| Basic Information | |
|---|---|
| Family ID | F079000 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AYDGADDWARELLEEADPDAPPSAEPGTVADAAFHVYARGAADYRP |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.97 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.621 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.966 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 74.14 |
| PF00376 | MerR | 6.03 |
| PF01569 | PAP2 | 2.59 |
| PF01638 | HxlR | 0.86 |
| PF01381 | HTH_3 | 0.86 |
| PF07295 | DUF1451 | 0.86 |
| PF00733 | Asn_synthase | 0.86 |
| PF03009 | GDPD | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.62 % |
| All Organisms | root | All Organisms | 41.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig73704 | Not Available | 718 | Open in IMG/M |
| 2170459004|F62QY1Z02I8JBM | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300001398|JGI20207J14881_1024200 | Not Available | 1419 | Open in IMG/M |
| 3300001534|A15PFW1_10356211 | Not Available | 673 | Open in IMG/M |
| 3300001686|C688J18823_10499936 | Not Available | 780 | Open in IMG/M |
| 3300002568|C688J35102_118217777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300002568|C688J35102_120188257 | Not Available | 918 | Open in IMG/M |
| 3300005167|Ga0066672_10659472 | Not Available | 675 | Open in IMG/M |
| 3300005171|Ga0066677_10612157 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005187|Ga0066675_10623899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300005327|Ga0070658_11950718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300005344|Ga0070661_101647835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300005458|Ga0070681_10237923 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300005518|Ga0070699_102203227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300005529|Ga0070741_10486781 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005530|Ga0070679_100113142 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300005530|Ga0070679_100184644 | Not Available | 2057 | Open in IMG/M |
| 3300005553|Ga0066695_10806241 | Not Available | 541 | Open in IMG/M |
| 3300005557|Ga0066704_10365776 | Not Available | 965 | Open in IMG/M |
| 3300005563|Ga0068855_100463370 | Not Available | 1382 | Open in IMG/M |
| 3300005564|Ga0070664_101923281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300005616|Ga0068852_102328413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300005764|Ga0066903_105960379 | Not Available | 639 | Open in IMG/M |
| 3300006028|Ga0070717_11441733 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006032|Ga0066696_10611407 | Not Available | 707 | Open in IMG/M |
| 3300006175|Ga0070712_101708394 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006638|Ga0075522_10326499 | Not Available | 739 | Open in IMG/M |
| 3300006804|Ga0079221_10521670 | Not Available | 777 | Open in IMG/M |
| 3300009093|Ga0105240_12221050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300009098|Ga0105245_10882980 | Not Available | 935 | Open in IMG/M |
| 3300010229|Ga0136218_1006967 | Not Available | 1189 | Open in IMG/M |
| 3300010301|Ga0134070_10139828 | Not Available | 863 | Open in IMG/M |
| 3300010358|Ga0126370_11611466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010362|Ga0126377_11723211 | Not Available | 702 | Open in IMG/M |
| 3300010373|Ga0134128_11668384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 701 | Open in IMG/M |
| 3300010375|Ga0105239_12831025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300010396|Ga0134126_11145941 | Not Available | 866 | Open in IMG/M |
| 3300010399|Ga0134127_11981855 | Not Available | 660 | Open in IMG/M |
| 3300010399|Ga0134127_12577777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300010399|Ga0134127_13534305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300010400|Ga0134122_11750945 | Not Available | 651 | Open in IMG/M |
| 3300012203|Ga0137399_11421911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300012212|Ga0150985_104116522 | Not Available | 2731 | Open in IMG/M |
| 3300012930|Ga0137407_11675771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300012951|Ga0164300_10224567 | Not Available | 936 | Open in IMG/M |
| 3300012958|Ga0164299_10316000 | Not Available | 967 | Open in IMG/M |
| 3300012958|Ga0164299_10959553 | Not Available | 626 | Open in IMG/M |
| 3300012960|Ga0164301_10011050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3653 | Open in IMG/M |
| 3300012960|Ga0164301_11217812 | Not Available | 606 | Open in IMG/M |
| 3300012961|Ga0164302_11140437 | Not Available | 619 | Open in IMG/M |
| 3300012985|Ga0164308_11430742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300012986|Ga0164304_10710824 | Not Available | 764 | Open in IMG/M |
| 3300012988|Ga0164306_10543000 | Not Available | 901 | Open in IMG/M |
| 3300012989|Ga0164305_10136269 | Not Available | 1643 | Open in IMG/M |
| 3300012989|Ga0164305_11389267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300013104|Ga0157370_11320226 | Not Available | 650 | Open in IMG/M |
| 3300013105|Ga0157369_11179576 | Not Available | 782 | Open in IMG/M |
| 3300013307|Ga0157372_12688480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300013765|Ga0120172_1128059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300013766|Ga0120181_1118584 | Not Available | 578 | Open in IMG/M |
| 3300013772|Ga0120158_10348507 | Not Available | 697 | Open in IMG/M |
| 3300014497|Ga0182008_10808041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 545 | Open in IMG/M |
| 3300014827|Ga0120171_1076305 | Not Available | 909 | Open in IMG/M |
| 3300014829|Ga0120104_1117595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300014969|Ga0157376_10463410 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300015203|Ga0167650_1093064 | Not Available | 683 | Open in IMG/M |
| 3300015245|Ga0137409_10456286 | Not Available | 1098 | Open in IMG/M |
| 3300015374|Ga0132255_106097114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300017936|Ga0187821_10245389 | Not Available | 698 | Open in IMG/M |
| 3300017959|Ga0187779_10010911 | Not Available | 5201 | Open in IMG/M |
| 3300018058|Ga0187766_11403783 | Not Available | 513 | Open in IMG/M |
| 3300018482|Ga0066669_10277080 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300020070|Ga0206356_10076663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300020070|Ga0206356_10482114 | Not Available | 864 | Open in IMG/M |
| 3300020081|Ga0206354_10561604 | Not Available | 1229 | Open in IMG/M |
| 3300020082|Ga0206353_10902396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300025482|Ga0208715_1096354 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025703|Ga0208357_1080923 | Not Available | 993 | Open in IMG/M |
| 3300025906|Ga0207699_10836744 | Not Available | 677 | Open in IMG/M |
| 3300025909|Ga0207705_10501002 | Not Available | 943 | Open in IMG/M |
| 3300025909|Ga0207705_10836133 | Not Available | 714 | Open in IMG/M |
| 3300025912|Ga0207707_10496364 | Not Available | 1041 | Open in IMG/M |
| 3300025913|Ga0207695_10205502 | Not Available | 1882 | Open in IMG/M |
| 3300025914|Ga0207671_11544415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300025920|Ga0207649_10334068 | Not Available | 1117 | Open in IMG/M |
| 3300025920|Ga0207649_10945804 | Not Available | 677 | Open in IMG/M |
| 3300025920|Ga0207649_11419593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300025921|Ga0207652_11664287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300025924|Ga0207694_10771901 | Not Available | 812 | Open in IMG/M |
| 3300025924|Ga0207694_11485958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300025929|Ga0207664_10411715 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300025944|Ga0207661_10995943 | Not Available | 772 | Open in IMG/M |
| 3300025944|Ga0207661_11747680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300025986|Ga0207658_10438469 | Not Available | 1154 | Open in IMG/M |
| 3300026330|Ga0209473_1221268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300027821|Ga0209811_10153279 | Not Available | 855 | Open in IMG/M |
| 3300027821|Ga0209811_10398201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300027826|Ga0209060_10171238 | Not Available | 1004 | Open in IMG/M |
| 3300027875|Ga0209283_10282704 | Not Available | 1097 | Open in IMG/M |
| 3300031249|Ga0265339_10061960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2012 | Open in IMG/M |
| 3300031680|Ga0318574_10114855 | Not Available | 1505 | Open in IMG/M |
| 3300031793|Ga0318548_10359772 | Not Available | 714 | Open in IMG/M |
| 3300031795|Ga0318557_10058764 | Not Available | 1636 | Open in IMG/M |
| 3300031821|Ga0318567_10830946 | Not Available | 523 | Open in IMG/M |
| 3300031939|Ga0308174_10936252 | Not Available | 733 | Open in IMG/M |
| 3300031939|Ga0308174_11846629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300031942|Ga0310916_11118464 | Not Available | 654 | Open in IMG/M |
| 3300031942|Ga0310916_11184935 | Not Available | 632 | Open in IMG/M |
| 3300032074|Ga0308173_10807041 | Not Available | 864 | Open in IMG/M |
| 3300032829|Ga0335070_10217698 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300032893|Ga0335069_12485764 | Not Available | 536 | Open in IMG/M |
| 3300032896|Ga0335075_10196127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2424 | Open in IMG/M |
| 3300032898|Ga0335072_11606566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300034195|Ga0370501_0367225 | Not Available | 524 | Open in IMG/M |
| 3300034268|Ga0372943_0645407 | Not Available | 697 | Open in IMG/M |
| 3300034384|Ga0372946_0663165 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.86% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010229 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 | Engineered | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0704.00004990 | 2166559005 | Simulated | KRVGQVFTLGELADAYDGADEWARSLLDDADPDAPPATEPGTVADAAFHAYARGAADYRP |
| E4B_06196290 | 2170459004 | Grass Soil | ARDAIDRADPEAPPPTELPAVTGAAFRQYARGATDYRP |
| JGI20207J14881_10242001 | 3300001398 | Arctic Peat Soil | ADEWARSLLADADPDAPVISEPGTVADAAFHLFARGASDYSP* |
| A15PFW1_103562111 | 3300001534 | Permafrost | AYEGADEWARELLEDAAGPDAPPTVEAGTVADAAFHLYARGAVDYRP* |
| C688J18823_104999361 | 3300001686 | Soil | LLDDADPEGPPAAEAGTVADAAFHVYARGATDYRP* |
| C688J35102_1182177771 | 3300002568 | Soil | AYEGADEWARMLLDDADPEGGPSHEPGTVADAAFHAYARGALDYQP* |
| C688J35102_1201882571 | 3300002568 | Soil | EWVRELLDEAEPDAPPPTEPGTIADAAFHVYAHGAVDYRP* |
| Ga0066672_106594721 | 3300005167 | Soil | AYDGADDWARELLEEADPDAPPSAEPGTVADAAFHVYARGAADYRP* |
| Ga0066677_106121571 | 3300005171 | Soil | AYVGADDWVRELLEEADPEGVPAEPGTVADAAFHVYARGALDYRP* |
| Ga0066675_106238993 | 3300005187 | Soil | DWVRELLEEADPEGVPAEPGTVADAAFHVYARGALDYRP* |
| Ga0070658_119507183 | 3300005327 | Corn Rhizosphere | DEWARELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0070661_1016478351 | 3300005344 | Corn Rhizosphere | WVRELLDEADPEAPVPTEPGTIADAAFHAYARGALDYRP* |
| Ga0070681_102379231 | 3300005458 | Corn Rhizosphere | ELAAAYDGADEWARTLLDEAEPEAPVTAEPGTLADAAFHAYARGASDYRP* |
| Ga0070699_1022032271 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LAELADAYDGADDWARSLLDDADPDAAPVAEPGTVADAAFHLYARGATDYRP* |
| Ga0070741_104867811 | 3300005529 | Surface Soil | LAELASVYDGADDWVRDMLEEADPEGKTPREPGTVADAAFHAYARSALDYRP* |
| Ga0070679_1001131426 | 3300005530 | Corn Rhizosphere | RVGQVFTLAELAAAYDGADEWARTLLDEAEPEAPVTAEPGTLADAAFHAYARGASDYRP* |
| Ga0070679_1001846446 | 3300005530 | Corn Rhizosphere | AYEGADEWTRELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0066695_108062413 | 3300005553 | Soil | TLAELADAYDGADDWARELLDAADPEAPPAAEAGTVADAAFHVYARGATDYRP* |
| Ga0066704_103657761 | 3300005557 | Soil | ARELLEAAADPDEPPAPEAGTVADAAFHAYARGAVDYRP* |
| Ga0068855_1004633701 | 3300005563 | Corn Rhizosphere | GAYDGADEWARSLLADADPDAPVISEPGTVADAAFHVFARGASDYAP* |
| Ga0070664_1019232811 | 3300005564 | Corn Rhizosphere | LDELAGAYDGADEWARSLIDDADPEGTPTAEPGTVADAAFHAYARGAADYTP* |
| Ga0068852_1023284131 | 3300005616 | Corn Rhizosphere | AALYGGADGWVLELLDAADPEGELPFEPGTVADAAFHAYSRGAVDYRP* |
| Ga0066903_1059603793 | 3300005764 | Tropical Forest Soil | LEDADPDGTVPAEPGTVADAAFHAYARGALDYRP* |
| Ga0070717_114417333 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAELADAYDGADEWARGLIDDADPEAAPADEPGTVADAAFHLYARGAADYEP* |
| Ga0066696_106114073 | 3300006032 | Soil | GQVFTLAELADAYDGADDWARELLDAADPEAPPAAEAGTVADAAFHVYARGATDYRP* |
| Ga0070712_1017083943 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FTLDELADTYAGADDWARDAIDRADPDAPPPTELPAVTGAAFRQYARGATDYRP* |
| Ga0075522_103264991 | 3300006638 | Arctic Peat Soil | DDWARELLDDAAEPDAPPTAEAGTVADAAFHLYARGAVDYRP* |
| Ga0079221_105216703 | 3300006804 | Agricultural Soil | GADHWVLELLEEADPEGAVPFEPGTVADAAFHAYARGAVDYRP* |
| Ga0105240_122210503 | 3300009093 | Corn Rhizosphere | YGGADGWVLELLEDADPNGAAPVEPGTIADAAFHAYARGAVDYRP* |
| Ga0105245_108829803 | 3300009098 | Miscanthus Rhizosphere | LLDEADPEAPPPFEPGTVADAAFYQYARGAADYAP* |
| Ga0136218_10069673 | 3300010229 | Soil | XXXXDDWVLELLEDGDPEGRVPLEPGTVADAAFHAYARGAVDYRP* |
| Ga0134070_101398283 | 3300010301 | Grasslands Soil | GADDWARELLDAAADPDAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0126370_116114661 | 3300010358 | Tropical Forest Soil | AYGGADDWVLELLEDADPEGRVPLEPGTVADAAFHAYARGAVDYRP* |
| Ga0126377_117232111 | 3300010362 | Tropical Forest Soil | RVGQVFTLGELADAYDGADEWARNLLDDVDPDAPPTTEPGTVADAAFHAYARGAADYRP* |
| Ga0134128_116683843 | 3300010373 | Terrestrial Soil | PARVRELVDAYDGADDWARELLEDADPDAPPAVEAGTVADAAFHAYARGAADYRP* |
| Ga0105239_128310251 | 3300010375 | Corn Rhizosphere | LADAYDGADEWARTLLDDADPDAAPATEPGTIADAAFHLYARGATDYRP* |
| Ga0134126_111459413 | 3300010396 | Terrestrial Soil | EVGQTFTLAELADAYVGADDWARTLLDEADPDAPPPLEPGTVADAAFYQYARGASDYAP* |
| Ga0134127_119818551 | 3300010399 | Terrestrial Soil | DEWARTLLDDADPDAAPATEPGTIADAAFHLYARGATDYRP* |
| Ga0134127_125777771 | 3300010399 | Terrestrial Soil | AYGGADDWVLELLEDTDPDGAVPLEPGTVADAAFHAYARGAVDYRP* |
| Ga0134127_135343051 | 3300010399 | Terrestrial Soil | WVLELLEDADPNGAAPVEPGTIADAAFHAYARGAVDYRP* |
| Ga0134122_117509453 | 3300010400 | Terrestrial Soil | LADAYVGADDWARTLLDEADPEAPPPLEPGTVADAAFYQYARGASDYAP* |
| Ga0137399_114219113 | 3300012203 | Vadose Zone Soil | VAGLRRRLGQVFTLAELAAAYSGADDWARELLEDADPEAPLAAEPGTIADAAFHVYARGATDYRP* |
| Ga0150985_1041165228 | 3300012212 | Avena Fatua Rhizosphere | VLELLDEAEPEAPPAAEAGTVADAAFHLYARGAVDYRP* |
| Ga0137407_116757711 | 3300012930 | Vadose Zone Soil | ELAAAYGGADDWVRDLLEDADPDGGVPTEPGTIADAAFHAYARGALDYRP* |
| Ga0164300_102245671 | 3300012951 | Soil | IGQTFTLGELAEAYDGADEWTRTLLEDVDPDAPPVLEPGTVADAAFHQYARGAVDYAP* |
| Ga0164299_103160003 | 3300012958 | Soil | ARELLEAAAAPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0164299_109595533 | 3300012958 | Soil | DELAGAYDGADEWARSLIDDADPEGMPSSEPGTVADAAFHAYARGATDYSP* |
| Ga0164301_100110501 | 3300012960 | Soil | DEWTRTLLEDVDPDAPPVLEPGTVADAAFHQYARGAVDYAP* |
| Ga0164301_112178123 | 3300012960 | Soil | VDRWAGAAIEEADPEESPATEPGTVADAAFHLYARGATDYRP* |
| Ga0164302_111404373 | 3300012961 | Soil | RELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0164308_114307423 | 3300012985 | Soil | GQIFTLDELAGAYDGADEWARTLLDDADPEGAPSHEPGTVSDAAFHAYARGATDYQP* |
| Ga0164304_107108243 | 3300012986 | Soil | VFTLDELAGAYDGADEWARSLIDDADPEGMPSSEPGTVADAAFHAYARGATDYSP* |
| Ga0164306_105430001 | 3300012988 | Soil | ARELLEDAEPDAPPAVEAGTVADAAFHAYARGAADYRP* |
| Ga0164305_101362695 | 3300012989 | Soil | ARELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0164305_113892673 | 3300012989 | Soil | ELADAYDGADEWARELLDDVEPDAPPALEAGTVADAAFHVYARGATDYRP* |
| Ga0157370_113202263 | 3300013104 | Corn Rhizosphere | VLELLEDTDPEGAVPLEPGTVADAAFHAYARGAVDYRP* |
| Ga0157369_111795763 | 3300013105 | Corn Rhizosphere | AYDGADEWVRDVLDEADPEGPGPSEPGTVADAAFHVYAHGAADYRP* |
| Ga0157372_126884802 | 3300013307 | Corn Rhizosphere | DAYDGADEWAHSTLDDAQPDAPPTSEPGTLADAAFHVYARGALDYRP* |
| Ga0120172_11280591 | 3300013765 | Permafrost | LAEAYDGADAWTGGLLEDADPEHAPATEPGTVADAAFHVYARGATDYHP* |
| Ga0120181_11185841 | 3300013766 | Permafrost | ADEWARGLIDDADPEAPADEPGTVADAAFHLYARGAVDYRP* |
| Ga0120158_103485073 | 3300013772 | Permafrost | FTLAELADAYDKADVWTGGLLDDADPDEAPATEPGTVADAAFHLYARGAADYHP* |
| Ga0182008_108080412 | 3300014497 | Rhizosphere | AYEGADEWARELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP* |
| Ga0120171_10763053 | 3300014827 | Permafrost | LEDAADPDEPPTAEAGTVADAAFHVYARGAVDYRP* |
| Ga0120104_11175953 | 3300014829 | Permafrost | LIDDADPEGAPAAEPGTVADAAFHLYARGAVDYRP* |
| Ga0157376_104634101 | 3300014969 | Miscanthus Rhizosphere | LLDDADPEGAPSHEPGTVSDAAFHAYARGAADYRP* |
| Ga0167650_10930641 | 3300015203 | Glacier Forefield Soil | ADAYDGADEWARELLDDAADPDAPPAAEAGTVADAAFHVYARGAVDYRP* |
| Ga0137409_104562863 | 3300015245 | Vadose Zone Soil | DVVVAGLRRRLGQVFTLAELAAAYAGADDWARELLEDADPEAPLAAEPGTIADAAFHVYARGATDYRP* |
| Ga0132255_1060971143 | 3300015374 | Arabidopsis Rhizosphere | ELLDESDPEGPPPTEPGTVADAAFHAYARGAADYRP* |
| Ga0187821_102453891 | 3300017936 | Freshwater Sediment | FTLVELADAYDGAEDWARDVVDLADPEAPPTADAAAVTDAAFHNYARGAADYRP |
| Ga0187779_100109111 | 3300017959 | Tropical Peatland | DGADAWVRDLLDDEDPDGRPVVEAGTVADAAFHSYARGASDYRP |
| Ga0187766_114037833 | 3300018058 | Tropical Peatland | ELADAYDGADDWVRELLEDRFPDAPPPHEPGTVADAAFHVYARSASDYRP |
| Ga0066669_102770801 | 3300018482 | Grasslands Soil | GVYDGADEWARSLLDDADPEAPPVTEPGTVADAAFHLYARGATDYRP |
| Ga0206356_100766631 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | EELATAYDGVDDWVLELLEDGDPEGRVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0206356_104821141 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | SFTLEELATAYDGVDDWVLELLEDGDPEGRVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0206354_105616041 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | GADEWVRDVLDDADPEGPGPSEPGTVADAAFHVYAHGAADYRP |
| Ga0206353_109023961 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTFTLAELANAYNGADDWARDAIDFADPDAPPPLEASTVTDAAFHRYAHGATDYIP |
| Ga0208715_10963542 | 3300025482 | Arctic Peat Soil | EGADEWARELLEDAADPDAPPAAEAGTVADAAFHVYARGAVDYRP |
| Ga0208357_10809233 | 3300025703 | Arctic Peat Soil | RSLLADADPDAPVISEPGTVADAAFHLFARGASDYSP |
| Ga0207699_108367441 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ELADAYDGADEWARELLDDVEPDAPPALEAGTVADAAFHVYARGATDYRP |
| Ga0207705_105010023 | 3300025909 | Corn Rhizosphere | ELLEDTDPEGAVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0207705_108361333 | 3300025909 | Corn Rhizosphere | LAELSGAYDGADEWARSLLADADPDAPVISEPGTVADAAFHVFARGASDYAP |
| Ga0207707_104963641 | 3300025912 | Corn Rhizosphere | ELAAAYDGADEWARTLLDEAEPEAPVTAEPGTLADAAFHAYARGASDYRP |
| Ga0207695_102055021 | 3300025913 | Corn Rhizosphere | LAALYGGADGWVLELLDAADPEGELPFEPGTVADAAFHAYSRGAVDYRP |
| Ga0207671_115444153 | 3300025914 | Corn Rhizosphere | GQSFTLDELAALYGGADGWVLELLDAADPEGELPFEPGTVADAAFHAYSRGAVDYRP |
| Ga0207649_103340684 | 3300025920 | Corn Rhizosphere | LELLEDGDPEGRVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0207649_109458041 | 3300025920 | Corn Rhizosphere | DDWVLELLEETDPDGAVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0207649_114195931 | 3300025920 | Corn Rhizosphere | WVRELLDEADPEAPVPTEPGTIADAAFHAYARGALDYRP |
| Ga0207652_116642871 | 3300025921 | Corn Rhizosphere | GVDDWVLELLEDGDPEGRVPLEPGTVADAAFHAYARGAVDYRP |
| Ga0207694_107719011 | 3300025924 | Corn Rhizosphere | MISRPSLDEWAHSTLDDAQPDAPPTSEPGTLADAAFHVYARGALDY |
| Ga0207694_114859583 | 3300025924 | Corn Rhizosphere | RTLLDEAEPEAPVTAEPGTLADAAFHAYARGASDYRP |
| Ga0207664_104117154 | 3300025929 | Agricultural Soil | QSYDGADDWARAVLDEANPEAPPVSEAGTVADAAFHLYARGATDYRP |
| Ga0207661_109959431 | 3300025944 | Corn Rhizosphere | AAYGAADDWVLELLEDADPDGAVPSEPGTVADAAFHAYARGAVDYRP |
| Ga0207661_117476803 | 3300025944 | Corn Rhizosphere | YEGADEWTRELLEAAADPEAPPTAEAGTVADAAFHAYARGAVDYRP |
| Ga0207658_104384694 | 3300025986 | Switchgrass Rhizosphere | VYADADAWVPHVLDDDDPETPVATEPGTVADAAFYAYARGAADYRP |
| Ga0209473_12212681 | 3300026330 | Soil | RERVGQVFTLAELAAAYDGADDWARELLEEADPDAPPSAEPGTVADAAFHVYARGAADYR |
| Ga0209811_101532793 | 3300027821 | Surface Soil | WARSLLDDADPEGLPSSEPGTVADAAFHAYARGAADYTP |
| Ga0209811_103982013 | 3300027821 | Surface Soil | ADLAVAYDGADDWVRELLDESDPEGPPPTEPGTVADAAFHAYARGAADYRP |
| Ga0209060_101712383 | 3300027826 | Surface Soil | YDGADDWVRDLLEDTNPDGAIPREPGTVMDAAFHAYARGALDYAP |
| Ga0209283_102827043 | 3300027875 | Vadose Zone Soil | WARGLLDDADPEAAPADEPGTVADAAFHLYARGAVDYKP |
| Ga0265339_100619606 | 3300031249 | Rhizosphere | DDWARHVLDDADPEAPPVSEAGTVADAAFHLYARGATDYRP |
| Ga0318574_101148554 | 3300031680 | Soil | YDGADDWVRTALDLAADPDAPVPAEVPAVAGAAFHQYARGATDYRP |
| Ga0318548_103597721 | 3300031793 | Soil | LDELAGAYDGADDWVRTALDLAADPDAPVPAEVPAVAGAAFHQYARGATDYRP |
| Ga0318557_100587645 | 3300031795 | Soil | RRVGQTFTLAELADVYDGADGWVRELLDDEDPDGRPVVEAGTVADAAFHHYARGASDYRP |
| Ga0318567_108309461 | 3300031821 | Soil | VYDGADGWVRELLDDEDPDGRPVVEAGTVADAAFHHYARGASDYRP |
| Ga0308174_109362521 | 3300031939 | Soil | AHSTLDDARPDTPPTSEPGTLADAAFHVYARGALDYRP |
| Ga0308174_118466291 | 3300031939 | Soil | DDWARTVLDDSDPEAPPTPTVGTLADAAFHQYARGASDYRP |
| Ga0310916_111184641 | 3300031942 | Soil | AELADVYDGADGWVRELLDDEDPDGRPVVEAGTVADAAFHHYARGASDYRP |
| Ga0310916_111849351 | 3300031942 | Soil | GADDWVRTALDLAADPDAPVPAEVPAVAGAAFHQYARGATDYRP |
| Ga0308173_108070413 | 3300032074 | Soil | AAAYGGADDWVLELLEDADPEGGVPLEPGTAADAAFHAYARGAVDYRP |
| Ga0335070_102176981 | 3300032829 | Soil | ADAYDGADDWARELLDDRFPDAVPHEPGTVTDAAFHVYARGASDYRP |
| Ga0335069_124857642 | 3300032893 | Soil | TFTLEELAEVYDGADGWVHDLLDDADPDGRAVVEAGTVADAAFHHYARGASDYRP |
| Ga0335075_101961275 | 3300032896 | Soil | WVLDTLDRADPDAPPPREAAAVADAAFHRYAVGATDYRP |
| Ga0335072_116065663 | 3300032898 | Soil | LASAYDGADDWVRELLDEHEPDDAVPSEPGTVADAAFHSYARGAADYRP |
| Ga0370501_0367225_367_522 | 3300034195 | Untreated Peat Soil | DELAEAYDGADDWARTVLDDAEPDAPPVAEAGTVADAAFHLYARGATDYRP |
| Ga0372943_0645407_512_691 | 3300034268 | Soil | VGQVFTLDELADAYEGADEWARELLEAAADPDAPPTAEAGTVADAAFHAYARGAADYRP |
| Ga0372946_0663165_2_175 | 3300034384 | Soil | QVFTLGELAEAYDGADDWARELLDAAADPDSPPTAEAGTVADAAFHSYARGAADYHP |
| ⦗Top⦘ |