NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079048

Metagenome Family F079048

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079048
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 45 residues
Representative Sequence MITRHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPMEYDGS
Number of Associated Samples 103
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 97.41 %
% of genes near scaffold ends (potentially truncated) 99.14 %
% of genes from short scaffolds (< 2000 bps) 90.52 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.724 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.276 % of family members)
Environment Ontology (ENVO) Unclassified
(24.138 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.724 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00296Bac_luciferase 2.59
PF00903Glyoxalase 2.59
PF00106adh_short 1.72
PF00496SBP_bac_5 1.72
PF14226DIOX_N 1.72
PF08669GCV_T_C 1.72
PF04909Amidohydro_2 1.72
PF00005ABC_tran 0.86
PF00311PEPcase 0.86
PF01075Glyco_transf_9 0.86
PF01053Cys_Met_Meta_PP 0.86
PF13738Pyr_redox_3 0.86
PF08352oligo_HPY 0.86
PF00529CusB_dom_1 0.86
PF01872RibD_C 0.86
PF00866Ring_hydroxyl_B 0.86
PF12903DUF3830 0.86
PF07690MFS_1 0.86
PF13193AMP-binding_C 0.86
PF02668TauD 0.86
PF00872Transposase_mut 0.86
PF01722BolA 0.86
PF13360PQQ_2 0.86
PF00535Glycos_transf_2 0.86
PF01588tRNA_bind 0.86
PF02885Glycos_trans_3N 0.86
PF03480DctP 0.86
PF05598DUF772 0.86
PF00732GMC_oxred_N 0.86
PF13610DDE_Tnp_IS240 0.86
PF01979Amidohydro_1 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.59
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.86
COG55173-phenylpropionate/cinnamic acid dioxygenase, small subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.86
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.86
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.86
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.86
COG2517Predicted RNA-binding protein, contains C-terminal EMAP domainGeneral function prediction only [R] 0.86
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 0.86
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.86
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.86
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.86
COG0073tRNA-binding EMAP/Myf domainTranslation, ribosomal structure and biogenesis [J] 0.86
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.86
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.86
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.86
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.86
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.86
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.86
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.86
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.86
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.86
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.72 %
All OrganismsrootAll Organisms48.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10042191All Organisms → cellular organisms → Bacteria2840Open in IMG/M
3300002245|JGIcombinedJ26739_101554587All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300004152|Ga0062386_101046649All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300004152|Ga0062386_101284446Not Available609Open in IMG/M
3300005177|Ga0066690_10164081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1466Open in IMG/M
3300005184|Ga0066671_10809126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300005332|Ga0066388_101237449Not Available1280Open in IMG/M
3300005356|Ga0070674_100531073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria984Open in IMG/M
3300005437|Ga0070710_10087387Not Available1832Open in IMG/M
3300005575|Ga0066702_10901335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1527Open in IMG/M
3300005614|Ga0068856_100789191All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005764|Ga0066903_107911754Not Available546Open in IMG/M
3300006028|Ga0070717_12018952Not Available519Open in IMG/M
3300006174|Ga0075014_100861710Not Available540Open in IMG/M
3300006175|Ga0070712_100547507All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300006237|Ga0097621_100995455Not Available784Open in IMG/M
3300006755|Ga0079222_11489323All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300006755|Ga0079222_12012326Not Available568Open in IMG/M
3300006794|Ga0066658_10301222All Organisms → cellular organisms → Bacteria → Proteobacteria857Open in IMG/M
3300006794|Ga0066658_10679857Not Available567Open in IMG/M
3300006796|Ga0066665_10929058Not Available672Open in IMG/M
3300006797|Ga0066659_10694301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2831Open in IMG/M
3300006800|Ga0066660_11465416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1536Open in IMG/M
3300009038|Ga0099829_10673249Not Available860Open in IMG/M
3300009090|Ga0099827_11408675Not Available607Open in IMG/M
3300009177|Ga0105248_10704303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → Roseicella frigidaeris1139Open in IMG/M
3300009553|Ga0105249_13216514Not Available525Open in IMG/M
3300010046|Ga0126384_11715804Not Available594Open in IMG/M
3300010361|Ga0126378_12261692All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300010376|Ga0126381_100826046Not Available1331Open in IMG/M
3300010398|Ga0126383_13083659Not Available544Open in IMG/M
3300011270|Ga0137391_10108825All Organisms → cellular organisms → Bacteria2403Open in IMG/M
3300011270|Ga0137391_10573656All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300012096|Ga0137389_11457157Not Available580Open in IMG/M
3300012199|Ga0137383_10445821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2948Open in IMG/M
3300012212|Ga0150985_111841237Not Available644Open in IMG/M
3300012924|Ga0137413_10452266All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300012951|Ga0164300_10500966All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012988|Ga0164306_11932395Not Available513Open in IMG/M
3300013766|Ga0120181_1051167Not Available931Open in IMG/M
3300014157|Ga0134078_10188908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria834Open in IMG/M
3300014497|Ga0182008_10207359Not Available999Open in IMG/M
3300014969|Ga0157376_10329935All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300015373|Ga0132257_103341050Not Available584Open in IMG/M
3300016294|Ga0182041_10548617Not Available1009Open in IMG/M
3300016371|Ga0182034_10217865All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300016387|Ga0182040_10135898Not Available1730Open in IMG/M
3300016422|Ga0182039_10187323Not Available1639Open in IMG/M
3300017792|Ga0163161_11925990All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria526Open in IMG/M
3300018073|Ga0184624_10484448Not Available539Open in IMG/M
3300018431|Ga0066655_11126877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1551Open in IMG/M
3300018433|Ga0066667_10059820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2350Open in IMG/M
3300018433|Ga0066667_10186078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1510Open in IMG/M
3300018920|Ga0190273_11877487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae549Open in IMG/M
3300020579|Ga0210407_10929494Not Available666Open in IMG/M
3300020580|Ga0210403_10608564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales882Open in IMG/M
3300020582|Ga0210395_10168030Not Available1641Open in IMG/M
3300020583|Ga0210401_11417631Not Available552Open in IMG/M
3300021168|Ga0210406_11026461Not Available612Open in IMG/M
3300021170|Ga0210400_10564026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae939Open in IMG/M
3300021178|Ga0210408_10571751Not Available896Open in IMG/M
3300021178|Ga0210408_10965668Not Available661Open in IMG/M
3300021180|Ga0210396_11243492All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300021406|Ga0210386_11478884Not Available567Open in IMG/M
3300021478|Ga0210402_11783740Not Available541Open in IMG/M
3300021479|Ga0210410_10712387All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300021560|Ga0126371_10669773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1186Open in IMG/M
3300021560|Ga0126371_13136785Not Available559Open in IMG/M
3300025915|Ga0207693_10121738Not Available2049Open in IMG/M
3300025915|Ga0207693_10487520Not Available962Open in IMG/M
3300025922|Ga0207646_11927826Not Available503Open in IMG/M
3300025929|Ga0207664_11968916Not Available507Open in IMG/M
3300025942|Ga0207689_10225212All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300025960|Ga0207651_11736791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales562Open in IMG/M
3300026308|Ga0209265_1079772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2934Open in IMG/M
3300026527|Ga0209059_1266748All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300026530|Ga0209807_1113502Not Available1137Open in IMG/M
3300027583|Ga0209527_1085653All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300027701|Ga0209447_10194759Not Available554Open in IMG/M
3300027846|Ga0209180_10020704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3484Open in IMG/M
3300027862|Ga0209701_10634476Not Available561Open in IMG/M
3300027882|Ga0209590_10632141Not Available688Open in IMG/M
3300028906|Ga0308309_10797736All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031128|Ga0170823_16512762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300031231|Ga0170824_113527354Not Available766Open in IMG/M
3300031474|Ga0170818_104087123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales818Open in IMG/M
3300031474|Ga0170818_107175907Not Available547Open in IMG/M
3300031573|Ga0310915_10056211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2556Open in IMG/M
3300031680|Ga0318574_10395481Not Available807Open in IMG/M
3300031681|Ga0318572_10700877Not Available603Open in IMG/M
3300031744|Ga0306918_10039350All Organisms → cellular organisms → Bacteria3063Open in IMG/M
3300031744|Ga0306918_10164266All Organisms → cellular organisms → Bacteria → Proteobacteria1650Open in IMG/M
3300031744|Ga0306918_10694675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300031747|Ga0318502_10577125Not Available676Open in IMG/M
3300031748|Ga0318492_10042805All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300031782|Ga0318552_10321683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300031798|Ga0318523_10421119Not Available663Open in IMG/M
3300031805|Ga0318497_10188087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1139Open in IMG/M
3300031880|Ga0318544_10447909Not Available503Open in IMG/M
3300031942|Ga0310916_10880699All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300031954|Ga0306926_12883589Not Available517Open in IMG/M
3300031962|Ga0307479_11517759Not Available627Open in IMG/M
3300031996|Ga0308176_12407989All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300032001|Ga0306922_10093636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883169Open in IMG/M
3300032001|Ga0306922_11507381Not Available672Open in IMG/M
3300032043|Ga0318556_10248179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300032054|Ga0318570_10357166Not Available665Open in IMG/M
3300032064|Ga0318510_10073281All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300032076|Ga0306924_11595901Not Available688Open in IMG/M
3300032090|Ga0318518_10045035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882078Open in IMG/M
3300032091|Ga0318577_10088265Not Available1441Open in IMG/M
3300032174|Ga0307470_11147502Not Available628Open in IMG/M
3300032261|Ga0306920_100064622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5346Open in IMG/M
3300032261|Ga0306920_104226901Not Available517Open in IMG/M
3300033158|Ga0335077_10978727Not Available846Open in IMG/M
3300033475|Ga0310811_10479874Not Available1314Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.45%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.86%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.86%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1004219143300001356Peatlands SoilMHAEDSTRRGWSRRGFLQGSAAALAGAYGMAPRYGLAADIPLQYDG
JGIcombinedJ26739_10155458723300002245Forest SoilMITRHQGRTSWSRRDMLRGSAAALMGVYGSAPRYGL
Ga0062386_10104664923300004152Bog Forest SoilMIIRHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPME
Ga0062386_10128444613300004152Bog Forest SoilMIIRHPARTSWSRRDVLRGSAAALMGAYRLAPRYGLAADIPTEYDGSK
Ga0066690_1016408133300005177SoilMITRHPAGTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIALE
Ga0066671_1080912613300005184SoilMITRHSASIGWSRRDMLRGSAAALLGAYGLAPRYGLAADIPME
Ga0066388_10123744913300005332Tropical Forest SoilMSTRRSARSTLSRRDMLLGSAAALMGGYGLAPRYGLAADIP
Ga0070674_10053107313300005356Miscanthus RhizosphereMASIRHPARTNWSRRDMLRGSAAALMGAYGLAPRYGLAADIPTEYDGSKFQMAAPE
Ga0070710_1008738743300005437Corn, Switchgrass And Miscanthus RhizosphereMNTRHPARAGWSRRDMLRGSAAALMGAYGLAPRYGLAADIPT
Ga0066702_1090133513300005575SoilMTTRHPARTNWSRRDILRGGSATALMGAYGFAPRYGLAAD
Ga0068856_10078919123300005614Corn RhizosphereMNIKQTARTSLSRRDMLIGSAAALLGTYGLAPRYGLAADVPLEYD
Ga0066903_10791175423300005764Tropical Forest SoilMNTRRPAPTSFSRRDVLWGGAAALMGAYGLAPRYGLAADIP
Ga0070717_1201895213300006028Corn, Switchgrass And Miscanthus RhizosphereMNTKHPARAGWSRRDMLRGSAAALMGAYGLAPRYGLAAD
Ga0075014_10086171023300006174WatershedsMDTKYPARTGWSRRDVLRGSTAAIMGIYGLAPRYGLAADIPYEYDGSKFQMAA
Ga0070712_10054750723300006175Corn, Switchgrass And Miscanthus RhizosphereMKTRRPACTSLSRRDMLLGGAAALMGVYGLAPRYGLAADIPMEYD
Ga0097621_10099545533300006237Miscanthus RhizosphereMSISDPTTTGWSRRDMLRGSLAALMGAYGIAPRYGLAADIPYEYDGSK
Ga0079222_1148932323300006755Agricultural SoilMTTRHPAHTSWSRRDILRGGSAAALMGAYGLAPRYGLAADIPMEYDG
Ga0079222_1201232623300006755Agricultural SoilMITRHPARTSWSRRDMLRGGAAALMGAYGLAPRYGLGADIPMEYDGSKFQM
Ga0066658_1030122213300006794SoilMTTRHPARTNWSRRDILRGGSAAALMGAYGFAPRYGLAAD
Ga0066658_1067985713300006794SoilMITRHPARTSWSRRDMLRGSAAALMGAYGFAPRYGLAAD
Ga0066665_1092905823300006796SoilMITRHPVRTGWSRRDMLLGSAAASMGGYGLAPRYGLAADIPMEYDGSKFQM
Ga0066659_1069430133300006797SoilMTTRHPARTNWSRRDILRGGSAAALMGAYGFAPRYGLAADVPTEYDGSKFQM
Ga0066660_1146541613300006800SoilMTTRHPARTNWSRRDILRGGSATALMGAYGFAPRYGLAADIPTEYDGSKFQM
Ga0099829_1067324923300009038Vadose Zone SoilMIIRHPARTSWSRRDVLRGSAAASMGAYGLAPGYGLAADIPME
Ga0099827_1140867513300009090Vadose Zone SoilMNTWHPARTSWSRRDILRAAALMGAYGLAPRYGLAADIP
Ga0105248_1070430323300009177Switchgrass RhizosphereMITRRRERTDWSRRDMLLGSAAALGVYGLAPRYGLAADVPLEY
Ga0105249_1321651413300009553Switchgrass RhizosphereMASIRHPARTNWSRRDMLRGSAAALMGAYGLAPRY
Ga0126384_1171580423300010046Tropical Forest SoilMEDTGMMNTRHPACSSLSRRDVLLGSAAALMGAYGLAPRYGLAADVPLEYDGSK
Ga0126378_1226169223300010361Tropical Forest SoilMNTRPPLRPNWSRRDVLRGSAAALLGAYGLAPRYGLAADIPLEYDGS
Ga0126381_10082604613300010376Tropical Forest SoilMEDTGMMNTRHPACSSLSRRDVLLGSAAALMGAYGLAPRYGLAADVPLEYDGSKFQMAAP
Ga0126383_1308365923300010398Tropical Forest SoilMITRHPARTSWSRRDLLRGSAAALMGAYGLAPRYGFAADIPME
Ga0137391_1010882513300011270Vadose Zone SoilMITKHPARTIWSRRDMLRGSAAALMGAYGLAPRYG
Ga0137391_1057365633300011270Vadose Zone SoilMIIRHPARTSWSRRDVLRGSAAAMMGAYGLAPRYGLAADIPM
Ga0137389_1145715713300012096Vadose Zone SoilMITRHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPMEYDGS
Ga0137383_1044582123300012199Vadose Zone SoilMTTRHPARTNWSRRDILRGGSAAALMGAYGFAPRYGLAADVPTEYDGSKFQMAA
Ga0150985_11184123713300012212Avena Fatua RhizosphereMNREHLTHTPWPRRDMLRAGAAALLGAYGLAPRYGLAADVPFDYDGSK
Ga0137413_1045226633300012924Vadose Zone SoilMIIRHPARTSWSRRDVLRGSAAELLRAYGLASRYGLAA
Ga0164300_1050096613300012951SoilQREDIHAMKTIHPTRIEWSRRDMLRGSIAALMGGYGLAPRYGLAADIPTECDG*
Ga0164306_1193239513300012988SoilMNSNHPLRTAWSRRDMLRGSAAALMGAYGLAPRFGLAAD
Ga0120181_105116713300013766PermafrostMIIRHPAPTSWSRRDVLRGSAAALMVAYGLAPRYG
Ga0134078_1018890823300014157Grasslands SoilMTTRHPARTSWSRRDILYGGSAAALMGAYGLAPRYGLAADIPTEYDG*
Ga0182008_1020735913300014497RhizosphereMTRHPARTSWSRRDILRGGSAAALMGAYGLAPRYG
Ga0157376_1032993533300014969Miscanthus RhizosphereMSISDPTTTGWSRRDMLRGSLAALMGAYGIAPRYG
Ga0132257_10334105013300015373Arabidopsis RhizosphereMNTNHLLRTAWSRRDMLRGSAAALMGAYGLAPRFGLAADIPYEYDGSK
Ga0182041_1054861733300016294SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKFQ
Ga0182034_1021786523300016371SoilMNTRQPAHTGMTRRDMLRGSAAALMGAYGLAPRDGL
Ga0182040_1013589813300016387SoilMNIKHPARTSLSRRDMLRGGAAALMGAYGLAPRYGLAADVPMEYD
Ga0182039_1018732333300016422SoilMNIKHPARTSLSRRDMLRGGAAALMGAYGLAPRYGLAADVPMEYDGTK
Ga0163161_1192599013300017792Switchgrass RhizosphereMITRRRARTDWSRRDMLLGSAAALGVYGLAPRYGLAADVP
Ga0184624_1048444813300018073Groundwater SedimentMEAKHPTPTGWSRRDMLRGSAVAMLGAYGLAPRYGLAAD
Ga0066655_1112687713300018431Grasslands SoilMTTRHSARTDWSRRDILRGGSAAALMGAYGFAPRYGLAADIPTEYDGSKFQ
Ga0066667_1005982033300018433Grasslands SoilMTTRHPSRTNWSRRDILRGGSAAALMGPYGFAPRYGLAADIPTEYDGSKFQMAAPE
Ga0066667_1018607843300018433Grasslands SoilMHPSRTSWSRRDMLRGSAAALMGAYGLAARYGLAADIPMEY
Ga0190273_1187748713300018920SoilMSTSKSMNLGWSRRDMLRGAAALLGGYGLAPRYGLAADIPYQYDGSN
Ga0210407_1092949413300020579SoilMNTKHPARAGWSRRDMLRGSAAALMGAYGLAPRYGLAADIPTEY
Ga0210403_1060856413300020580SoilMNTRHPARTDWSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYDGSTF
Ga0210395_1016803013300020582SoilMVSRHSACAGWSRRDVLLGGAAAVVGAYGLGPRYSLAADIPLEYDGS
Ga0210401_1141763113300020583SoilMITRHPARTSWSRRDMLRGSAAALMGAYGLAPRYGLAADIP
Ga0210406_1102646113300021168SoilMKTRRPACTSLSRRDMLLGSAAALMGVYGLAPRYGLAADIPMEYD
Ga0210400_1056402633300021170SoilMAPSRRTTRRNVIAGWSRRDVLRGSAAAIMGAYDLAPRYGLAADIPYEYDGSRFQ
Ga0210408_1057175113300021178SoilMNTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGL
Ga0210408_1096566813300021178SoilMNTRLPARTGWSRRDVLRGSAAALMGAYGLAPRYGLAADVPLDY
Ga0210396_1124349223300021180SoilMITRHPTRTSWSRRDMLRGSAAALMGAYGLAPRYGLAADIPTEYD
Ga0210386_1147888413300021406SoilMMNTRHPAPTSWSRRDVLRGSAAALMGAYGLAPRFGLADDIPMEYDGS
Ga0210402_1178374013300021478SoilMITRHPARTSWSRRDMLRGSAAALMGAYGLAPRYGFAADIPMEYDGSKFQ
Ga0210410_1071238723300021479SoilMITKHPARTNWTRRDMLRGSAAALMGAYGLAPRYGLAADIPLEYDGSKFQMAAL
Ga0126371_1066977333300021560Tropical Forest SoilMNTRLPARTGWSRRDVLRGSAAALLGAYGFAPRYGLAADVQLEYDGSKFQM
Ga0126371_1313678513300021560Tropical Forest SoilMHTDELTRAAWSRRDMLRGSAVALIGAYALAPRYGLAADIPYEYDGSKFQMAA
Ga0207693_1012173833300025915Corn, Switchgrass And Miscanthus RhizosphereMNTRHPARAGWSRRDMLRGSAAALMGAYGLAPRYGLAAD
Ga0207693_1048752013300025915Corn, Switchgrass And Miscanthus RhizosphereMNTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLA
Ga0207646_1192782613300025922Corn, Switchgrass And Miscanthus RhizosphereMITRYPARASWSRRDVLRGSAAALMGAYGLAPRYGLAADIPTEFDGSKFQMA
Ga0207664_1196891613300025929Agricultural SoilMNTKHPARAGWSRRDMLRGSAAALMGAYGLAPRYGLAADIPT
Ga0207689_1022521213300025942Miscanthus RhizosphereMNIKHPSRSGLSRRDMLLGSAVALLGTYGLAPRYGLAADVPLEYDGSKF
Ga0207651_1173679113300025960Switchgrass RhizosphereMITRRRARTDWSRRDMLLGSAAALGVYGLAPRYGLAADVPLEYDGSKFQMAAPE
Ga0209265_107977213300026308SoilMTTRHPARTNWSRRDILYGGSAAALMGAYGFAPRYGLAADVPTEYDGSKFQMAAP
Ga0209059_126674833300026527SoilMHPSRTSWSRRDMLRGSAAALMGAYGLAPRYGLAADIPTEYDGSKFQMA
Ga0209807_111350223300026530SoilMTTRHPARTNWSRRDILRGGSAAALMGAYGFAPRYGLAADVPTEYDGSKFQMA
Ga0209527_108565313300027583Forest SoilMITRYPARASWSRRDVLRGSAAALMGAYGLAPRYGLAADIPTEFDGSKFQ
Ga0209447_1019475913300027701Bog Forest SoilMNIRHPARTNWSRRDMLRGSVAALLGAYGLAPRYGLAADVPMEYDGSKFQIA
Ga0209180_1002070413300027846Vadose Zone SoilMIARHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPLEYDG
Ga0209701_1063447613300027862Vadose Zone SoilMIIRHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKFQI
Ga0209590_1063214123300027882Vadose Zone SoilMIIRHPARTSWSRRDVLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKFQIAAPEDLVARIGR
Ga0308309_1079773613300028906SoilMITRHPTRTSWSRRDMLRGSAAALMGAYGLAPRYGLAADIPTEYDGSKFQMAAP
Ga0170823_1651276213300031128Forest SoilMNTRHHARTNLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKFQ
Ga0170824_11352735423300031231Forest SoilMSTRHPTRTNWSRRDMLRGSAAALLGAYGLAPRYGLAADIPLEYDGSKFQ
Ga0170818_10408712313300031474Forest SoilMNTRHPARTDWSRRDVLRGSAAALMGAYGLTPRYGLAADVPLEYDGSKFQ
Ga0170818_10717590713300031474Forest SoilMASSRGTTRRNDIAGWSRRDVLRGSAAAIMGAYGLVPRYGLAADIPYEYD
Ga0310915_1005621113300031573SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKF
Ga0318574_1039548133300031680SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYG
Ga0318572_1070087723300031681SoilMNTRHPARRVWSRREMLRGSAAALLGASGFAPRYGLAADVPLEYDG
Ga0306918_1003935013300031744SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYDG
Ga0306918_1016426613300031744SoilMNSRHPAHTAWSRRDVLRGGAAALMGAYGLAPRYG
Ga0306918_1069467523300031744SoilMNIRHPARNRLSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYD
Ga0318502_1057712513300031747SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYD
Ga0318492_1004280533300031748SoilMNTRQPAHTGMTRRDMLRGSAAALMGAYGLAPRDGLAADVPLE
Ga0318552_1032168333300031782SoilMNTRRPALTGWSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYD
Ga0318523_1042111913300031798SoilMNIKHPARTSLSRRDMLRGGAAALMGAYGLAPRYGLAADVPMEYDG
Ga0318497_1018808733300031805SoilMNTRRPALTGWSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYDGSKFQ
Ga0318544_1044790933300031880SoilMNSRHPAHTAWSRRDVLRGGAAALMGAYGLAPRYGLAADV
Ga0310916_1088069913300031942SoilMNTGHPARTILSRRDMLLGSAAALMGAYGLAPRYGLAA
Ga0306926_1288358913300031954SoilMNTRHPARTILSRRDMLLGSAAALMGAYGLAPRYGLAAD
Ga0307479_1151775913300031962Hardwood Forest SoilMNPGQPTPAIWSRRDVFRGSAAALIAAYGLAPRYGLAADIPTEFDGSSFQ
Ga0308176_1240798913300031996SoilMKTSHPTRIGLSRRDMLLGSAVGLMGAYGLAPRYGLAADI
Ga0306922_1009363613300032001SoilMNIRHPARNRLSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYDGSK
Ga0306922_1150738113300032001SoilMNINHSTSAAWSRRNMLRGAVTAMMGAYGLAPRYGLAADISYEFDG
Ga0318556_1024817933300032043SoilMNTRRPALTGWSRRDVLRGSAAALMGAYGLAPRYGLAADV
Ga0318570_1035716633300032054SoilMNTRRPALTGWSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEY
Ga0318510_1007328133300032064SoilMNTRHPARTSLSRRDVLLGSAAALMGAYGLAPRYGLAADIPLEYDGSKF
Ga0306924_1159590113300032076SoilMNTRHPARRVWSRREMLRGSAAALLGASGFAPRYGLAADVPLEYD
Ga0318518_1004503533300032090SoilMNIRHPARNRLSRRDVLRGSAAALMGAYGLAPRYGLAADVPLEYDGSKF
Ga0318577_1008826513300032091SoilMNIRHPARNRLSRRDVLRGSAAALMGAYGLAPRYGLAADVP
Ga0307470_1114750223300032174Hardwood Forest SoilMITRHPTRISLSRRDMLRGSAATLMGTYGLAPRYGLAA
Ga0306920_10006462293300032261SoilMDTRHPARTSLSRRDMLRGSAAALMGAYGLAPRYGLAADIPMEYDGSKFQIA
Ga0306920_10422690123300032261SoilMNTRHPARNILSRRDVLWGSAALMGAYGLAPRYGLAADIPLEYDGSKFQM
Ga0335077_1097872713300033158SoilMKIRHPARNSWSRREMLLGSAAALMGAYGLAPRYGL
Ga0310811_1047987423300033475SoilMTTRHPAHTSWSRRDILRGGSAAALMGAYGLAPRYGLAADIPMEYDGSKF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.