| Basic Information | |
|---|---|
| Family ID | F079027 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GHVFVRPEARYYHIVNNTDVFSSGNVVRVGASIGYTIGPD |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 91.38 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil (8.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.310 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 35.29% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF09335 | SNARE_assoc | 12.93 |
| PF13505 | OMP_b-brl | 5.17 |
| PF12697 | Abhydrolase_6 | 1.72 |
| PF00202 | Aminotran_3 | 0.86 |
| PF00873 | ACR_tran | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 12.93 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 12.93 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 12.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.69 % |
| Unclassified | root | N/A | 4.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_87432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 693 | Open in IMG/M |
| 3300000955|JGI1027J12803_100669380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300004133|Ga0058892_1216126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300004635|Ga0062388_101449375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300005175|Ga0066673_10344913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300005533|Ga0070734_10314361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300005534|Ga0070735_10860937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005542|Ga0070732_10793850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300005545|Ga0070695_100744454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300005602|Ga0070762_10067255 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300005610|Ga0070763_10298451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300005610|Ga0070763_10426467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300005610|Ga0070763_10579374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300005764|Ga0066903_100947101 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300006175|Ga0070712_100561377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300006176|Ga0070765_100274474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1552 | Open in IMG/M |
| 3300006755|Ga0079222_12171593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006800|Ga0066660_10927486 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006800|Ga0066660_11516018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 528 | Open in IMG/M |
| 3300006804|Ga0079221_10824740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300009029|Ga0066793_10692482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300009522|Ga0116218_1481405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300009525|Ga0116220_10372183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009623|Ga0116133_1176539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009698|Ga0116216_10022690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3929 | Open in IMG/M |
| 3300009792|Ga0126374_11521459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010048|Ga0126373_10218640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300010358|Ga0126370_10690032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300010376|Ga0126381_104478648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300010379|Ga0136449_100795917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300010937|Ga0137776_1685636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300011065|Ga0138533_1035613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011271|Ga0137393_10236356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
| 3300011271|Ga0137393_11079924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300012205|Ga0137362_10465540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300012469|Ga0150984_102674092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012582|Ga0137358_10957025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012683|Ga0137398_10882164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300012930|Ga0137407_11510456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300014199|Ga0181535_10106402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300016294|Ga0182041_11153116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300017946|Ga0187879_10428674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300018017|Ga0187872_10240929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300018043|Ga0187887_10917722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300018044|Ga0187890_10142416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300018085|Ga0187772_10880016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300018085|Ga0187772_10949764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300018085|Ga0187772_11452066 | Not Available | 510 | Open in IMG/M |
| 3300018086|Ga0187769_10819221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300018090|Ga0187770_11689853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300020150|Ga0187768_1104653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300020199|Ga0179592_10446083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300020582|Ga0210395_10311543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
| 3300021046|Ga0215015_10440938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300021180|Ga0210396_10784255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300021474|Ga0210390_10020065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5435 | Open in IMG/M |
| 3300021474|Ga0210390_10661858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300021476|Ga0187846_10158713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300021560|Ga0126371_10104712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2825 | Open in IMG/M |
| 3300021858|Ga0213852_1033581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300021861|Ga0213853_11034916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300022730|Ga0224570_101500 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300025878|Ga0209584_10341062 | Not Available | 577 | Open in IMG/M |
| 3300025911|Ga0207654_10757803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300025920|Ga0207649_11384009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300026215|Ga0209849_1053246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300026356|Ga0257150_1075513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300026514|Ga0257168_1013307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300026557|Ga0179587_10867402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300026557|Ga0179587_10892783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300027080|Ga0208237_1025693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300027168|Ga0208239_1001967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300027502|Ga0209622_1081936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027575|Ga0209525_1008081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2482 | Open in IMG/M |
| 3300027583|Ga0209527_1140435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300027609|Ga0209221_1110403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300027773|Ga0209810_1154709 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300027812|Ga0209656_10254740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300027889|Ga0209380_10149367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300027908|Ga0209006_10320499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300028747|Ga0302219_10055991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1471 | Open in IMG/M |
| 3300028748|Ga0302156_10126069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300028776|Ga0302303_10232570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300028866|Ga0302278_10451438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300028906|Ga0308309_10219485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300028906|Ga0308309_11903800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300029914|Ga0311359_11138611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300030013|Ga0302178_10387735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300030054|Ga0302182_10086691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
| 3300030399|Ga0311353_10137868 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300030659|Ga0316363_10129123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300030707|Ga0310038_10284755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300030737|Ga0302310_10147461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
| 3300031474|Ga0170818_114201880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031715|Ga0307476_10337668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300031715|Ga0307476_10670255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300031718|Ga0307474_10152229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300031718|Ga0307474_10388862 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031754|Ga0307475_10056653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2961 | Open in IMG/M |
| 3300031754|Ga0307475_10789821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300031754|Ga0307475_11175511 | Not Available | 598 | Open in IMG/M |
| 3300031793|Ga0318548_10549112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300031820|Ga0307473_11348390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031912|Ga0306921_12337738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300031945|Ga0310913_11244164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031946|Ga0310910_10447241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300031962|Ga0307479_10498513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300031962|Ga0307479_11352438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300032829|Ga0335070_10904270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300032892|Ga0335081_10262005 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300033290|Ga0318519_10903799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300033402|Ga0326728_10702522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300034130|Ga0370494_084737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300034282|Ga0370492_0059402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1568 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.59% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01490200 | 2199352024 | Soil | VDLGAGVRYYVWGHAFVRPEVRYYHVLNNSDNFSSGNVIRVGASIGYTIGPD |
| JGI1027J12803_1006693801 | 3300000955 | Soil | YYVWGHVFLRPEVRYFHIVNNGDNFTSDNVIRVGASIGYTIGPE* |
| Ga0058892_12161262 | 3300004133 | Forest Soil | GLRYYVWGHFFVRPEVRYYRILNNTDVFSSDNVFHVGASIGYTIGPD* |
| Ga0062388_1014493752 | 3300004635 | Bog Forest Soil | GHVFLRPEVRYYHIVNNTDVFNSSNIVRVGASVGYTIGPD* |
| Ga0066673_103449131 | 3300005175 | Soil | HVFVRPEVRYYKVFNNTSDFTSGNLVHVGASIGYTIGPD* |
| Ga0070734_103143611 | 3300005533 | Surface Soil | GHVFVRPEAHYYHILNNTDFFSSGNVIRMGASIGYTIGPD* |
| Ga0070735_108609372 | 3300005534 | Surface Soil | VFVRPEVRYYKIFNNTADFTSGNILHVGASIGYTIGPD* |
| Ga0070732_107938501 | 3300005542 | Surface Soil | FVRPEVHYYHILNNTDVFSNTNVIRAGASIGYTIGGPN* |
| Ga0070695_1007444541 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HVFVRPEVRYYKVFNNDSDFTSGNLVHVGASIGYTIGPD* |
| Ga0070762_100672551 | 3300005602 | Soil | YVWNHVFVRPEVRYYHIVNNTDVFSSDNVFRVGASIGYTIGPD* |
| Ga0070763_102984512 | 3300005610 | Soil | RYYFWGHVFIRPEVRYYYIHNNTVDFTSNSVFRAGGSIGYTIGPE* |
| Ga0070763_104264672 | 3300005610 | Soil | PEVRYYHIQNNTDEFNSSNIFRVGGSIGYTIGPD* |
| Ga0070763_105793742 | 3300005610 | Soil | AFVRPEVRYYHVVNNTDVFTSGDIVRVGASIGYTIGPD* |
| Ga0066903_1009471014 | 3300005764 | Tropical Forest Soil | RPEVRYFYITNNSDNFNSNNVIHVGASIGYTIGPD* |
| Ga0070712_1005613771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGAGIRYYAYGHVFIRPEVRYYKVFNNSVDFTSGNVIRVGASIGYTIGPE* |
| Ga0070765_1002744744 | 3300006176 | Soil | WGHVFVRPEVHYYHIFNNTDVFSNGNVIRVGASVGYTIGGGPD* |
| Ga0079222_121715932 | 3300006755 | Agricultural Soil | AGLRYYVWGHMFVRPEVRYYHVTNNEDVFTSPNLVHVGASIGYTIGPD* |
| Ga0066660_109274862 | 3300006800 | Soil | SNHFLVDVGAGIRYYVWGHMFLRPEVRYYHIINNGDNFTSDNVFRVGASIGYTIGPE* |
| Ga0066660_115160182 | 3300006800 | Soil | WHNVFLRPEAHYYFIHDNSEFSGNNAIRVGASIGYTWRSEY* |
| Ga0079221_108247402 | 3300006804 | Agricultural Soil | RPEVHYYHILNNTDFFSSDNVIRVGASIGYTIGPD* |
| Ga0102924_13961762 | 3300007982 | Iron-Sulfur Acid Spring | VFIRPEAHYYHVQNNQGFNSGNVFRVGASIGYTIGK* |
| Ga0066793_106924822 | 3300009029 | Prmafrost Soil | AGIRYYVWGHVVVRPEVRYYNVINNTDYYTSGNLVHVGASIGYTIGPD* |
| Ga0116218_14814052 | 3300009522 | Peatlands Soil | GIRYYVWGHTFVRPEVRYNHVLNNGDVFTSGDTLRVGASIGYTIGPD* |
| Ga0116220_103721831 | 3300009525 | Peatlands Soil | LVDIGGGVRYYFYGHFFLRPEAHYYHILNNSDFFSSGNVIRVGASIGYTIGPD* |
| Ga0116133_11765391 | 3300009623 | Peatland | GGLKYYVWHHAFIRPEVRYYNIFNNTADFNSNSVIHVGASIGYTIGGPE* |
| Ga0116216_100226901 | 3300009698 | Peatlands Soil | VGGGIRYYVYGHAFIRPEVHIYHILNNTDVYTNNNVIRVGASIGYTIGPD* |
| Ga0126374_115214591 | 3300009792 | Tropical Forest Soil | RYYFWGHVFVRPEVRYYYVNNNTNDFTSNNVFRAGASIGYTIGPE* |
| Ga0126373_102186401 | 3300010048 | Tropical Forest Soil | VRPEVRYYYINNNTSDFTSNNVFRAGASIGYTIGPE* |
| Ga0126370_106900321 | 3300010358 | Tropical Forest Soil | LRYYVWGHMFIRPEARYYHIVNNTDNFTSGNVIHVGASIGYTIGPE* |
| Ga0126381_1044786482 | 3300010376 | Tropical Forest Soil | FVRPEVRYYYVHNNSVDFTSPNLFRLGASIGYTIGPE* |
| Ga0136449_1007959174 | 3300010379 | Peatlands Soil | GHVFLRPEVRFYHILNNTDAFTSDNVVHVGASIGYTIGPD* |
| Ga0137776_16856362 | 3300010937 | Sediment | IRPEVRYYYVNNNTNDFTSNNVFRAGASIGYTIGPD* |
| Ga0138533_10356131 | 3300011065 | Peatlands Soil | HAFIRPEVHIYHILNNTDVYTNNNVIRVGASIGYTIGPD* |
| Ga0137393_102363563 | 3300011271 | Vadose Zone Soil | VRPEAHFYHIVNNTSDFSSNNVVRVGASIGYTIGPD* |
| Ga0137393_110799242 | 3300011271 | Vadose Zone Soil | YYVWGHVFVRPEVHFYHINNNTDVFSNDNVFRAGASIGYTIGPD* |
| Ga0137362_104655403 | 3300012205 | Vadose Zone Soil | FVRPEVRYYHIHNNAEFNSNNVVRVGASIGYTIAPH* |
| Ga0150984_1026740921 | 3300012469 | Avena Fatua Rhizosphere | YYAWGHVFVRPEARYYKILNNTDNFSSGSVLHVGASIGYTIGPD* |
| Ga0137358_109570252 | 3300012582 | Vadose Zone Soil | VRPEAHFYHIVNNTNDFNSNNVVRVGASIGFTIGPD* |
| Ga0137398_108821641 | 3300012683 | Vadose Zone Soil | GHVFVRPEAHFYHIVNNTSDFSSNNVVRVGASIGYTIGPD* |
| Ga0137407_115104562 | 3300012930 | Vadose Zone Soil | FRPEAHFYHIMNNSDVFNNSNVIRVGASIGYTIGGPE* |
| Ga0181535_101064024 | 3300014199 | Bog | VGAGIRYYVWGHAFVRPEVRYYHVLNNTDVFTSGDIVRVGASIGYTIGPD* |
| Ga0182041_111531161 | 3300016294 | Soil | IRPELRYYNIMNNTDNFTSDHVIHVGASIGYTIGPE |
| Ga0187879_104286742 | 3300017946 | Peatland | KYYVWHHAFIRPEVRYYNIFNNTADFNSNSVIHVGASIGYTIGGPE |
| Ga0187872_102409292 | 3300018017 | Peatland | YVWHHFFVRPEIHYYHIQNNTDVFSTDNVFRVGASIGYTIGND |
| Ga0187887_109177221 | 3300018043 | Peatland | RPEAHYYHILNNTDFFSSGNVIRIGASIGYTIGPE |
| Ga0187890_101424161 | 3300018044 | Peatland | VWGHVFVRPEAHYYNILNNTDVFNSSSVIRVGASIGYTIGPD |
| Ga0187772_108800162 | 3300018085 | Tropical Peatland | VWGHMFVRPEVRYYHVLNNTDVFSSGDILRVGASIGYTIGPE |
| Ga0187772_109497641 | 3300018085 | Tropical Peatland | RPEVKYYQIRNNTADFTSGNVFRVGASIGYTIGGD |
| Ga0187772_114520661 | 3300018085 | Tropical Peatland | IRPEVRYYNVHNNTVDFSSGNLFRVGASLGYTIGGSD |
| Ga0187769_108192211 | 3300018086 | Tropical Peatland | RYYFWHHVFVRPEVRYYWINNNTADFTGNNVLRVGGSVGYTIGGPD |
| Ga0187770_116898532 | 3300018090 | Tropical Peatland | AGLRYYFFGHAFIRPEVRYYWINNNTVDFTSANVVRVGASIGYTIGPD |
| Ga0187768_11046532 | 3300020150 | Tropical Peatland | TSDNHFLVHVGGGLRYYVFGHAFVRPEVHLYHILNNTSAYTNTNVVRVGASIGYTIGPE |
| Ga0179592_104460832 | 3300020199 | Vadose Zone Soil | HVLVRPEAHFYHIVNNTADFTSNNVVRVGASIGFTLGPD |
| Ga0210395_103115433 | 3300020582 | Soil | HLPHVFVRPEAHYYHVQNNQGFNSSNVFRVGASIGYTIGK |
| Ga0215015_104409382 | 3300021046 | Soil | CIRDSYYVHGDFFVRPEAHFYHIVNNTSDFSSNNVVRVGASIGYTIGGPE |
| Ga0210396_107842552 | 3300021180 | Soil | GHVFVRPEARYYHIVNNTDVFSSGNVVRVGASIGYTIGPD |
| Ga0210390_100200658 | 3300021474 | Soil | DVGAGIRYYVWGHAFVRPEVRYYHVVNNTDVFTSGDIVRVGASIGYTIGPD |
| Ga0210390_106618581 | 3300021474 | Soil | NHVFVRPEVRYYHIVNNTDVFSSDNVFRVGASIGYTIGPD |
| Ga0187846_101587131 | 3300021476 | Biofilm | VWGHLFVRPEAHYYWINNNTDVFSSGNVIRLGGSIGYTIGPD |
| Ga0126371_101047121 | 3300021560 | Tropical Forest Soil | RYYVWGHVFVRPEVRYYWINNNTADFTSNSVIRVGGSIGYTIGPE |
| Ga0213852_10335812 | 3300021858 | Watersheds | RPEAHYYKVFNNTADFTSNNVVRVGASIGYTIGPE |
| Ga0213853_110349163 | 3300021861 | Watersheds | WGHVFVRPEVRYYKVFNNTADFTSNNVVRVGASIGYTIGPE |
| Ga0224570_1015001 | 3300022730 | Rhizosphere | FVRPEVRYYNIINNTNIFSSNSVIHVGASIGYTIGGPD |
| Ga0208034_10622131 | 3300025442 | Peatland | WHHFFVRPEIHYYHIQNNTDVFSTDNVFRVGASIGYTIGND |
| Ga0209584_103410622 | 3300025878 | Arctic Peat Soil | FVRPEVRYYNVINNTDYYTSGNLVHVGASIGYTIGPD |
| Ga0207654_107578031 | 3300025911 | Corn Rhizosphere | FVRPEVRYYKVFNNTSDFTSGNLVHVGASIGYTIGPD |
| Ga0207649_113840091 | 3300025920 | Corn Rhizosphere | VFVRPEIRYYKVFNNTSDFTSGNLVHVGASIGYTIGPD |
| Ga0209849_10532462 | 3300026215 | Soil | DVGGGIRYYVRGHIFVRPEIRFYHIVNNTADFTNNNVFRVGASIGYTIGPD |
| Ga0257150_10755131 | 3300026356 | Soil | YVRGHVFVRPEAHFYHIVNNTSDFSSNNVVRVGASIGYTIGPD |
| Ga0257168_10133074 | 3300026514 | Soil | RGHVFVRPEAHFYHIVNNTSDFSSNNVVRVGASIGYTIGPD |
| Ga0179587_108674022 | 3300026557 | Vadose Zone Soil | GHVLVRPEAHFYHIVNNTADFTSNNVVRVGASIGFTLGPD |
| Ga0179587_108927832 | 3300026557 | Vadose Zone Soil | HVFVRPEAHFYHIVNNTNDFNSNNVVRVGASIGFTIGPD |
| Ga0208237_10256932 | 3300027080 | Forest Soil | DLGGGVRYYVWGHFFVRPEVHYYHIVNNTDVFSNGNVIRVGASIGYTIGGGD |
| Ga0208239_10019671 | 3300027168 | Forest Soil | VWGHVFVRPEVRYYHVLNNTDVYTSGDIIRVGASIGYTIGGGLD |
| Ga0209622_10819361 | 3300027502 | Forest Soil | VDLGAGIRYYAYGHLFVRPEVRYYKVFNNSSDFTSGNVVRVGASIGYTIGPD |
| Ga0209525_10080815 | 3300027575 | Forest Soil | VFVRPEIHYYQVHGNTDDFSSNNVLRMGASIGYTIGPQ |
| Ga0209527_11404351 | 3300027583 | Forest Soil | RPEVHYYYVVNNTSDFTSNNLFRVGASIGYTIGPD |
| Ga0209221_11104031 | 3300027609 | Forest Soil | DVGGGLKYYVWHNAFLRPEVHYYNILNNTNEFSSNNILRVGASIGYTIGRD |
| Ga0209810_11547092 | 3300027773 | Surface Soil | LRPEAHYYFVRNADVDFTSNNVFRVGASLGLSFGR |
| Ga0209656_102547402 | 3300027812 | Bog Forest Soil | RYYVWGHFFVRPEARYYYVNNNTNDFTSDNLFKVGASIGYTIGPE |
| Ga0209380_101493673 | 3300027889 | Soil | NHFLVDIGGGIRYYVWGHVFLRPEARFYHILNNTDVFSSGNVVRVGASIGYTIGPD |
| Ga0209006_103204991 | 3300027908 | Forest Soil | LVHGGVGLRYYAYGNLFIRPELHVYHILSNTDVFTNNNVIRVGASIGYTIGGPN |
| Ga0302219_100559911 | 3300028747 | Palsa | YYVWGHVFVRPEVRYYYVLNNTDVFTSGNVFRVGASIGYTIGGGPD |
| Ga0302156_101260693 | 3300028748 | Bog | YYVWNHFFVRPEARFYHILNNTDVFSSGNVVRVGASVGYTIGPD |
| Ga0302303_102325701 | 3300028776 | Palsa | FIRPEIKYYNVHNNTADFTGNNLLRVGASIGYTIGGPD |
| Ga0302278_104514382 | 3300028866 | Bog | DIGGGIRYYVWGHVFIRPEAHYYHIVNNTNDFTSNDVVRVGASIGYTIGGGD |
| Ga0308309_102194854 | 3300028906 | Soil | FVRPEAHYYHILNNTDFFSSGNVIRVGASIGYTIGGPE |
| Ga0308309_119038002 | 3300028906 | Soil | WNHVFVRPEIHYYQVHGNTDDFSSNNVLRMGASIGYTIGPQ |
| Ga0311359_111386112 | 3300029914 | Bog | LVDIGGGIRYYVWGHVFIRPEAHYYHIVNNTNDFTSNDVVRVGASIGYTIGGGD |
| Ga0302178_103877351 | 3300030013 | Palsa | WGHVFVRPEVRYYYVLNNTDVFTSGNVFRVGASIGYTIGGGPD |
| Ga0302182_100866913 | 3300030054 | Palsa | FVRPEVHYYHIQNNTDEFYSNSVVRVGGSIGYTIGPE |
| Ga0311353_101378681 | 3300030399 | Palsa | PEVHYYNILNNTNEFNSNSVIHVGASIGYTIGGPD |
| Ga0316363_101291232 | 3300030659 | Peatlands Soil | VFVRPEAHYYWIRNNTVDFNSNNILRVGASIGYTIGGPE |
| Ga0310038_102847551 | 3300030707 | Peatlands Soil | FFLRPEAHYYHILNNSDFFSSGNVIRVGASIGYTIGPD |
| Ga0302310_101474613 | 3300030737 | Palsa | PEVRYYYVLNNTDVFTSGNVFRVGASIGYTIGGGPD |
| Ga0170818_1142018801 | 3300031474 | Forest Soil | RYYVWGHVFLRPEAHYYHILNNTNEFSSNDIIRVGASIGYTIGPD |
| Ga0307476_103376681 | 3300031715 | Hardwood Forest Soil | HVFVRPEVRYYHVMNNSDAFTSGNLLRLGASIGYTIGGPE |
| Ga0307476_106702551 | 3300031715 | Hardwood Forest Soil | VRPEVRYYKVFNNSSDFTSGNVIRVGASIGYTIGPD |
| Ga0307474_101522291 | 3300031718 | Hardwood Forest Soil | VDLGAGIRYYAYGHLFVRPEVRYYKVFNNSSDFTSGNVIRVGASIGYTIGPD |
| Ga0307474_103888621 | 3300031718 | Hardwood Forest Soil | RPELNYYRVFNNTSDFTSDNLLRVGASFGYTLGPE |
| Ga0307475_100566531 | 3300031754 | Hardwood Forest Soil | YVWGHVFVRPEVRVFHILNNGDNFTSDNVFRVGASIGYTIGPE |
| Ga0307475_107898211 | 3300031754 | Hardwood Forest Soil | YVWGHMFVRPEVHFYHIVNNTADFSSNNVVRVGASIGYTLGPE |
| Ga0307475_111755111 | 3300031754 | Hardwood Forest Soil | EIHYYWVNNNTNDFSSNNLFRAGASIGYTIGGPFE |
| Ga0318548_105491122 | 3300031793 | Soil | NHFVVDVGGGLRYYVWGHMFLRPELRYYQIVNNTDVFTSNHVIHVGASIGYTIGPE |
| Ga0307473_113483901 | 3300031820 | Hardwood Forest Soil | FLRPEVRYYHIVNNGDNFTSDNVFRVGASIGYTIGPE |
| Ga0306921_123377382 | 3300031912 | Soil | HFLVDVGAGLRYYVWGHMFVRPEFRYYHVTNNDDVFTSPHLIHVGASIGYTIGPD |
| Ga0310913_112441642 | 3300031945 | Soil | VGGGIRYYVWGHMFVRPEVRWYHIFNNTDNFTSDNVIHVGASIGYTIGPE |
| Ga0310910_104472411 | 3300031946 | Soil | TSSNHFVVDVGGGLRYYVWGHMFLRPELRYYQIVNNTDVFTSNHVIHVGASIGYTIGPE |
| Ga0307479_104985133 | 3300031962 | Hardwood Forest Soil | IRYYVWGHVFVRPEVRYYKVFNNTADFTSNNVVRVGASIGYTIGPE |
| Ga0307479_113524381 | 3300031962 | Hardwood Forest Soil | YAYGHLFVRPEVRYYKVFNNSSDFTSGNVIRVGASIGYTIGPD |
| Ga0335070_109042702 | 3300032829 | Soil | FLVDVGGGLRYYVWGHVFIRPELRYYHIMNNTDNFTSEHVIRVGASIGYTIGPE |
| Ga0335081_102620055 | 3300032892 | Soil | HVFVRPEAHFYHILNNTNDFSSNNVVRVGASIGYTIGGPE |
| Ga0318519_109037992 | 3300033290 | Soil | YVWGHMFLRPELRYYQIVNNTDVFTSNHVIHVGASIGYTIGPE |
| Ga0326728_107025221 | 3300033402 | Peat Soil | YVWQHVFVRPEVRYYHVLNNTDIFSSGDIVRVGASIGYTIGPD |
| Ga0370494_084737_3_137 | 3300034130 | Untreated Peat Soil | YYVWGHVFVRPEARYYHILNNTDFFSSGNVVRVGASIGYTIGPD |
| Ga0370492_0059402_2_109 | 3300034282 | Untreated Peat Soil | RPEAHYYKVFNNTADFTSGNIVRLGASIGYTIGPD |
| ⦗Top⦘ |