| Basic Information | |
|---|---|
| Family ID | F079019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MVDPNEVNELDLAAAPATPAESSWLSSLLATLGAALAAASTVRFLFG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 86.21 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.241 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.690 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.138 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.34% β-sheet: 0.00% Coil/Unstructured: 27.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13604 | AAA_30 | 89.66 |
| PF01977 | UbiD | 3.45 |
| PF02738 | MoCoBD_1 | 1.72 |
| PF03401 | TctC | 0.86 |
| PF13245 | AAA_19 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 3.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.24 % |
| Unclassified | root | N/A | 7.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10072408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10121470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300000956|JGI10216J12902_107573558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300002568|C688J35102_118515407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300002910|JGI25615J43890_1014837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300004156|Ga0062589_102339196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300004629|Ga0008092_11094473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300005180|Ga0066685_10969039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300005332|Ga0066388_104845316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300005546|Ga0070696_100609654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300005553|Ga0066695_10075484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. USDA 4541 | 2043 | Open in IMG/M |
| 3300005598|Ga0066706_10686923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300005598|Ga0066706_11115863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300005713|Ga0066905_101563336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300005713|Ga0066905_101741314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300005764|Ga0066903_100289131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2579 | Open in IMG/M |
| 3300005764|Ga0066903_100553933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1973 | Open in IMG/M |
| 3300006046|Ga0066652_101303401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300006058|Ga0075432_10167230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300006178|Ga0075367_10120629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1615 | Open in IMG/M |
| 3300006579|Ga0074054_12125891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300006604|Ga0074060_10010923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300006755|Ga0079222_11318598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300006845|Ga0075421_101874754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300006852|Ga0075433_10731745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300006903|Ga0075426_10446007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300006953|Ga0074063_10113173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300006969|Ga0075419_10628996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300007265|Ga0099794_10754497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300009088|Ga0099830_11161835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300009094|Ga0111539_10585154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1300 | Open in IMG/M |
| 3300010046|Ga0126384_10886004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300010047|Ga0126382_10879984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300010303|Ga0134082_10364778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300010359|Ga0126376_12278223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300010360|Ga0126372_12688468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300010361|Ga0126378_12628973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300010361|Ga0126378_12902165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300010362|Ga0126377_11336368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300010376|Ga0126381_104753813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300010396|Ga0134126_11219212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
| 3300010401|Ga0134121_11136022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300010868|Ga0124844_1148708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
| 3300010868|Ga0124844_1180678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300011119|Ga0105246_11665227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300011270|Ga0137391_10747587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 809 | Open in IMG/M |
| 3300012096|Ga0137389_11305574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300012199|Ga0137383_10266628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1254 | Open in IMG/M |
| 3300012207|Ga0137381_10178074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1838 | Open in IMG/M |
| 3300012362|Ga0137361_11130892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300012469|Ga0150984_118274086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300012916|Ga0157310_10136525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
| 3300012929|Ga0137404_10662623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
| 3300012948|Ga0126375_11445691 | Not Available | 585 | Open in IMG/M |
| 3300012948|Ga0126375_11916228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300012955|Ga0164298_10132397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1373 | Open in IMG/M |
| 3300012958|Ga0164299_10156317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1268 | Open in IMG/M |
| 3300016270|Ga0182036_10115189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1854 | Open in IMG/M |
| 3300016422|Ga0182039_10219747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1528 | Open in IMG/M |
| 3300016445|Ga0182038_10469432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
| 3300018000|Ga0184604_10375793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300019996|Ga0193693_1017412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1367 | Open in IMG/M |
| 3300020004|Ga0193755_1048729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1386 | Open in IMG/M |
| 3300021080|Ga0210382_10239778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300021479|Ga0210410_10943140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300025911|Ga0207654_10404443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300025922|Ga0207646_10372437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1290 | Open in IMG/M |
| 3300027050|Ga0209325_1001056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2239 | Open in IMG/M |
| 3300027388|Ga0208995_1000264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6890 | Open in IMG/M |
| 3300027875|Ga0209283_10196152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1341 | Open in IMG/M |
| 3300027907|Ga0207428_10786296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300028713|Ga0307303_10069400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300028720|Ga0307317_10033595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1608 | Open in IMG/M |
| 3300028754|Ga0307297_10138832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300028799|Ga0307284_10067926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
| 3300028824|Ga0307310_10211850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
| 3300028878|Ga0307278_10045911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1982 | Open in IMG/M |
| 3300028878|Ga0307278_10284982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300028880|Ga0307300_10124214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300030905|Ga0308200_1142519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300031474|Ga0170818_108044669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300031543|Ga0318516_10718913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300031543|Ga0318516_10743572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300031544|Ga0318534_10575638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300031561|Ga0318528_10364834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300031640|Ga0318555_10295091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 877 | Open in IMG/M |
| 3300031681|Ga0318572_10091331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1705 | Open in IMG/M |
| 3300031713|Ga0318496_10858901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031719|Ga0306917_11029262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300031744|Ga0306918_10933010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300031768|Ga0318509_10107502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300031768|Ga0318509_10415424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300031769|Ga0318526_10026030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2093 | Open in IMG/M |
| 3300031792|Ga0318529_10020002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2656 | Open in IMG/M |
| 3300031796|Ga0318576_10517934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300031858|Ga0310892_10599508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300031859|Ga0318527_10215117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300031880|Ga0318544_10255742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300031897|Ga0318520_10116004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1520 | Open in IMG/M |
| 3300031959|Ga0318530_10143230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300032035|Ga0310911_10408696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
| 3300032042|Ga0318545_10287112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300032044|Ga0318558_10291365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300032063|Ga0318504_10419547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300032065|Ga0318513_10054404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1800 | Open in IMG/M |
| 3300032065|Ga0318513_10069143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1613 | Open in IMG/M |
| 3300032076|Ga0306924_10294824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1861 | Open in IMG/M |
| 3300032089|Ga0318525_10049030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2092 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.07% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100724081 | 3300000597 | Forest Soil | LAAASAPTAESSWLSYLLMTLGAALAAASGLRFLFV* |
| AF_2010_repII_A001DRAFT_101214701 | 3300000793 | Forest Soil | RLSPANGVKMVDPNEVNELDLAATPAVPADSSWLSYLLATLGAALAAASTVRFCLA* |
| JGI10216J12902_1075735581 | 3300000956 | Soil | EVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| C688J35102_1185154072 | 3300002568 | Soil | VDPNEVNELDLAAAPAPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| JGI25615J43890_10148372 | 3300002910 | Grasslands Soil | PASGVKMVDPNEVNELDLAAAPTTPTESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0062589_1023391962 | 3300004156 | Soil | TVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0008092_110944731 | 3300004629 | Tropical Rainforest Soil | ELNELDLAAASAPTAESSWLSYLLMTLGAALAAASGLRFLFV* |
| Ga0066685_109690391 | 3300005180 | Soil | VVDPNDLNELDVAAASAAPAGSAESSWLSYLLMTLGGALAAASTVRFLFFV* |
| Ga0066388_1048453162 | 3300005332 | Tropical Forest Soil | PNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0070696_1006096542 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ELDLAAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0066695_100754843 | 3300005553 | Soil | MVDPNEVNELDLAAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0066706_106869231 | 3300005598 | Soil | AAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0066706_111158631 | 3300005598 | Soil | AAAAPTPEPTGTSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0066905_1015633362 | 3300005713 | Tropical Forest Soil | LVDPNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0066905_1017413141 | 3300005713 | Tropical Forest Soil | ELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFA* |
| Ga0066903_1002891312 | 3300005764 | Tropical Forest Soil | MVDPNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG* |
| Ga0066903_1005539333 | 3300005764 | Tropical Forest Soil | SGVKMVDPNEVNELDLAATPATPAGSSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0066903_1023351101 | 3300005764 | Tropical Forest Soil | AAAPSPATESATAPAAPDSVQMVDSNEVNELDLAAAAPTPEPTGTSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0066652_1013034011 | 3300006046 | Soil | VDPNELNELDLAAAGAPPAQSSWLGSLLMTLGAALAAASAVRAFFV* |
| Ga0075432_101672302 | 3300006058 | Populus Rhizosphere | PNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG* |
| Ga0070712_1008486652 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAPRGSAESSWLSYLLMTLGGALAAASTVRFLFFV* |
| Ga0075367_101206293 | 3300006178 | Populus Endosphere | VATVDPNEVNELDLAAAAPAPTPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0074054_121258912 | 3300006579 | Soil | ELDLAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0074060_100109231 | 3300006604 | Soil | AAAPAPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0079222_113185982 | 3300006755 | Agricultural Soil | AAPAAPAESSWLSYLLATLGAALAAASTVRFLFA* |
| Ga0075428_1023726011 | 3300006844 | Populus Rhizosphere | DLAATSAAPRGSAESSWLSYLLMTLGGALAAASTMRFLFFV* |
| Ga0075421_1018747541 | 3300006845 | Populus Rhizosphere | VDPNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0075433_107317452 | 3300006852 | Populus Rhizosphere | VDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0075426_104460071 | 3300006903 | Populus Rhizosphere | ASGVKMVDPNEVNELDLAAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0074063_101131732 | 3300006953 | Soil | AAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0075419_106289961 | 3300006969 | Populus Rhizosphere | DPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0075435_1007689821 | 3300007076 | Populus Rhizosphere | AANEVRVVEPNELNELDVAAASAAPAGSAESSWLSYLLMTLGGALAAASTVRFLFFV* |
| Ga0099794_107544971 | 3300007265 | Vadose Zone Soil | NEIDLAAREPEPADSSWLRYLLATLGAALAAASMVRFLSV* |
| Ga0099830_111618352 | 3300009088 | Vadose Zone Soil | VNELDLAAAPTTPTESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0111539_105851542 | 3300009094 | Populus Rhizosphere | ALNELDLAATSAAPRGSAESSWLSYLLMTLGGALAAASTMRFLFFV* |
| Ga0126384_108860041 | 3300010046 | Tropical Forest Soil | MVDPHEVKELDLAATSATPAASSWLSYLLATLGAALAAASTVRFFFA* |
| Ga0126382_108799842 | 3300010047 | Tropical Forest Soil | AGNVKLVDPNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0134082_103647782 | 3300010303 | Grasslands Soil | TPTVPASGVKMVDPNEVNELDLAAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0126376_122782231 | 3300010359 | Tropical Forest Soil | NGVKMVDPNEVNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG* |
| Ga0126372_126884682 | 3300010360 | Tropical Forest Soil | VPANGVKMVDPNEVNELDLAATPAVPADSSWLSYLLATLGAALAAASTVRFCLA* |
| Ga0126378_126289732 | 3300010361 | Tropical Forest Soil | VPANGVKMVDPNEVNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFA* |
| Ga0126378_129021652 | 3300010361 | Tropical Forest Soil | VDPHELNELDLAATSTPPAESSWLSYLLMTLGGALAAASGLRFLFV* |
| Ga0126377_113363682 | 3300010362 | Tropical Forest Soil | AAAGNVKLVDPNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0126381_1047538132 | 3300010376 | Tropical Forest Soil | VKMVDPNEVNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG* |
| Ga0134126_112192121 | 3300010396 | Terrestrial Soil | PNELNELDLAATSAAPRGSAESSWLSYLLMTLGGALAAASTVRFLFFV* |
| Ga0134121_111360222 | 3300010401 | Terrestrial Soil | AAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0124844_11487081 | 3300010868 | Tropical Forest Soil | VVDPNELNELDVAAASAAPAGSAESSWLSYLLMTLGGALAAASTMRFLFFV* |
| Ga0124844_11806781 | 3300010868 | Tropical Forest Soil | NEVNELDLAATPSTPAESSWLRSLLATLGAALAAASTVRFLFG* |
| Ga0105246_116652271 | 3300011119 | Miscanthus Rhizosphere | EVNEIDLAAREPEPAASSWLRYLVATLGAALAAASMVRFLFV* |
| Ga0137391_107475871 | 3300011270 | Vadose Zone Soil | AVRFVRSDEVNEIDLAAREPEPADSSWLRYLVATLGAALAAASMARFLFV* |
| Ga0137389_113055741 | 3300012096 | Vadose Zone Soil | STVQLVDPREPNELDLAADSQAPAQSGWLSSLLATLGAALAAASAMRFLFV* |
| Ga0137383_102666281 | 3300012199 | Vadose Zone Soil | GNELDLAATPAVPAESSWLSYLLATLGAALAAASTVRFLFA* |
| Ga0137382_107601502 | 3300012200 | Vadose Zone Soil | AAANEVRVVDPNELNELDLAAANADPAGSAGSSWLSYLLMTLGGALAAASTVRFLFFV* |
| Ga0137381_101780743 | 3300012207 | Vadose Zone Soil | KMVDPNEINELDLAAAPAAPAESSWLGYLLATLGAALAAASTVRFLFA* |
| Ga0137361_111308922 | 3300012362 | Vadose Zone Soil | DLAAAPITPAESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0150984_1182740862 | 3300012469 | Avena Fatua Rhizosphere | PALTAGVATVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0157310_101365251 | 3300012916 | Soil | ATVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0137404_106626232 | 3300012929 | Vadose Zone Soil | DPNEVNELDLAAAPTTPTESSWLSSLLATLGAALAAASTVRFLFG* |
| Ga0126375_114456912 | 3300012948 | Tropical Forest Soil | VKLVDPNEVNELDLAAAAPAPAPAESSWLSYLLVTLGGALAAASTVRLFLF* |
| Ga0126375_119162281 | 3300012948 | Tropical Forest Soil | DPNEVNELDLAATPAMPADSSWLSYLLATLGAALAAASTVRFLFA* |
| Ga0164298_101323972 | 3300012955 | Soil | AAAAPAPAPAESSWLKYLLTPLGAALAAASTVRFLFV* |
| Ga0164299_101563172 | 3300012958 | Soil | VATVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV* |
| Ga0182036_101151893 | 3300016270 | Soil | GVKMVDPNEVNELDLAATPAVPADSSWLSYLLATLGAALAAASTVRFCLA |
| Ga0182039_102197471 | 3300016422 | Soil | LDLAAAPTTPAESSWLRYLLATLGAALAAASSLRFLVA |
| Ga0182038_104694322 | 3300016445 | Soil | MVDPNEVNELDLAAASTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0184604_103757931 | 3300018000 | Groundwater Sediment | NGVNELDLAAATPAPAPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0193693_10174121 | 3300019996 | Soil | QTATAPALAGGVATVDPNEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLF |
| Ga0193755_10487292 | 3300020004 | Soil | NEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0210382_102397781 | 3300021080 | Groundwater Sediment | PAEAVRFVNSDEINEIDLAAKEPEPADSSWLRYLMATLGAALAAASMVRFLFV |
| Ga0210410_109431401 | 3300021479 | Soil | NELDLAAAPATPTESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0207692_102916092 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AAPRGSAESSWLSYLLMTLGGALAAASTVRFLFFV |
| Ga0207654_104044432 | 3300025911 | Corn Rhizosphere | AAVTAGVATVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0207693_100187601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAPRGSAESSWLSYLLMTLGGALAAASTVRFLFFV |
| Ga0207646_103724372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NELDLAATPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0207690_114178122 | 3300025932 | Corn Rhizosphere | ELDLAATSAAPRGSAESSWLSYLLMTLGGALAAASTVRFLFFV |
| Ga0209325_10010563 | 3300027050 | Forest Soil | MVDPNEVNELDLAAAPATPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0208995_10002641 | 3300027388 | Forest Soil | APALARGVATVDPNEVNELDLAAGPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0209283_101961521 | 3300027875 | Vadose Zone Soil | AAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0207428_107862961 | 3300027907 | Populus Rhizosphere | PNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG |
| Ga0307303_100694001 | 3300028713 | Soil | DLAAAPTPGPAESSSIKYLLATLGAALAAASTVRFLFV |
| Ga0307317_100335951 | 3300028720 | Soil | QTATAPALAGVATVDPNEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0307297_101388321 | 3300028754 | Soil | GVATVDPNEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0307284_100679262 | 3300028799 | Soil | VDPNEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0307310_102118501 | 3300028824 | Soil | GGVATVDPNEVNELDLAAAPTPGPAESSRIKYLLATLGAALAAASTVRFLFV |
| Ga0307278_100459113 | 3300028878 | Soil | NELDLAAAAALPDESSWLSYLVMTLGGALAAASAVRFLFV |
| Ga0307278_102849822 | 3300028878 | Soil | DFAAAPALPDESSWLSYLVMTLGGALAAASAVRFLFV |
| Ga0307300_101242141 | 3300028880 | Soil | APTAPALANGVATVDSNEVNELDLAAAPTPGPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0308200_11425191 | 3300030905 | Soil | NELDLAAATPAPAPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0170818_1080446692 | 3300031474 | Forest Soil | ANGVATVDPNEVNELDLAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0318516_107189132 | 3300031543 | Soil | PASGVKMVDPNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG |
| Ga0318516_107435722 | 3300031543 | Soil | ELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0318534_105756382 | 3300031544 | Soil | LDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0318528_103648342 | 3300031561 | Soil | IPTVPASGVKMVDPNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG |
| Ga0318555_102950911 | 3300031640 | Soil | MVDPNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG |
| Ga0318572_100913313 | 3300031681 | Soil | GRVKMVNPNEVNELDLAAAPTTPAGSSWLSYLLATLGAALAAASSLRFLVA |
| Ga0318496_108589011 | 3300031713 | Soil | PNEVNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0306917_110292621 | 3300031719 | Soil | LAATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0306918_109330102 | 3300031744 | Soil | VNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0318509_101075023 | 3300031768 | Soil | PNEVNELDLAAAPTTPAGSSWLSYLLATLGAALAAASSLRFLVA |
| Ga0318509_104154242 | 3300031768 | Soil | KMVDPNEVNELDLAATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0318526_100260301 | 3300031769 | Soil | MNELDLAAAPTTAEASWLSYLLATLGAALAAASSLRFLVA |
| Ga0318529_100200023 | 3300031792 | Soil | PTVPARGVKMVDPNEVNELDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0318576_105179341 | 3300031796 | Soil | NELDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0310892_105995082 | 3300031858 | Soil | AAGSVATVDPNEVNELDLAAAAPTPAPAESSWIKYLLATLGAALAAASTVRFLFV |
| Ga0318527_102151171 | 3300031859 | Soil | VKMVDPNEVNELDLAATPATPAESSWLRSLLATLGAALAAASTVRFLFG |
| Ga0318544_102557421 | 3300031880 | Soil | PARGVKMVDPNEVNELDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0318520_101160043 | 3300031897 | Soil | IPAGRVKMVNPNEVNELDLAAAPTTPAGSSWLSYLLATLGAALAAASSLRFLVA |
| Ga0318530_101432301 | 3300031959 | Soil | PTIPAGRVKMVNPNEVNELDLAAAPTTPAGSSWLSYLLATLGAALAAASSLRFLVA |
| Ga0310911_104086963 | 3300032035 | Soil | VPASGVKMVDPNEVNELDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0318545_102871121 | 3300032042 | Soil | VKMVDPNEVNELDLAAAPTTPAESSWLSSLLATLGAALAAASTVRFLFG |
| Ga0318558_102913652 | 3300032044 | Soil | SEVKVVDPHELNELDLAAASTPPAESSWLSYLLMTLGGALAAASGLRFLFV |
| Ga0318504_104195472 | 3300032063 | Soil | AATPATPAASSWLSYLLATLGAALAAASTVRFFFG |
| Ga0318513_100544041 | 3300032065 | Soil | LDLAAAPTTPAGSSWLSYLLATLGAALAAASSLRFLVA |
| Ga0318513_100691433 | 3300032065 | Soil | NEMNELDLAAAPTTAEASWLSYLLATLGTALAAASSLRFLVA |
| Ga0306924_102948243 | 3300032076 | Soil | NGVKMVDPNEVNELDLAATPAVPADSSWLSYLLATLGAALAAASTVRFCLA |
| Ga0318525_100490301 | 3300032089 | Soil | NELDLAAAPTTSEASWLSYLLATLGAALAAASSLRFLVA |
| ⦗Top⦘ |