Basic Information | |
---|---|
Family ID | F078999 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 45 residues |
Representative Sequence | VFFFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.72 % |
% of genes near scaffold ends (potentially truncated) | 96.55 % |
% of genes from short scaffolds (< 2000 bps) | 89.66 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.414 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.655 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.034 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.310 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF00762 | Ferrochelatase | 86.21 |
PF01578 | Cytochrom_C_asm | 0.86 |
PF03379 | CcmB | 0.86 |
PF01040 | UbiA | 0.86 |
PF03544 | TonB_C | 0.86 |
PF02628 | COX15-CtaA | 0.86 |
PF13462 | Thioredoxin_4 | 0.86 |
PF00069 | Pkinase | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 86.21 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.45 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.86 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.41 % |
Unclassified | root | N/A | 2.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100580429 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300004152|Ga0062386_100676733 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300004152|Ga0062386_100990123 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300004633|Ga0066395_10134821 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300004635|Ga0062388_100350460 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300005332|Ga0066388_101479911 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300005332|Ga0066388_102420371 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005467|Ga0070706_100223349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1758 | Open in IMG/M |
3300005526|Ga0073909_10722695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300005718|Ga0068866_10139646 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300005844|Ga0068862_101158235 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300005921|Ga0070766_11051591 | Not Available | 561 | Open in IMG/M |
3300006175|Ga0070712_101748963 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300006903|Ga0075426_11050653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300006904|Ga0075424_100083468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3356 | Open in IMG/M |
3300009545|Ga0105237_10703902 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300010043|Ga0126380_10918033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300010043|Ga0126380_11081316 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010043|Ga0126380_12127619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300010047|Ga0126382_12238668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300010048|Ga0126373_10402730 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300010048|Ga0126373_11658259 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300010048|Ga0126373_12309577 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010358|Ga0126370_11107890 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300010358|Ga0126370_11520710 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300010360|Ga0126372_10066967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2533 | Open in IMG/M |
3300010360|Ga0126372_11092027 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300010360|Ga0126372_12174147 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010360|Ga0126372_12187866 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300010361|Ga0126378_13019266 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012189|Ga0137388_11897987 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012202|Ga0137363_11305828 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300012362|Ga0137361_10605022 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300012925|Ga0137419_10933718 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300012925|Ga0137419_11086296 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012971|Ga0126369_11195628 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300012971|Ga0126369_12587330 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012971|Ga0126369_13536463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300012989|Ga0164305_10803097 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300013306|Ga0163162_13362909 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300013308|Ga0157375_10512809 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300014151|Ga0181539_1054956 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
3300014153|Ga0181527_1069026 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300014153|Ga0181527_1069076 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300015373|Ga0132257_103244005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300016294|Ga0182041_11655620 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300016319|Ga0182033_10672722 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300016319|Ga0182033_11704694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300016341|Ga0182035_11238520 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300016357|Ga0182032_11845215 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300016387|Ga0182040_11181728 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300016387|Ga0182040_11868216 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300016422|Ga0182039_10379860 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300016422|Ga0182039_11120382 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300016750|Ga0181505_11179837 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300017822|Ga0187802_10248304 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300017823|Ga0187818_10289965 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300017928|Ga0187806_1234216 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300017933|Ga0187801_10104759 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300017934|Ga0187803_10225765 | Not Available | 740 | Open in IMG/M |
3300017936|Ga0187821_10382859 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300017944|Ga0187786_10106245 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300017947|Ga0187785_10723957 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300017975|Ga0187782_11545922 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300017995|Ga0187816_10012365 | All Organisms → cellular organisms → Bacteria | 3201 | Open in IMG/M |
3300018012|Ga0187810_10117485 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300018085|Ga0187772_10275338 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300019788|Ga0182028_1225672 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300021181|Ga0210388_10224202 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300021403|Ga0210397_11283236 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300021407|Ga0210383_10083338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2679 | Open in IMG/M |
3300021420|Ga0210394_10090419 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
3300021474|Ga0210390_10525729 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300024317|Ga0247660_1078371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300025472|Ga0208692_1059139 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300025477|Ga0208192_1088706 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300025914|Ga0207671_10457385 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300025915|Ga0207693_10550616 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300025915|Ga0207693_11037962 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300025929|Ga0207664_11261954 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300025934|Ga0207686_10206867 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300026800|Ga0207742_114987 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300026862|Ga0207724_1016349 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300027011|Ga0207740_1002950 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300027024|Ga0207819_1020128 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300027035|Ga0207776_1028071 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300027049|Ga0207806_1010727 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300027104|Ga0208095_1016452 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300027667|Ga0209009_1083745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300027680|Ga0207826_1088895 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300027889|Ga0209380_10043700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2540 | Open in IMG/M |
3300027902|Ga0209048_10873670 | Not Available | 582 | Open in IMG/M |
3300028379|Ga0268266_10010070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8287 | Open in IMG/M |
3300031573|Ga0310915_10077972 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
3300031679|Ga0318561_10211923 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300031680|Ga0318574_10529748 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300031718|Ga0307474_10125230 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
3300031719|Ga0306917_11374486 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031781|Ga0318547_10103918 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300031793|Ga0318548_10578488 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031833|Ga0310917_10986857 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300031897|Ga0318520_10841371 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300031897|Ga0318520_11019764 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031910|Ga0306923_10520891 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300031912|Ga0306921_10060938 | All Organisms → cellular organisms → Bacteria | 4306 | Open in IMG/M |
3300031947|Ga0310909_11135784 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031954|Ga0306926_11394417 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300032001|Ga0306922_11553965 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300032076|Ga0306924_11046327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300032180|Ga0307471_101312956 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300032892|Ga0335081_11451690 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300032895|Ga0335074_10109499 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
3300032955|Ga0335076_10123968 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
3300033134|Ga0335073_11473647 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300033158|Ga0335077_11786264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300033289|Ga0310914_11260719 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.62% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1005804293 | 3300002245 | Forest Soil | VIMGGPGSGLEPTMAKVFFFSVLAMHVLMIFLIRERYILEQTSSEVELLQREAEAL* |
Ga0062386_1006767333 | 3300004152 | Bog Forest Soil | NKVFLFNVLVMHVFAAFLIVERYMLDKTKSEVEILQREVEA* |
Ga0062386_1009901231 | 3300004152 | Bog Forest Soil | PGSGLDPTMNKVFFFSVLAMHILMIFLIVERYSLEKMKSEVEILLREAEAQ* |
Ga0066395_101348213 | 3300004633 | Tropical Forest Soil | MKKVFFFNVLAMHVLALFLVVERYFLERTKHDVELLQREAEAR* |
Ga0062388_1003504603 | 3300004635 | Bog Forest Soil | FFFNVLAMHVLALFLIVERYSLEKMKHDVERLNRESEAA* |
Ga0066388_1014799113 | 3300005332 | Tropical Forest Soil | MGDPQSGLEPTMKATFFFSVLAMHVLMVFLIMERNRLEKLRFQVDVIRHELEVA* |
Ga0066388_1024203711 | 3300005332 | Tropical Forest Soil | SGLDPIMSKVFFFNVFVMHLFAAFLIVERYILEKLRHDVDVLQREAGAQ* |
Ga0070706_1002233494 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFNVAVMHVFAAFLIMERYSLEKSKHDVELLQHESEAR* |
Ga0073909_107226953 | 3300005526 | Surface Soil | LAMHVLAAFLIVERYLLEETKHDVEILQREAEAQ* |
Ga0068866_101396463 | 3300005718 | Miscanthus Rhizosphere | GLDPVMNKVFFFNVLAMHVLAAFLIAERYLLEKNKHEVELLQREAEAR* |
Ga0068862_1011582353 | 3300005844 | Switchgrass Rhizosphere | PAPVIMGGSGSGLDPVMKKVFFFNVLAMHVLAAFLIAERYFLAKTKHEVELLQREAEAR* |
Ga0070766_110515912 | 3300005921 | Soil | MNKVFFFSVFAMHVLTVFLLVERYGLEKMKSEVDVLQREAEAL* |
Ga0070712_1017489631 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLDPIMKKVFFFNVLALHVLAAFFIVERYLLEKVKYDVEILKEETESR* |
Ga0075426_110506533 | 3300006903 | Populus Rhizosphere | PTMKAVFFFNVAAMHVFAAFLIVERYSLEKDKRDVELLQQEVEAR* |
Ga0075424_1000834681 | 3300006904 | Populus Rhizosphere | FNVLAMHVFAAFLIVQRYFLEKAKHDVALLQREAEVR* |
Ga0105237_107039023 | 3300009545 | Corn Rhizosphere | FSVLAMHVFAAFLIVERYLLEKTKYDVELMAREAEAR* |
Ga0126380_109180333 | 3300010043 | Tropical Forest Soil | IMGDPQSGLEPTMKATFFFSVLAMHVLMVFLIMERNRLEKLRFQVDVIRHELEVA* |
Ga0126380_110813161 | 3300010043 | Tropical Forest Soil | MGGEGSGLDPAMRKVFFFNVLAMHILALFFIAERYLLEKSKHEAELLRREAEAR* |
Ga0126380_121276191 | 3300010043 | Tropical Forest Soil | KVFFLNVLAMHIFALFLVVERYFLEKTKHDVELLHREAES* |
Ga0126382_122386683 | 3300010047 | Tropical Forest Soil | VMRKVFFFNVLAMHILALFLIAERYLLEKSKHDAELLRREAEAR* |
Ga0126373_104027301 | 3300010048 | Tropical Forest Soil | VFVMHVFVLFLIVERYVLEKLRHDVDLLQREAEAQ* |
Ga0126373_116582591 | 3300010048 | Tropical Forest Soil | PAPVIMGGSGSGLDPTMSKVFFFNVLVMHFFAAFLIVERYVLEKMKHDVDLLQREAEAQ* |
Ga0126373_123095771 | 3300010048 | Tropical Forest Soil | DPTMSKVFFFNVLVMHVFCAFLIVERYIVEKLRHDVDLLQREAEVQ* |
Ga0126370_111078903 | 3300010358 | Tropical Forest Soil | VFFFNVLAMHVLALFLVVERYFLERTKHDVELLQREVEAR* |
Ga0126370_115207101 | 3300010358 | Tropical Forest Soil | PTMQKVFFLNVLAMHVLAAFLIVERYLLERNQHDVEMVQREAEAQ* |
Ga0126372_100669675 | 3300010360 | Tropical Forest Soil | GGEGSGLDPVMRKVFLFNVLAMHILALFLIAERYLLEKSKHDAELLRREAEAR* |
Ga0126372_110920273 | 3300010360 | Tropical Forest Soil | GLEPTMRKVFFLNVLAMHVLAAFLIVERYLLERNKHDVEILQREAEAQ* |
Ga0126372_121741471 | 3300010360 | Tropical Forest Soil | APVIMGGPGSGLDPVMKKVFLFNVLAMHVFAVFLIAERYYLEKTRHSVELLQREAEAR* |
Ga0126372_121878663 | 3300010360 | Tropical Forest Soil | LVMHIFAAFLIVERYVLEKMKNDVDLLQREAEVQ* |
Ga0126378_130192663 | 3300010361 | Tropical Forest Soil | VFVMHVFVLFLIVERYVLEKLRHDVDLLQHEAEAQ* |
Ga0137388_118979873 | 3300012189 | Vadose Zone Soil | GPGSGLDPTMRKVFFFSVLAAHFLAAFLIIERFILEKLRSEVEVLQREAEAQ* |
Ga0137363_113058283 | 3300012202 | Vadose Zone Soil | SVLAMHVLAAFLIVERYVLEKMKSEFDFLAREVEAQ* |
Ga0137361_106050223 | 3300012362 | Vadose Zone Soil | SGSGLDPTMSKVFFFSVLAMHILAAFLIVERYVLEKMKSELDFLAREVEAQ* |
Ga0137419_109337183 | 3300012925 | Vadose Zone Soil | LDPTMSKVFFFSVLAMHVLAAFLIVERYVLEKMKSEFDFLAREVEAQ* |
Ga0137419_110862963 | 3300012925 | Vadose Zone Soil | DPTMSKVFFFSVLAMHVLAAFLIVERYVLEKMKSELDFVVREVEAQ* |
Ga0126369_111956283 | 3300012971 | Tropical Forest Soil | NVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ* |
Ga0126369_125873303 | 3300012971 | Tropical Forest Soil | VLAMHVLAAFLIVERYLLERNQHDVEMVQREAEAQ* |
Ga0126369_135364631 | 3300012971 | Tropical Forest Soil | KVFFLNVLAMHTLALFLIVERYLLEKSKHDVELMRREAEVR* |
Ga0164305_108030971 | 3300012989 | Soil | KKVFFFNVLAMHVFAAFLIFERYFLEKTKHDVELLQREAEGR* |
Ga0163162_133629093 | 3300013306 | Switchgrass Rhizosphere | APVIMGGPGSGLEPTMKAVFFFNVAVMHVFAAFLIMERYSLEKTKHDVQLLQHEAEAR* |
Ga0157375_105128091 | 3300013308 | Miscanthus Rhizosphere | DSGLEPTMKAVFFFNVAVMHVFAAFLIMERYSLEKSKHDVELLQHESEAR* |
Ga0181539_10549564 | 3300014151 | Bog | GPGSGLDPTMRKVLFFSGLAMCVLMAFLIVERYALEKMRSEVDILKREAEAQ* |
Ga0181527_10690263 | 3300014153 | Bog | IMGGPGSGLDPTMRKVLFFSGLAMCVLMAFLIVERYALEKMRSEVDILKREAEAQ* |
Ga0181527_10690763 | 3300014153 | Bog | IMGGPGSGLDPTMRKVLFFSGLAMCVLMAFLIVERYALEKIRSEVDILKREAEAQ* |
Ga0132257_1032440051 | 3300015373 | Arabidopsis Rhizosphere | NKVFFFNVLAMHVLAAFLIAERYLLEKNKHEVELLHREAEAR* |
Ga0182041_116556203 | 3300016294 | Soil | FFFNVLGMHVFASFQFVESYVIEKMKHDYDLLQREAEAQ |
Ga0182033_106727223 | 3300016319 | Soil | VLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0182033_117046941 | 3300016319 | Soil | IMGGEGSGLDPVMRKVFFFNVLAMHILALFLIAERYLLEKSKHDAELLRREAEAR |
Ga0182035_112385203 | 3300016341 | Soil | VLVMHIFAAFLIVERYVVEKMKNDVELLQREAEAQ |
Ga0182032_118452151 | 3300016357 | Soil | KVFFFNVLAMHALALFLIAERYRLERMEEEVEVLQWEAEAQ |
Ga0182040_111817281 | 3300016387 | Soil | VFVMHLFVAFLIVERYILEKFRHDVDALQREAEAQ |
Ga0182040_118682161 | 3300016387 | Soil | QGSGLDPTMSKVFFFNVLVMHVFCAFLIVERYIVEKLRHDVDLLQREAEVQ |
Ga0182039_103798601 | 3300016422 | Soil | NVLVMHVFCAFLIVERYIVEKLRHDVDLLQREAEVQ |
Ga0182039_111203823 | 3300016422 | Soil | LDPTMNKVFFFNVFVMHLFVAFLIVERYILEKLRHDVDLLQREVEAQ |
Ga0181505_111798371 | 3300016750 | Peatland | TMKKVFFFTVLAMNVFAGFLIVERYILEKLKHEVDILQREAEA |
Ga0187802_102483043 | 3300017822 | Freshwater Sediment | LFFFVFAMHVFALFLIVERYILEKMKNEVDILQREVETL |
Ga0187818_102899653 | 3300017823 | Freshwater Sediment | VIMGGSGSGLDPTMNKVFFFSVFAMHVFAAFLIVERYVLEQMRHDVELLQREAEA |
Ga0187806_12342163 | 3300017928 | Freshwater Sediment | SVLAMHVLMAFLIVERYSLEKMKSEVDILQREAEAQ |
Ga0187801_101047594 | 3300017933 | Freshwater Sediment | GLEHTMKLVLFFFVFAMHVFAAFLIVERYVLEKMKNEVDILQREAEAQ |
Ga0187803_102257651 | 3300017934 | Freshwater Sediment | LDPTMKKVFLFSVLAMHLLMIFLVIERYVLEKTRTEVDILLREAEAQ |
Ga0187821_103828593 | 3300017936 | Freshwater Sediment | DSGLDPLMKKVFFFNVLAMHVFAAFLIVERYILEQTKHDVASLQQEAEAQ |
Ga0187786_101062451 | 3300017944 | Tropical Peatland | MGAPGSGLDPTMKKVFFFSVLAMHVLMAFLIVERYALEKMRSEVDVLRHEAEAL |
Ga0187785_107239573 | 3300017947 | Tropical Peatland | VFMGGPNSGLADPTMKKVFYFSVLVMHVFALFLILERYALEKLKHDVDILKRELEVA |
Ga0187782_115459223 | 3300017975 | Tropical Peatland | DPEMKKVFFFAVFAMHVFAAFLIVERYILEKMKNEVDILQREAEAL |
Ga0187816_100123651 | 3300017995 | Freshwater Sediment | TGSGLDPTMNKVFFFNVLAMHVFAAFLIVERYVVEKMKHEVDLLQREAEAL |
Ga0187810_101174851 | 3300018012 | Freshwater Sediment | PSPVIMGGQGSGLDPTMKSVFFFSALAMHVFMAFLIAERYGLEKLQTETDFLVREVEAQ |
Ga0187772_102753383 | 3300018085 | Tropical Peatland | DPTMEKVLFFSVFAMHVLAAFLIVERYILEKMKSEVDVLQREAEAL |
Ga0182028_12256723 | 3300019788 | Fen | FSGLAMCVLMAFLIAERYVQEKMRSEVDILPREAEAQ |
Ga0210388_102242023 | 3300021181 | Soil | MGGSGSGLDPTMSKVFFFSVLAMHVLAAFLIVERYVLEKMNSELDFLAREVEAQ |
Ga0210397_112832361 | 3300021403 | Soil | VFAMHILMVFLLIERYGLEKMKYDVDILQREAEAL |
Ga0210383_100833381 | 3300021407 | Soil | KVFFFNVFVMHLFVAFLIVERYILEKLRHDVDVLQREAEAQ |
Ga0210394_100904191 | 3300021420 | Soil | MNKVFFFSVFAMHVLTAFLLVERYGLEKMKYDVDVLQREAEAL |
Ga0210390_105257293 | 3300021474 | Soil | KVFLLFVVAMHVFAAFLIVERYFLEKMRNEVDVLPREAEAR |
Ga0247660_10783711 | 3300024317 | Soil | SGLEPTMKAVFFFNVLAMHLFAAFLIVERYFLEKTKHDVELLRQEAEAR |
Ga0208692_10591393 | 3300025472 | Peatland | TMDKVFLFSVLAMHVFAAFLIVERYMLEKMRSEVDILRREAEAQ |
Ga0208192_10887063 | 3300025477 | Peatland | DPTMNKVFLFSVLAMHVLAAFLIVERYMLEKMRSEVDTLRREAEAQ |
Ga0207671_104573851 | 3300025914 | Corn Rhizosphere | FSVLAMHVFAAFLIVERYLLEKTKYDVELMAREAEAR |
Ga0207693_105506161 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SKVFFFNVFVMHLFVAFLIVERYILEKLRHDVNVLQREAEAQ |
Ga0207693_110379621 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PTMSKVFFFNVFVMHLFVAFLIVERYILEKLRHDVDVLQREAEAQ |
Ga0207664_112619543 | 3300025929 | Agricultural Soil | GDANAGLEPTMKATFFFSVLAMHILMVFLIVERNRLEKLRLEVDVIRHELEVA |
Ga0207686_102068673 | 3300025934 | Miscanthus Rhizosphere | KKVFFFNVLAMHVLAAFLIAERYFLAKTKHEVELLQREAEAR |
Ga0207742_1149873 | 3300026800 | Tropical Forest Soil | FNVLVMHIFAAFLIVERYVVEKMKNDVELLQREAEAQ |
Ga0207724_10163491 | 3300026862 | Tropical Forest Soil | PTMKKVFFFNVLVMHIFCLFLIVERYVLEKLRHDVDLLQREAEVQ |
Ga0207740_10029501 | 3300027011 | Tropical Forest Soil | MNKVFFFNVLVMHIFAAFLIVERYVVEKMKNDVELLQREAEAQ |
Ga0207819_10201281 | 3300027024 | Tropical Forest Soil | FFFNVLVMHIFCLFLIVERYVLEKLRHDVDLLQREAEVQ |
Ga0207776_10280711 | 3300027035 | Tropical Forest Soil | FFFNVLVMHIFAAFLIVERYVVEKMKNDVELLQREAEAQ |
Ga0207806_10107273 | 3300027049 | Tropical Forest Soil | MGGSGSGLDPTMNKVFFFNVLVMHIFAAFLIVERYVVEKMKNDVELLQREAEAQ |
Ga0208095_10164521 | 3300027104 | Forest Soil | VFVMHLFVAFLIVERYILEKLRHDVDVLQREAEAQ |
Ga0209009_10837451 | 3300027667 | Forest Soil | SVFAMHVLTAFLLVERYGLEKMKSEVDVLQREAEAL |
Ga0207826_10888951 | 3300027680 | Tropical Forest Soil | FFNVLVMHIFAAFLIIERYVLEKMKHDVDLLQREAEAQ |
Ga0209380_100437005 | 3300027889 | Soil | MNKVFFFSVFAMHVLTVFLLVERYGLEKMKSEVDVLQREAEAL |
Ga0209048_108736703 | 3300027902 | Freshwater Lake Sediment | PAPVVMGGPGSGLDPTMSKVFFFNVLVMHIFVAFLIVERYILEKMRHDVDILQREAEAQ |
Ga0268266_100100701 | 3300028379 | Switchgrass Rhizosphere | KVFFFSVLAMHVFAAFLIVERYLLEKTKYDVELMAREAEAR |
Ga0310915_100779724 | 3300031573 | Soil | MGGSGSGLDPTMSKIFFFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0318561_102119231 | 3300031679 | Soil | VFFFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0318574_105297483 | 3300031680 | Soil | GGSGSGLDPTMNRVFFFNVFVMHLFAAFLIVERYILEKMRHDVDLLQREAEAQ |
Ga0307474_101252301 | 3300031718 | Hardwood Forest Soil | PTMNKVFFFNVLAMHVFAAFLIVERCVLERTKHEVDLLQREAEA |
Ga0306917_113744861 | 3300031719 | Soil | FNVFVMHVFVLFLIVERYVLEKLRHDVDLLQREAEAQ |
Ga0318547_101039181 | 3300031781 | Soil | LDPTMSKVFFFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0318548_105784881 | 3300031793 | Soil | FFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0310917_109868571 | 3300031833 | Soil | FFNVLVMHIFAAFLIVERYVLEKMRHDVDLLQREAEAQ |
Ga0318520_108413711 | 3300031897 | Soil | DPTMNRVFFFNVFVMHLFAAFLIVERYILEKMRHDVDLLQREAEAQ |
Ga0318520_110197641 | 3300031897 | Soil | GLDPVMKKVFFLNVLAMHLFAAFLVVERYLLEESKHDVELLQREAEAQ |
Ga0306923_105208911 | 3300031910 | Soil | PGSGLDPVMEKVFFLNVLAMHLFAAFLIVERYLLEESKYDVERLQREAEAQ |
Ga0306921_100609387 | 3300031912 | Soil | KVFFFNVLVMHVFCVFLIVERYILEKLRNDVDLLQREAEAQ |
Ga0310909_111357841 | 3300031947 | Soil | DPVMKKVFFLNVLAMHLFAAFLIVERYLLEESKYDVELLQREAEAQ |
Ga0306926_113944171 | 3300031954 | Soil | FFFNVLVMHVFAAFLIVERYVLEKMKHDVDLLQREAEAQ |
Ga0306922_115539653 | 3300032001 | Soil | VFFFNVFVMHLFVAFLIVERYILEKLRHDVDALQREAEAQ |
Ga0306924_110463272 | 3300032076 | Soil | MGGSGSGLDPTMNKVFFFNVLVMHIFAAFLIVERYVLEKMRHDVDLLQREAEAQ |
Ga0307471_1013129563 | 3300032180 | Hardwood Forest Soil | SGLDPTMSKVFFFSVLAMHVLAAFLIVERYVLEKMKSELDFLAREVEAQ |
Ga0335081_114516903 | 3300032892 | Soil | GLDPTMSKVFFFNVLAMHVFAAFLIVERYVVEKMKHEVDLLQREAEAL |
Ga0335074_101094995 | 3300032895 | Soil | MEKVLFFSVFAMHVLAAFLIIERYILEKMRNEVDVLQREVEAL |
Ga0335076_101239684 | 3300032955 | Soil | FFFNVLVMHIFCVFLIVERYILEKLRHDVDLLQREAEVQ |
Ga0335073_114736471 | 3300033134 | Soil | FSVFALHVLAAFLIIERYILEKMKNEVDLLQREAEAL |
Ga0335077_117862641 | 3300033158 | Soil | SGLDPTMSKVFFFNVLAMHVFAAFLIVERYVVEKMKHEVDLLQREAEAL |
Ga0310914_112607191 | 3300033289 | Soil | FLNVLAMHLFAAFLVVERYLLEESKHDVELLQREAEAQ |
⦗Top⦘ |