| Basic Information | |
|---|---|
| Family ID | F079032 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.61 % |
| % of genes near scaffold ends (potentially truncated) | 95.69 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.552 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF05378 | Hydant_A_N | 31.90 |
| PF00005 | ABC_tran | 23.28 |
| PF01321 | Creatinase_N | 8.62 |
| PF00557 | Peptidase_M24 | 8.62 |
| PF03401 | TctC | 6.03 |
| PF02538 | Hydantoinase_B | 1.72 |
| PF09084 | NMT1 | 0.86 |
| PF02423 | OCD_Mu_crystall | 0.86 |
| PF13924 | Lipocalin_5 | 0.86 |
| PF02668 | TauD | 0.86 |
| PF03480 | DctP | 0.86 |
| PF06347 | SH3_4 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 63.79 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 8.62 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 6.03 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 3.45 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.86 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.55 % |
| Unclassified | root | N/A | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004268|Ga0066398_10187905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300004281|Ga0066397_10014392 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005332|Ga0066388_102621954 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005332|Ga0066388_103233072 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005332|Ga0066388_105950034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300005332|Ga0066388_107734475 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005555|Ga0066692_10080763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. | 1887 | Open in IMG/M |
| 3300005586|Ga0066691_10479176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300005764|Ga0066903_101506259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. | 1270 | Open in IMG/M |
| 3300005764|Ga0066903_104225206 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005764|Ga0066903_108027373 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005921|Ga0070766_10510003 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006047|Ga0075024_100198470 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006057|Ga0075026_100640471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 629 | Open in IMG/M |
| 3300006175|Ga0070712_100452838 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300006175|Ga0070712_101416003 | Not Available | 607 | Open in IMG/M |
| 3300006176|Ga0070765_102285660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300006604|Ga0074060_11108075 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006800|Ga0066660_11122725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300006844|Ga0075428_102374104 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006969|Ga0075419_11441767 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009525|Ga0116220_10418449 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009792|Ga0126374_10475198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300010041|Ga0126312_11429937 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010043|Ga0126380_10219465 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300010046|Ga0126384_10709399 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010337|Ga0134062_10476761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300010359|Ga0126376_10956003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300010359|Ga0126376_11188503 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010360|Ga0126372_10405090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300010362|Ga0126377_10818258 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300010376|Ga0126381_104269175 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010398|Ga0126383_10516781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300010398|Ga0126383_10732077 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300012200|Ga0137382_10614010 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012205|Ga0137362_10373102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
| 3300012205|Ga0137362_11601277 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012210|Ga0137378_10522815 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300012908|Ga0157286_10429406 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012917|Ga0137395_10092733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1992 | Open in IMG/M |
| 3300012925|Ga0137419_10371807 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300012930|Ga0137407_12237118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300012944|Ga0137410_10708881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300012948|Ga0126375_11507610 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014969|Ga0157376_10479324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 1219 | Open in IMG/M |
| 3300015242|Ga0137412_11068415 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300015371|Ga0132258_10825580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2338 | Open in IMG/M |
| 3300015372|Ga0132256_102471493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 621 | Open in IMG/M |
| 3300015373|Ga0132257_100408976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 1651 | Open in IMG/M |
| 3300015373|Ga0132257_102587648 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300016270|Ga0182036_11492059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 567 | Open in IMG/M |
| 3300016371|Ga0182034_10945822 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300016387|Ga0182040_10022962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3503 | Open in IMG/M |
| 3300016404|Ga0182037_10084382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2241 | Open in IMG/M |
| 3300016422|Ga0182039_11006827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 747 | Open in IMG/M |
| 3300016422|Ga0182039_11475092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300018054|Ga0184621_10269769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 603 | Open in IMG/M |
| 3300018466|Ga0190268_11856210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 546 | Open in IMG/M |
| 3300018469|Ga0190270_10084389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 2370 | Open in IMG/M |
| 3300018482|Ga0066669_12179608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 525 | Open in IMG/M |
| 3300020581|Ga0210399_11319640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 567 | Open in IMG/M |
| 3300021170|Ga0210400_10407386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1122 | Open in IMG/M |
| 3300021170|Ga0210400_10465174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1044 | Open in IMG/M |
| 3300021170|Ga0210400_11329034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300021171|Ga0210405_10692724 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300021180|Ga0210396_10530314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1028 | Open in IMG/M |
| 3300021403|Ga0210397_10773736 | Not Available | 740 | Open in IMG/M |
| 3300021433|Ga0210391_11322300 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021479|Ga0210410_11393349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 594 | Open in IMG/M |
| 3300021560|Ga0126371_10191445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2136 | Open in IMG/M |
| 3300022694|Ga0222623_10367052 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300026295|Ga0209234_1302864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300026314|Ga0209268_1056524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1229 | Open in IMG/M |
| 3300026481|Ga0257155_1048413 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300026508|Ga0257161_1024409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300026514|Ga0257168_1083971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300026542|Ga0209805_1326758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300027388|Ga0208995_1088150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 541 | Open in IMG/M |
| 3300027646|Ga0209466_1018650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1449 | Open in IMG/M |
| 3300027646|Ga0209466_1027808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1164 | Open in IMG/M |
| 3300027680|Ga0207826_1222744 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027701|Ga0209447_10202827 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027826|Ga0209060_10549934 | Not Available | 523 | Open in IMG/M |
| 3300027895|Ga0209624_10992113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 545 | Open in IMG/M |
| 3300027909|Ga0209382_11180192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 784 | Open in IMG/M |
| 3300028799|Ga0307284_10432264 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300028906|Ga0308309_10681440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 893 | Open in IMG/M |
| 3300030618|Ga0311354_10375824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 1442 | Open in IMG/M |
| 3300031544|Ga0318534_10062188 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300031544|Ga0318534_10527147 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031545|Ga0318541_10004843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. J32 | 5593 | Open in IMG/M |
| 3300031561|Ga0318528_10542252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031561|Ga0318528_10663557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031681|Ga0318572_10582518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 667 | Open in IMG/M |
| 3300031724|Ga0318500_10208475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 938 | Open in IMG/M |
| 3300031744|Ga0306918_10933405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300031744|Ga0306918_11097313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300031764|Ga0318535_10049068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 1756 | Open in IMG/M |
| 3300031769|Ga0318526_10347331 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031799|Ga0318565_10272088 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031835|Ga0318517_10294993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
| 3300031835|Ga0318517_10386164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300031890|Ga0306925_10359972 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300031910|Ga0306923_10466021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1432 | Open in IMG/M |
| 3300031910|Ga0306923_12168066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300031945|Ga0310913_10512219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 852 | Open in IMG/M |
| 3300031947|Ga0310909_10900396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
| 3300031959|Ga0318530_10283615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300032068|Ga0318553_10146919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1219 | Open in IMG/M |
| 3300032074|Ga0308173_12124730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300032160|Ga0311301_10554914 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300032180|Ga0307471_102359799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300032782|Ga0335082_10944527 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300033289|Ga0310914_10277683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300033289|Ga0310914_11401420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066398_101879051 | 3300004268 | Tropical Forest Soil | YDAQMPSFSADGAWDPKAIEVIRHSLKDLGILPQVPDAKAIYNGKFVPVKF* |
| Ga0066397_100143922 | 3300004281 | Tropical Forest Soil | SDGAWSPVAIDVIRHSLKELGILPVVPEAKTIYNDKFVPVKF* |
| Ga0066388_1026219542 | 3300005332 | Tropical Forest Soil | AWSPAAIDVIRHSLKELGILASVPEAKAIYNDKFVPVKF* |
| Ga0066388_1032330721 | 3300005332 | Tropical Forest Soil | TDGAWDPASIEVIRNSLKELEILDFVPEAKTIYNDQFVPVKF* |
| Ga0066388_1059500342 | 3300005332 | Tropical Forest Soil | AWNPAAIEVIRHSLKELGILPVVPEAKTIYNDQFVPVRF* |
| Ga0066388_1077344751 | 3300005332 | Tropical Forest Soil | QIGSFSSDGAWDPVAIDVIRNSLKELGILDFVPEAKTIYNDKFVPVQI* |
| Ga0066692_100807633 | 3300005555 | Soil | GAWNPAAIDVIRHSLKELGILSVEPEAKAISNDQFVPVRF* |
| Ga0066691_104791762 | 3300005586 | Soil | GFSGDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF* |
| Ga0066903_1015062591 | 3300005764 | Tropical Forest Soil | PAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF* |
| Ga0066903_1042252061 | 3300005764 | Tropical Forest Soil | AIDVIRNSLKELGILDFVPEAKTIYNDKFVPVKI* |
| Ga0066903_1080273732 | 3300005764 | Tropical Forest Soil | DGAWDPKAIEVIRHSLKELGILPEVPDAKALYNDKFVPVKF* |
| Ga0070766_105100032 | 3300005921 | Soil | SRAMDVIASSLKELGILPVVPDAKALYTDKFVPVKF* |
| Ga0066652_1010815912 | 3300006046 | Soil | KVYDTQIGSFSADGAWDMQSIDVIRNSLKELGILDFIPEAKVIYNDKFVPVKF* |
| Ga0075024_1001984702 | 3300006047 | Watersheds | DPVAIDVIRKSLKELGILDAVPEAKTIYNDKFVPVKLAQ* |
| Ga0075026_1006404712 | 3300006057 | Watersheds | DGAWDPVAIDVIRNSLKELGILDTVPEAKTIYNDKFVPVKLAQ* |
| Ga0070712_1004528381 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | WSAAAIDVIRRSLKELGTLDHVPDANTIHNDKFVPVKF* |
| Ga0070712_1014160032 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DGAWDPAAIDVIRHSLKELGILLAVPDAKDLYTNKFVPVKF* |
| Ga0070765_1022856602 | 3300006176 | Soil | GAWDPAAIDVIRNSLKDLGILDTVPAAKTLYNDQFVPVKF* |
| Ga0074060_111080752 | 3300006604 | Soil | FSADGAWDMQSIDVIRNSLKDLGILDFVPEAKVIYNDKFVPVKF* |
| Ga0066660_111227252 | 3300006800 | Soil | PAAIDVIRHSLKELGILPTVPDAKAIYNDTFVPVKF* |
| Ga0075428_1023741042 | 3300006844 | Populus Rhizosphere | AQVNGFSRDGAWDPVAIEVIRKSLKDLGILDSLPDARTIYNDKFVPVKL* |
| Ga0075419_114417672 | 3300006969 | Populus Rhizosphere | EAQMAGFSPDGAWSPVAIDVIRHSLKELGILASVPEAKAIYNDKFVPVKF* |
| Ga0116220_104184491 | 3300009525 | Peatlands Soil | AVDVIRSSLKELGILPVVPEANQLTTDKFVPVRF* |
| Ga0126374_104751982 | 3300009792 | Tropical Forest Soil | SLDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFAPVRF* |
| Ga0126312_114299371 | 3300010041 | Serpentine Soil | TQIGSFSTDGAWDPQAIEVIRHSLKDLGILDFVPEAKTIYNDKFVPVKL* |
| Ga0126380_102194651 | 3300010043 | Tropical Forest Soil | DVAAIDVIRQSLNELGILNRVPEPHELYTDKFVPVRF* |
| Ga0126384_107093992 | 3300010046 | Tropical Forest Soil | DVAAIDVIRLSLNELGILNRVPEPHELYTDKFVPVRF* |
| Ga0134062_104767612 | 3300010337 | Grasslands Soil | AGFSGDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF* |
| Ga0126376_109560032 | 3300010359 | Tropical Forest Soil | DAQMGGFSSDGAWDPKAIEVIRHSLKDLGILPEVPDAKAIYTDKFVPVRF* |
| Ga0126376_111885032 | 3300010359 | Tropical Forest Soil | PVAIDVIRNSLKELGILDFVPEAKTIYNDKFVPVQI* |
| Ga0126372_104050902 | 3300010360 | Tropical Forest Soil | AIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF* |
| Ga0126377_108182581 | 3300010362 | Tropical Forest Soil | NGAWDPVAIDVIRNSLKELGILDFIPEAKAIYNDKFVPVNL* |
| Ga0126381_1042691751 | 3300010376 | Tropical Forest Soil | GAWDMAAIDVIRHSLNELGILSRVPEAHEIYNDQFVPVTF* |
| Ga0126383_105167811 | 3300010398 | Tropical Forest Soil | SPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF* |
| Ga0126383_107320772 | 3300010398 | Tropical Forest Soil | VSIDVIRNSLKELGILDFIPEAKAIYNDKFVPVHL* |
| Ga0137382_106140102 | 3300012200 | Vadose Zone Soil | ASLDVIRNSLKELEILDFVPEAKTIYNDAFVPVKF* |
| Ga0137362_103731022 | 3300012205 | Vadose Zone Soil | FSVDGAWSPAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF* |
| Ga0137362_116012772 | 3300012205 | Vadose Zone Soil | WDPEAIDVIRSSLKELGILPAIPDAKALYTDRFVPVRF* |
| Ga0137378_105228151 | 3300012210 | Vadose Zone Soil | IGGFSTDGAWDMASLDVIRNSLKELEILDFVPEAKTIYNDAFVPVKF* |
| Ga0157286_104294061 | 3300012908 | Soil | WDAASIDVIRKSLVDLGILDKVPDAKTIYNDQFVPVKF* |
| Ga0137395_100927331 | 3300012917 | Vadose Zone Soil | IAGFSVDGAWSPAAIDVIRHSLKELGILSAVPEAKAIYNDQFVPVRF* |
| Ga0137419_103718072 | 3300012925 | Vadose Zone Soil | DPEAIDVIRSSLKELGILPAVPDAKALYTDRFVPVRF* |
| Ga0137407_122371181 | 3300012930 | Vadose Zone Soil | GAWSPAAIDVIRHSLKELGILSAVPEAKAIYNDQFVPVRF* |
| Ga0137410_107088811 | 3300012944 | Vadose Zone Soil | VYDTQIGSFSADGAWDMQSIDVIRNSLKDLGILDFVPEAKTIYNDKFVPVKF* |
| Ga0126375_115076102 | 3300012948 | Tropical Forest Soil | PVAIDVIRNSLKDLGILDFIPEAKAIYNDKFVPVNL* |
| Ga0157376_104793243 | 3300014969 | Miscanthus Rhizosphere | DTQIGSFSTDGAWDPEAIDVIRNSLKSLGILDFTPDAKVIYNDKFVPVKL* |
| Ga0137412_110684152 | 3300015242 | Vadose Zone Soil | AIDVIRSSLKELGILPAIPEAKALYTDRFVPVRF* |
| Ga0132258_108255801 | 3300015371 | Arabidopsis Rhizosphere | PKAIEVIRHSLKELGILPEVPEAKALYNDKFVPVKF* |
| Ga0132256_1024714932 | 3300015372 | Arabidopsis Rhizosphere | DAEVNGFSRDGSWDPVAIEVIRKSLKDLGILDSLPDARTIYNDKFVPVKL* |
| Ga0132257_1004089762 | 3300015373 | Arabidopsis Rhizosphere | SPDGAWSPVAIDVIRHSLKELGILATVPEAKAIYNDKFVPVKF* |
| Ga0132257_1025876482 | 3300015373 | Arabidopsis Rhizosphere | IGDFSTDGAWDPQSIDVIRNSLKDLGILDVVPDAKVIYNDKFVPVKF* |
| Ga0182036_114920591 | 3300016270 | Soil | AQIAGFSLDGTWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0182034_109458221 | 3300016371 | Soil | GAWDPEAIDVIRGSLKELGILPTVPEAKVLYNDKFVPVRF |
| Ga0182040_100229621 | 3300016387 | Soil | AAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0182037_100843822 | 3300016404 | Soil | SADGAWDPEAIDVIRASLKELGTLPTVPDAKAIYNDKFVPVKLQ |
| Ga0182039_110068272 | 3300016422 | Soil | DFSADGAWDPQAIDTIRNSLKDLGILNFVPEAKMIYNDKFVPVKF |
| Ga0182039_114750921 | 3300016422 | Soil | AQMTGFSADGAWDPKAIEVIRFSLKELGILPNVPDAKALYNDKFVPVKF |
| Ga0184621_102697691 | 3300018054 | Groundwater Sediment | TQMAHFSIDGAWDPVAIDVIRNSLKELGILDFIPEAKVIYNDKFVPVNL |
| Ga0190268_118562101 | 3300018466 | Soil | NGFSSDGAWDPVAIEVIRKSLKDLGILDSLPDARTIYNDKFVPVKF |
| Ga0190270_100843894 | 3300018469 | Soil | ESIEVIRRSLKDLGILDSLPDARTIYNDKFVPVKF |
| Ga0066669_121796081 | 3300018482 | Grasslands Soil | IANFSTDGAWDPVAIDVIRNSLKELGILDFIPEAKVIYNDKFVPVNL |
| Ga0210399_113196401 | 3300020581 | Soil | AQIGGFSNDGAFDPTAIDVIRRSLKELGILPAVPEAKSIYSDKFVPVRF |
| Ga0210400_104073862 | 3300021170 | Soil | FSVDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0210400_104651741 | 3300021170 | Soil | IAGFSADGAWDPKAIEVIRHSLKDLGILPSVPDAKAIYNDKFVPVKF |
| Ga0210400_113290341 | 3300021170 | Soil | AWDPAAIDVIRNSLKDLGILDTVPDAKTIYNDKFVPVKF |
| Ga0210405_106927241 | 3300021171 | Soil | EAIDVIRASLKELGILPAIPDAKALYTDKFVPVRF |
| Ga0210396_105303142 | 3300021180 | Soil | SDGAWDPAAIDVIRNSLKDLGILDTVPAAKTLYNDQFVPVKF |
| Ga0210397_107737361 | 3300021403 | Soil | EMPGFSIDGTWDPEVIDVIRASLKELDILPKIPDAKALYTDAFVPVRF |
| Ga0210391_113223002 | 3300021433 | Soil | EAIDVIRSSLKELGILPTVPDAKALYNDKFVPVRF |
| Ga0210410_113933492 | 3300021479 | Soil | SFSSDGAWDPVAIDAIRNSLKELGILDSVPDAKTIYNDKFVPVKF |
| Ga0126371_101914451 | 3300021560 | Tropical Forest Soil | VSIDVIRKSLKELGILDTIPDAKSIYNDKFVPVKF |
| Ga0222623_103670522 | 3300022694 | Groundwater Sediment | PAAIEVIRKSLKELGILDSLPDARTIYNDQFVPVKL |
| Ga0209234_13028642 | 3300026295 | Grasslands Soil | DGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0209268_10565242 | 3300026314 | Soil | ISGFSADGAWNPAAIDVIRHSLKELGILSVVPEAKAISNDQFVPVRF |
| Ga0257155_10484132 | 3300026481 | Soil | WDPEAIDVIRSSLKELGILPTIPDAKALYTDRFVPVRF |
| Ga0257161_10244091 | 3300026508 | Soil | AAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0257168_10839712 | 3300026514 | Soil | WSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0209805_13267582 | 3300026542 | Soil | VDGTWDAQSIDVIRNSLKDLGILNFVPEAKTIYNDKFVPVRF |
| Ga0208995_10881502 | 3300027388 | Forest Soil | AGCSPDGAWSPVAIDVIRHSLKELGILNTVPDAKTIYNDAFVPVTF |
| Ga0209466_10186501 | 3300027646 | Tropical Forest Soil | AQIAGFSVDGAWSPAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0209466_10278082 | 3300027646 | Tropical Forest Soil | SDGAWSPVAIDVIRHSLKELGILPVVPEAKTIYNDKFVPVKF |
| Ga0207826_12227441 | 3300027680 | Tropical Forest Soil | FSADGAWDGKAIEVIRQSLKELGILPEVPDAKDLYNDQFVPVTF |
| Ga0209447_102028272 | 3300027701 | Bog Forest Soil | ADGAWDPEAIDVIRASLKELGTLPTVPDAKALYTDKFVPVRF |
| Ga0209060_105499341 | 3300027826 | Surface Soil | WDPVSIDAILKSLKDLGIVETIPDAKSIYNDKFVPVKF |
| Ga0209624_109921131 | 3300027895 | Forest Soil | MSSATSTDGAWDKEAIDVIRASLKDLGILPAVPDAKALYTDKFVPVRF |
| Ga0209382_111801922 | 3300027909 | Populus Rhizosphere | SGDGAWDPVAIEVIRKSLKDLGILDSLPDARTIYNDKFVPVKL |
| Ga0307284_104322642 | 3300028799 | Soil | SADGAWDMQSIDVIRNSLKDLGILDFVPEAKVIYNDKFVPVKF |
| Ga0308309_106814402 | 3300028906 | Soil | STDGAWDPAAIDVIRNSLKDLGILDTVPEAKTIYNDKFVPVKF |
| Ga0311354_103758242 | 3300030618 | Palsa | GGFSADGAWDPEAIDVIRASLKELGTLPTIPDAKMLYNDKFVPVRF |
| Ga0318534_100621882 | 3300031544 | Soil | LAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0318534_105271472 | 3300031544 | Soil | PEAIDVIRASLKELGTLPTVPDAKAIYNDKFVPVKLQ |
| Ga0318541_100048435 | 3300031545 | Soil | AWSPAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0318528_105422522 | 3300031561 | Soil | HGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0318528_106635572 | 3300031561 | Soil | AWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0318572_105825181 | 3300031681 | Soil | FSVDGAWSPAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0318500_102084751 | 3300031724 | Soil | GFSADGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0306918_109334051 | 3300031744 | Soil | ADGTFNPAAIEVIRHSLKELGILNAVPEAKTIYNDKFVPVKY |
| Ga0306918_110973132 | 3300031744 | Soil | PAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0318535_100490682 | 3300031764 | Soil | GFSVDGAWSPAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0318526_103473312 | 3300031769 | Soil | GAWDPEAIDVIRASLKELGTLPTVPDAKAIYNDKFVPVKLQ |
| Ga0318565_102720881 | 3300031799 | Soil | PAAIDVIRHSLKELGILAAVPEAKAIYNDQFVPVRF |
| Ga0318517_102949932 | 3300031835 | Soil | GFSLDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0318517_103861642 | 3300031835 | Soil | QIAGFSVDGAWSPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0306925_103599721 | 3300031890 | Soil | WDSRAMNAIAASLKELGILPVVPDAKALYTDKFVPVKF |
| Ga0306923_104660211 | 3300031910 | Soil | TQIGSFSSDGVWDPVAIDVIRNSLKELGILDHVPDAKSIYNDQFVPVKL |
| Ga0306923_121680661 | 3300031910 | Soil | ADGAWDPQAIDVIRNSLKELGILNFVPEAKTIYNDKFVPVKF |
| Ga0310913_105122191 | 3300031945 | Soil | FSSDGAWDPVAIDVIRNSLKELGILDHVPDAKSIYNDQFVPVKL |
| Ga0310909_109003961 | 3300031947 | Soil | QIGDFSADGAWDPQAIDVIRNSLKDLGILNFVPEAKTIYNDKFVPVKF |
| Ga0318530_102836152 | 3300031959 | Soil | AAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0318553_101469192 | 3300032068 | Soil | AWNPAAIDVIRHSLKELGILGAVPEAKAIYNDQFVPVRF |
| Ga0308173_121247301 | 3300032074 | Soil | VYDTQIGSFSTDGAWDPEAIDVIRNSLKSLGILDFTPDAKTIYNDKFVPVKL |
| Ga0311301_105549142 | 3300032160 | Peatlands Soil | DPEAIDVIRSSLKELGILPTIPDAKALYTDKFVPVRF |
| Ga0307471_1023597992 | 3300032180 | Hardwood Forest Soil | KAIEVIRHSLKDLGILPDVPDAKAIYNDKFVPVKF |
| Ga0335082_109445272 | 3300032782 | Soil | LSAFSTDGSFDPKAIEVIRRSLKELGILDFEPDPKTLYNDTFVPVKF |
| Ga0310914_102776831 | 3300033289 | Soil | GSFSSDGVWDPVAIDVIRNSLKELGILDHVPDAKSIYNDQFVPVKL |
| Ga0310914_114014202 | 3300033289 | Soil | VAIDVIRHSLKELGILNAVPDARTIYNDRFVPVKF |
| ⦗Top⦘ |