NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079023

Metagenome Family F079023

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079023
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 42 residues
Representative Sequence VRGFNVAHASGSGMDWLAVSDVSADVLTAFVQRLARADAAL
Number of Associated Samples 106
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.28 %
% of genes from short scaffolds (< 2000 bps) 95.69 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.345 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(11.207 % of family members)
Environment Ontology (ENVO) Unclassified
(52.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.207 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.64%    β-sheet: 20.29%    Coil/Unstructured: 55.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00149Metallophos 18.10
PF13557Phenol_MetA_deg 3.45
PF04542Sigma70_r2 2.59
PF13899Thioredoxin_7 2.59
PF07690MFS_1 2.59
PF13473Cupredoxin_1 2.59
PF00593TonB_dep_Rec 1.72
PF02530Porin_2 1.72
PF02798GST_N 1.72
PF08281Sigma70_r4_2 1.72
PF04392ABC_sub_bind 1.72
PF03401TctC 1.72
PF00515TPR_1 0.86
PF02867Ribonuc_red_lgC 0.86
PF10604Polyketide_cyc2 0.86
PF03928HbpS-like 0.86
PF13442Cytochrome_CBB3 0.86
PF00116COX2 0.86
PF13511DUF4124 0.86
PF13683rve_3 0.86
PF00378ECH_1 0.86
PF01740STAS 0.86
PF106053HBOH 0.86
PF11937DUF3455 0.86
PF13410GST_C_2 0.86
PF13561adh_short_C2 0.86
PF00912Transgly 0.86
PF02627CMD 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.59
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.59
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.59
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.59
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.72
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.72
COG3637Opacity protein LomR and related surface antigensCell wall/membrane/envelope biogenesis [M] 1.72
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 0.86
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.86
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.86
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.86
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.86
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.86
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.86
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.34 %
UnclassifiedrootN/A14.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_179531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium593Open in IMG/M
3300001991|JGI24743J22301_10066284All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300004092|Ga0062389_104553804All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae522Open in IMG/M
3300005181|Ga0066678_11112158All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria508Open in IMG/M
3300005327|Ga0070658_11194511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales661Open in IMG/M
3300005328|Ga0070676_10397783All Organisms → cellular organisms → Bacteria → Proteobacteria958Open in IMG/M
3300005329|Ga0070683_100366272All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300005330|Ga0070690_101247844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. YR605594Open in IMG/M
3300005335|Ga0070666_10329068All Organisms → cellular organisms → Bacteria → Proteobacteria1091Open in IMG/M
3300005338|Ga0068868_100147742All Organisms → cellular organisms → Bacteria → Proteobacteria1934Open in IMG/M
3300005344|Ga0070661_101388299All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005353|Ga0070669_100747580All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium828Open in IMG/M
3300005354|Ga0070675_101705707All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005435|Ga0070714_102461361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300005438|Ga0070701_10754433Not Available659Open in IMG/M
3300005439|Ga0070711_100874998All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium766Open in IMG/M
3300005457|Ga0070662_100924552All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005468|Ga0070707_101686188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales601Open in IMG/M
3300005529|Ga0070741_11761906All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales502Open in IMG/M
3300005536|Ga0070697_100675505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium910Open in IMG/M
3300005563|Ga0068855_102240068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales548Open in IMG/M
3300005563|Ga0068855_102486223All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium515Open in IMG/M
3300005564|Ga0070664_101360734All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300005578|Ga0068854_101823591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium558Open in IMG/M
3300005614|Ga0068856_100683945All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005616|Ga0068852_100486587All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300005834|Ga0068851_10704746All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005840|Ga0068870_10413290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria881Open in IMG/M
3300005841|Ga0068863_101690084All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300005842|Ga0068858_102431250All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300005843|Ga0068860_102267886Not Available563Open in IMG/M
3300006031|Ga0066651_10123822All Organisms → cellular organisms → Bacteria → Proteobacteria1330Open in IMG/M
3300006050|Ga0075028_100786729Not Available579Open in IMG/M
3300006175|Ga0070712_100740557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium840Open in IMG/M
3300006358|Ga0068871_100207626All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1693Open in IMG/M
3300006755|Ga0079222_10836759All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium759Open in IMG/M
3300006804|Ga0079221_10017666All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2852Open in IMG/M
3300006852|Ga0075433_11762264All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300006904|Ga0075424_100702602All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300009012|Ga0066710_103551584All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria589Open in IMG/M
3300009098|Ga0105245_11687061All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009156|Ga0111538_11020467All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae1046Open in IMG/M
3300009177|Ga0105248_10684530All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300009545|Ga0105237_10293842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica1627Open in IMG/M
3300009545|Ga0105237_11931698All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300010396|Ga0134126_11914177All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium649Open in IMG/M
3300010397|Ga0134124_11260789All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium761Open in IMG/M
3300010399|Ga0134127_10282734Not Available1589Open in IMG/M
3300010401|Ga0134121_12559235All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium553Open in IMG/M
3300010403|Ga0134123_10092642All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2385Open in IMG/M
3300011119|Ga0105246_10712470Not Available881Open in IMG/M
3300011119|Ga0105246_12592209Not Available501Open in IMG/M
3300012200|Ga0137382_10109138All Organisms → cellular organisms → Bacteria → Proteobacteria1836Open in IMG/M
3300012203|Ga0137399_10526707All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300012206|Ga0137380_10711026All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium872Open in IMG/M
3300012207|Ga0137381_10375505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1239Open in IMG/M
3300012285|Ga0137370_10801928All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium584Open in IMG/M
3300012354|Ga0137366_10431737Not Available957Open in IMG/M
3300012917|Ga0137395_10834624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium668Open in IMG/M
3300012923|Ga0137359_10299155All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1433Open in IMG/M
3300012955|Ga0164298_11021987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium612Open in IMG/M
3300013100|Ga0157373_11120833All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300013308|Ga0157375_12524828All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium614Open in IMG/M
3300014154|Ga0134075_10420639Not Available592Open in IMG/M
3300014325|Ga0163163_12555177All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium568Open in IMG/M
3300014326|Ga0157380_12349814All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium598Open in IMG/M
3300014745|Ga0157377_11092121All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300015090|Ga0167634_1031241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium759Open in IMG/M
3300018062|Ga0187784_10783186Not Available761Open in IMG/M
3300018433|Ga0066667_11522040Not Available592Open in IMG/M
3300018468|Ga0066662_10564003All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300018482|Ga0066669_10092908All Organisms → cellular organisms → Bacteria → Proteobacteria2070Open in IMG/M
3300018482|Ga0066669_12288652Not Available515Open in IMG/M
3300019356|Ga0173481_10596319All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300019789|Ga0137408_1301817All Organisms → cellular organisms → Bacteria → Proteobacteria1717Open in IMG/M
3300019879|Ga0193723_1032954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1556Open in IMG/M
3300020583|Ga0210401_11265174All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300022756|Ga0222622_10551510All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300022756|Ga0222622_10789589All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria693Open in IMG/M
3300025898|Ga0207692_11066495All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300025909|Ga0207705_10549831Not Available897Open in IMG/M
3300025912|Ga0207707_10341219All Organisms → cellular organisms → Bacteria → Proteobacteria1292Open in IMG/M
3300025920|Ga0207649_10385771All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300025920|Ga0207649_10789244All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300025927|Ga0207687_11964034All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025940|Ga0207691_11681521All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025941|Ga0207711_10566741All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300025949|Ga0207667_10136522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2525Open in IMG/M
3300025949|Ga0207667_10850974All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300025960|Ga0207651_11127931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium703Open in IMG/M
3300025981|Ga0207640_11006453Not Available733Open in IMG/M
3300025986|Ga0207658_10646668All Organisms → cellular organisms → Bacteria → Proteobacteria953Open in IMG/M
3300026023|Ga0207677_10341749All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300026041|Ga0207639_10176343All Organisms → cellular organisms → Bacteria → Proteobacteria1815Open in IMG/M
3300026078|Ga0207702_12298878All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300026116|Ga0207674_10267927All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1655Open in IMG/M
3300026116|Ga0207674_10715770All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300026548|Ga0209161_10339332All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium681Open in IMG/M
3300027727|Ga0209328_10271483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300028379|Ga0268266_11112037All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300028587|Ga0247828_11237221All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300028799|Ga0307284_10306813Not Available638Open in IMG/M
3300028812|Ga0247825_10932288All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300028906|Ga0308309_10899792All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium768Open in IMG/M
3300031231|Ga0170824_110320243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium759Open in IMG/M
3300031545|Ga0318541_10505392Not Available676Open in IMG/M
3300031548|Ga0307408_100056663All Organisms → cellular organisms → Bacteria → Proteobacteria2842Open in IMG/M
3300031720|Ga0307469_10130517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum1839Open in IMG/M
3300031740|Ga0307468_100540853All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium935Open in IMG/M
3300031908|Ga0310900_10927689All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium712Open in IMG/M
3300032013|Ga0310906_11283749All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032174|Ga0307470_11215328All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium613Open in IMG/M
3300032180|Ga0307471_100449259All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1428Open in IMG/M
3300032180|Ga0307471_100693371Not Available1183Open in IMG/M
3300032180|Ga0307471_103209139Not Available580Open in IMG/M
3300032211|Ga0310896_10089996All Organisms → cellular organisms → Bacteria1350Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere11.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015090Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_033540002199352024SoilVRPESEHGTPSTLRTIRGFNVAHASGFGMDWLAVSDINAGELADFVGKVARESGP
JGI24743J22301_1006628413300001991Corn, Switchgrass And Miscanthus RhizosphereALRTVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0062389_10455380423300004092Bog Forest SoilLTTQRGFNVAHAKGAAMEWWGVSDVSVDVLSALVARLARGE*
Ga0066678_1111215823300005181SoilPTPSSRTTIRGFNVAHAAGVGMDWWAVSDASPEVVNALVNRLARGDSPN*
Ga0070658_1119451113300005327Corn RhizosphereVRGFHVAHARGGGMEWLAVSDASAPVLMSFVQRLAAEAAAP*
Ga0070676_1039778313300005328Miscanthus RhizospherePMTLRTVRGFNVVHATGSGMEWIAVSDVNADELTEFVQRLARQSATP*
Ga0070683_10036627213300005329Corn RhizosphereTVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0070690_10124784413300005330Switchgrass RhizospherePAPMTLRTVRGFNVVHATGSGMEWIAVSDVNADELTEFVQRLARQSATP*
Ga0070666_1032906813300005335Switchgrass RhizosphereLRTVRGINVAHASGSGMDWLAVSDVSRDVLASFVQQLARSDTR*
Ga0068868_10014774213300005338Miscanthus RhizosphereALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN*
Ga0070661_10138829913300005344Corn RhizosphereRTIRGINVAHASGAQMDWLAVSDVSSDVLGSFVQSLARGGATQ*
Ga0070669_10074758023300005353Switchgrass RhizospherePALRTVRGFNVARANGSGMDWLAVSDVSADVLSAFVQRLARADTSP*
Ga0070675_10170570723300005354Miscanthus RhizosphereTVRGFNVAHASGSGMEWLAVSDVSPEVLDTFVEQFTRVSSVP*
Ga0070714_10246136113300005435Agricultural SoilVRGFNVAHATGSGMDWLAVSDVNPDELTEFARKLAREAGAP*
Ga0070701_1075443313300005438Corn, Switchgrass And Miscanthus RhizosphereALPTVRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0070711_10087499823300005439Corn, Switchgrass And Miscanthus RhizosphereTVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0070662_10092455213300005457Corn RhizosphereGINVAHASGAQMDWLAVSDVSPDVLSAFVESLARGNPTQ*
Ga0070707_10168618823300005468Corn, Switchgrass And Miscanthus RhizosphereALRTVRGFNVAHATGSGMDWLAVSDVNPDELTEFARKLAREAGAP*
Ga0070741_1176190613300005529Surface SoilMPLRTLRGFNIAHARGADMDWLAVSDVSADVLVPFVEALAAAR*
Ga0070697_10067550513300005536Corn, Switchgrass And Miscanthus RhizospherePMPELRTVRGFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR*
Ga0068855_10224006823300005563Corn RhizosphereRTVRGFNVVHAVGSGMDWLAVSDLNAAELSRFVDKLKE*
Ga0068855_10248622313300005563Corn RhizosphereNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0070664_10136073413300005564Corn RhizospherePALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068854_10182359113300005578Corn RhizosphereRGFNVAHATGSGMDWLAVSDVEPGILAEFVLRLARPDASP*
Ga0068856_10068394513300005614Corn RhizosphereVPATGRSMEWLAVSDAEPAAVAALVQRLAREEGAP*
Ga0068852_10048658733300005616Corn RhizosphereVAHARGGGMEWLAVSDAGAPVLASFVQRLAAEAAAP*
Ga0068851_1070474613300005834Corn RhizosphereAHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP*
Ga0068870_1041329023300005840Miscanthus RhizosphereHATGSGMDWIAVSDVSADELTQFVQRLAQQTATP*
Ga0068863_10169008433300005841Switchgrass RhizosphereALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068858_10243125033300005842Switchgrass RhizosphereTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068860_10226788633300005843Switchgrass RhizosphereVRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0066651_1012382233300006031SoilPTALRTVRGFNVAHATGSGMDWLGVSDVSADVLTAFVQRLAREDATPKP*
Ga0075028_10078672913300006050WatershedsSALRTVRGFNVARASGPSMDWLAVSDADAAALSAFVQRLAREDISQ*
Ga0070712_10074055723300006175Corn, Switchgrass And Miscanthus RhizosphereVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0068871_10020762633300006358Miscanthus RhizosphereHATGSGMDWLAVSDVSADVLSSFVQRLAHPATSP*
Ga0079222_1083675923300006755Agricultural SoilTIRGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0079221_1001766633300006804Agricultural SoilPSALRTIRGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0075433_1176226413300006852Populus RhizospherePPPELRTVRGFNVARASGPSMDWLAVSDAEPAVLSAFVQRLAREDIAQ*
Ga0075424_10070260213300006904Populus RhizosphereTVRGFNVARASGPTMDWLAVSDAEPAVLSAFVQRLAREDISQ*
Ga0066710_10355158413300009012Grasslands SoilGFNVAHATGAGMEWWGVSDVSADVLQLLVARLAQGE
Ga0105245_1168706123300009098Miscanthus RhizosphereFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0111538_1102046713300009156Populus RhizosphereVRGFNVAPATGSGMDWLAVSDVSADVLTAFVQRLARADAAP*
Ga0105248_1068453023300009177Switchgrass RhizosphereFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0105237_1029384233300009545Corn RhizosphereALRTVRGFNVAHATGSGMDWLAVSDVSADVLTAFVQRLAREDATTKP*
Ga0105237_1193169813300009545Corn RhizosphereHATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR*
Ga0134126_1191417723300010396Terrestrial SoilPMTLRTVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0134124_1126078923300010397Terrestrial SoilGFNVAHASGSGMDWLAVSDVSTDVLSPFVQRLARAEASPR*
Ga0134127_1028273413300010399Terrestrial SoilRGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0134121_1255923523300010401Terrestrial SoilLRTVRGFNVARANGLGMDWLAVSDVSADVLSEFVQRLARADTSP*
Ga0134123_1009264213300010403Terrestrial SoilSTLRTVRGFNVVHATGSGMDWIAVSDVNADELTELVQRLAQQTPSP*
Ga0105246_1071247023300011119Miscanthus RhizosphereAPRAVRGFNVAHASGPSMDWLAVSDAEPAELSAFVQRLAHEDTSQ*
Ga0105246_1259220913300011119Miscanthus RhizosphereVALPTVRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0137382_1010913833300012200Vadose Zone SoilFNVARASGPTMDWLAVSDAEPAVLSAFVQRLAREDISQ*
Ga0137399_1052670713300012203Vadose Zone SoilNVARASSANMDWLAVSDAEPAALTAFVQRLAREDISQ*
Ga0137380_1071102613300012206Vadose Zone SoilAHANGSGMDWLAVSDVSADILSSFVQRLARAEAAP*
Ga0137381_1037550523300012207Vadose Zone SoilFNVARASGPSMAWVAVSDAEPAVLSAFVQRLAREEVPQ*
Ga0137370_1080192823300012285Vadose Zone SoilGFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR*
Ga0137366_1043173713300012354Vadose Zone SoilFNVARASGPNMDWLAVSDTDPAVLSALVQRLAREDVTQ*
Ga0137395_1083462413300012917Vadose Zone SoilVARASGPRMDWFAVSDAEPAALSSFVQRLAREDVAQ*
Ga0137359_1029915543300012923Vadose Zone SoilVRGFNVAHASGPSMDWVAVSDAEPAVLSSFVQRLAREDVSR*
Ga0164298_1102198713300012955SoilSALRTVRGFNVVHASGSGMEWLAVSDVSADFLPRFVQRLASDAVAPL*
Ga0157373_1112083313300013100Corn RhizosphereRTIRGINVAHASGAQMDWLAVSDVSADVLGSFVLSLARGGATQ*
Ga0157375_1252482813300013308Miscanthus RhizospherePAPVALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN*
Ga0134075_1042063913300014154Grasslands SoilTVRGFTVVHASASGMDWLAVSDVSTDVLSAFVERLAHQAASQ*
Ga0163163_1255517723300014325Switchgrass RhizosphereVRGFNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP*
Ga0157380_1234981423300014326Switchgrass RhizosphereFNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP*
Ga0157377_1109212113300014745Miscanthus RhizosphereHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0167634_103124123300015090Glacier Forefield SoilRGFNVAHASGSGMDWLAVSDVSADVLTTFVQRLARADAAP*
Ga0187784_1078318613300018062Tropical PeatlandRGFNVAHAQGSQMEWLAVSDVSPDVLQGFVEQLARSETSH
Ga0066667_1152204023300018433Grasslands SoilPTALRTVRGFNVAHATGSGMDWLGVSDVSADVLTSFVQRLARGSGAP
Ga0066662_1056400333300018468Grasslands SoilGFNVAHATGTGLEWLAVSDVSPDVLAPFAEPLAPESPTR
Ga0066669_1009290813300018482Grasslands SoilMSALRTVRGFNVARASGPTMDWLAVSDAEPAVLSMFVQRLAREDISQ
Ga0066669_1228865213300018482Grasslands SoilTVRGFNVAHAVGSGMDWVAVSDLNAAELSSFVARVSSQD
Ga0173481_1059631923300019356SoilVRGFNVAHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0137408_130181743300019789Vadose Zone SoilVRGFNVAHASGSGMEWLAVSDVSADVLSPFVQRLARGEASP
Ga0193723_103295423300019879SoilVRGFNVAHASGSGMEWLAVSDVSADALSAFVQRLARAEAAP
Ga0210401_1126517413300020583SoilSLAARRGFNVAHATGAGMEWWGVSDVSADVLAALVARLAHGE
Ga0222622_1055151013300022756Groundwater SedimentPPHGVRGFNVAGEQGPTMDWLAVSDAEPEAVLALVRRLAREEAAR
Ga0222622_1078958923300022756Groundwater SedimentPALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARGETSP
Ga0207692_1106649523300025898Corn, Switchgrass And Miscanthus RhizosphereMPLRTLRGFNIAHARGADMDWLAVSDVSADVLVPFVEALAAAR
Ga0207705_1054983113300025909Corn RhizosphereTVRGFHVAHARGGGMEWLAVSDASAPVLMSFVQRLAAEAAAP
Ga0207707_1034121913300025912Corn RhizosphereGFNVAHGAGSGMEWLAVSDVSADVLASLVERLAHAATPP
Ga0207649_1038577123300025920Corn RhizosphereALRTVRGFNVAHATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR
Ga0207649_1078924423300025920Corn RhizosphereNVAHATGPSMDWLAVSDAEPEVLSAFVQRLAREEISQETPQRE
Ga0207687_1196403413300025927Miscanthus RhizosphereFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP
Ga0207691_1168152123300025940Miscanthus RhizosphereHVAHARGGGMEWLAVSDAGAPVLASFVQRLAAEAAAP
Ga0207711_1056674113300025941Switchgrass RhizosphereFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN
Ga0207667_1013652243300025949Corn RhizosphereTIRGFNVAHGAGSGMEWLAVSDVSADVLASLVERLAHAATSP
Ga0207667_1085097423300025949Corn RhizosphereATGSGMDWLAVSDVSADVLTAFVQRLAREDATTKP
Ga0207651_1112793123300025960Switchgrass RhizosphereLSPSSPPRPVRGFNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP
Ga0207640_1100645313300025981Corn RhizosphereRGFNVAHATGSGMDWLAVSDVEPGILAEFVLRLARPDASP
Ga0207658_1064666823300025986Switchgrass RhizosphereGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN
Ga0207677_1034174923300026023Miscanthus RhizospherePVPAPAALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN
Ga0207639_1017634333300026041Corn RhizosphereLRTVRGINVAHASGSGMDWLAVSDVSRDVLASFVQQLARSDTR
Ga0207702_1229887813300026078Corn RhizosphereLRTVRGFNVAHATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR
Ga0207674_1026792713300026116Corn RhizosphereAPAPMTLRTVRGFNVAHATGSGMDWIAVSDVGADELTEFVQRLARQSATP
Ga0207674_1071577023300026116Corn RhizosphereMTLRTVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP
Ga0209161_1033933213300026548SoilARANGPSMDWLAVSDAEPAVLSAFVQRLAREDISQ
Ga0209328_1027148323300027727Forest SoilVRGFNVAHASGSGMDWLAVSDVSADVLTAFVQRLARADAAL
Ga0268266_1111203723300028379Switchgrass RhizosphereTVRGFNVAHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0247828_1123722123300028587SoilAIGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0307284_1030681313300028799SoilPPAALRTVRGFNVAHAAGSGMDWLAVSDLNAAELSSFVARVSRDE
Ga0247825_1093228823300028812SoilTIRGINVAHASGAQMDWLAVSDVSSDLLSSFVESLARGGPTQ
Ga0308309_1089979223300028906SoilFNVAHATGAGMEWWGVSDVSADVLAALVARLARGE
Ga0170824_11032024323300031231Forest SoilHGFNVARANGPSMDWLAVSDADSGVLSAFVERLAREDISQ
Ga0318541_1050539223300031545SoilFNVARAVGPSMEWVAVSDVEPAVLSAFVQRLAREDITQ
Ga0307408_10005666313300031548RhizosphereRGINVAHASGAQMDWLAVSDVSPDVLSSFVDSLARGGSTQ
Ga0307469_1013051733300031720Hardwood Forest SoilNVARASGASMDWLAVSDAEPAVLSAFVQRLAREDVSR
Ga0307468_10054085313300031740Hardwood Forest SoilPALRTVRGFNVAHASGSGMDWLAVSDVSADVLSPFVQRLARADASPR
Ga0310900_1092768913300031908SoilPLRPVRGFNVARATGSGMNWLAVSDVEPDTLSEFVQRLARPESSP
Ga0310906_1128374923300032013SoilLRTVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP
Ga0307470_1121532813300032174Hardwood Forest SoilPPPALRAVRGFNVAHASGSGMDWLAVSDVSADVLSSFVQRLARAEASPR
Ga0307471_10044925913300032180Hardwood Forest SoilTVRGFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR
Ga0307471_10069337133300032180Hardwood Forest SoilHASTPALRTVRGFNVAHASGPSMDWLAVSDAEPAELSAFVQRLAREDISQ
Ga0307471_10320913913300032180Hardwood Forest SoilARASGLGMDWLAVSDAEPAELAAFVQRLAREDISQ
Ga0310896_1008999633300032211SoilHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.