| Basic Information | |
|---|---|
| Family ID | F078961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PAEQTDLGELTWELPLEGGQAATIRHRFTVEHPAQVTVTGL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 99.14 % |
| % of genes from short scaffolds (< 2000 bps) | 85.34 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.379 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 39.13% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 12.93 |
| PF00892 | EamA | 5.17 |
| PF04672 | Methyltransf_19 | 5.17 |
| PF02311 | AraC_binding | 4.31 |
| PF07228 | SpoIIE | 3.45 |
| PF02233 | PNTB | 3.45 |
| PF03711 | OKR_DC_1_C | 3.45 |
| PF00005 | ABC_tran | 2.59 |
| PF12833 | HTH_18 | 2.59 |
| PF13466 | STAS_2 | 1.72 |
| PF14024 | DUF4240 | 1.72 |
| PF00296 | Bac_luciferase | 1.72 |
| PF08818 | DUF1801 | 1.72 |
| PF13620 | CarboxypepD_reg | 1.72 |
| PF01042 | Ribonuc_L-PSP | 1.72 |
| PF13556 | HTH_30 | 1.72 |
| PF00561 | Abhydrolase_1 | 0.86 |
| PF13193 | AMP-binding_C | 0.86 |
| PF04028 | DUF374 | 0.86 |
| PF12697 | Abhydrolase_6 | 0.86 |
| PF02012 | BNR | 0.86 |
| PF12762 | DDE_Tnp_IS1595 | 0.86 |
| PF13424 | TPR_12 | 0.86 |
| PF01053 | Cys_Met_Meta_PP | 0.86 |
| PF12849 | PBP_like_2 | 0.86 |
| PF01904 | DUF72 | 0.86 |
| PF03372 | Exo_endo_phos | 0.86 |
| PF13598 | DUF4139 | 0.86 |
| PF04264 | YceI | 0.86 |
| PF14518 | Haem_oxygenas_2 | 0.86 |
| PF03060 | NMO | 0.86 |
| PF09234 | DUF1963 | 0.86 |
| PF13336 | AcetylCoA_hyd_C | 0.86 |
| PF08281 | Sigma70_r4_2 | 0.86 |
| PF12802 | MarR_2 | 0.86 |
| PF14833 | NAD_binding_11 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 4.31 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 3.45 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.72 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.72 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.72 |
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 0.86 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.86 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.86 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.86 |
| COG3878 | Uncharacterized conserved protein YwqG, DUF1963 family | Function unknown [S] | 0.86 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.86 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.86 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.86 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.86 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.86 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.86 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.86 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.86 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10466194 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10135814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
| 3300005332|Ga0066388_107749969 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005341|Ga0070691_10787667 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005435|Ga0070714_100044116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3774 | Open in IMG/M |
| 3300005435|Ga0070714_100690496 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005436|Ga0070713_102275783 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005445|Ga0070708_100426648 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300005518|Ga0070699_100060072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3293 | Open in IMG/M |
| 3300005518|Ga0070699_100504277 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005537|Ga0070730_10854607 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005541|Ga0070733_10233216 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005542|Ga0070732_10756880 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005577|Ga0068857_100135715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2221 | Open in IMG/M |
| 3300005602|Ga0070762_10267700 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300006028|Ga0070717_10683621 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300006028|Ga0070717_10700230 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006028|Ga0070717_11624797 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006059|Ga0075017_101328433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium T81 | 565 | Open in IMG/M |
| 3300006176|Ga0070765_100734247 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006871|Ga0075434_100976829 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300009089|Ga0099828_10072647 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
| 3300009090|Ga0099827_10213386 | Not Available | 1610 | Open in IMG/M |
| 3300009093|Ga0105240_10690677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1115 | Open in IMG/M |
| 3300009143|Ga0099792_10365381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300009628|Ga0116125_1259679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 505 | Open in IMG/M |
| 3300009700|Ga0116217_10860578 | Not Available | 557 | Open in IMG/M |
| 3300009824|Ga0116219_10368507 | Not Available | 804 | Open in IMG/M |
| 3300010329|Ga0134111_10250101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300010359|Ga0126376_11572372 | Not Available | 689 | Open in IMG/M |
| 3300010396|Ga0134126_10307515 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300010398|Ga0126383_10218097 | Not Available | 1846 | Open in IMG/M |
| 3300010876|Ga0126361_10388662 | Not Available | 546 | Open in IMG/M |
| 3300010876|Ga0126361_10762975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 614 | Open in IMG/M |
| 3300011271|Ga0137393_10122149 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300012205|Ga0137362_11015647 | Not Available | 706 | Open in IMG/M |
| 3300012351|Ga0137386_10468304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300012357|Ga0137384_11539443 | Not Available | 514 | Open in IMG/M |
| 3300012359|Ga0137385_11203645 | Not Available | 619 | Open in IMG/M |
| 3300012359|Ga0137385_11336130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300012924|Ga0137413_11081667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 633 | Open in IMG/M |
| 3300012971|Ga0126369_11489637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300016319|Ga0182033_10785722 | Not Available | 838 | Open in IMG/M |
| 3300016371|Ga0182034_10036180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3138 | Open in IMG/M |
| 3300016422|Ga0182039_11404989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300017821|Ga0187812_1135659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300017932|Ga0187814_10062809 | Not Available | 1363 | Open in IMG/M |
| 3300017946|Ga0187879_10334850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300017948|Ga0187847_10599594 | Not Available | 615 | Open in IMG/M |
| 3300017959|Ga0187779_10755692 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10373677 | Not Available | 983 | Open in IMG/M |
| 3300017974|Ga0187777_11152942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Labedaea → Labedaea rhizosphaerae | 565 | Open in IMG/M |
| 3300018006|Ga0187804_10070701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1396 | Open in IMG/M |
| 3300018060|Ga0187765_10878043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300020069|Ga0197907_10540609 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300020581|Ga0210399_11103620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300020583|Ga0210401_10091950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2851 | Open in IMG/M |
| 3300021374|Ga0213881_10007994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4333 | Open in IMG/M |
| 3300021374|Ga0213881_10051093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1750 | Open in IMG/M |
| 3300021402|Ga0210385_10432346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 992 | Open in IMG/M |
| 3300021402|Ga0210385_10761904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300021407|Ga0210383_10386465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1207 | Open in IMG/M |
| 3300021433|Ga0210391_10086539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2473 | Open in IMG/M |
| 3300021474|Ga0210390_10358475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1234 | Open in IMG/M |
| 3300021478|Ga0210402_11953286 | Not Available | 513 | Open in IMG/M |
| 3300021560|Ga0126371_11448084 | Not Available | 817 | Open in IMG/M |
| 3300022467|Ga0224712_10054411 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300025910|Ga0207684_10227895 | Not Available | 1608 | Open in IMG/M |
| 3300025921|Ga0207652_11591672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300025922|Ga0207646_10133806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2232 | Open in IMG/M |
| 3300025929|Ga0207664_10481441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1110 | Open in IMG/M |
| 3300025929|Ga0207664_12017343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 500 | Open in IMG/M |
| 3300027158|Ga0208725_1032507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 818 | Open in IMG/M |
| 3300027568|Ga0208042_1150813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300027641|Ga0208827_1086421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300027748|Ga0209689_1392405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 531 | Open in IMG/M |
| 3300027765|Ga0209073_10472501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300027775|Ga0209177_10511319 | Not Available | 502 | Open in IMG/M |
| 3300027884|Ga0209275_10305916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 883 | Open in IMG/M |
| 3300027889|Ga0209380_10143506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1393 | Open in IMG/M |
| 3300027905|Ga0209415_10101149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3162 | Open in IMG/M |
| 3300028877|Ga0302235_10456240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 544 | Open in IMG/M |
| 3300030503|Ga0311370_12336476 | Not Available | 520 | Open in IMG/M |
| 3300030707|Ga0310038_10451533 | Not Available | 550 | Open in IMG/M |
| 3300030739|Ga0302311_10487150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 850 | Open in IMG/M |
| 3300030739|Ga0302311_10599912 | Not Available | 741 | Open in IMG/M |
| 3300030743|Ga0265461_13686644 | Not Available | 520 | Open in IMG/M |
| 3300031234|Ga0302325_10167301 | Not Available | 3881 | Open in IMG/M |
| 3300031671|Ga0307372_10174421 | Not Available | 1449 | Open in IMG/M |
| 3300031680|Ga0318574_10899575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300031681|Ga0318572_10038719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 2520 | Open in IMG/M |
| 3300031713|Ga0318496_10004709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea fuscirosea | 6115 | Open in IMG/M |
| 3300031744|Ga0306918_11298347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300031748|Ga0318492_10506069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 641 | Open in IMG/M |
| 3300031754|Ga0307475_10805831 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031778|Ga0318498_10180577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300031779|Ga0318566_10502028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Sciscionella → unclassified Sciscionella → Sciscionella sp. | 594 | Open in IMG/M |
| 3300031793|Ga0318548_10142126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300031795|Ga0318557_10381585 | Not Available | 648 | Open in IMG/M |
| 3300031819|Ga0318568_10853278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300031819|Ga0318568_11035188 | Not Available | 507 | Open in IMG/M |
| 3300031819|Ga0318568_11037580 | Not Available | 506 | Open in IMG/M |
| 3300031819|Ga0318568_11038252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300031832|Ga0318499_10357601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300031835|Ga0318517_10372937 | Not Available | 645 | Open in IMG/M |
| 3300032044|Ga0318558_10024976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2466 | Open in IMG/M |
| 3300032064|Ga0318510_10444298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300032066|Ga0318514_10398398 | Not Available | 730 | Open in IMG/M |
| 3300032160|Ga0311301_10923728 | Not Available | 1170 | Open in IMG/M |
| 3300032261|Ga0306920_100017247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9966 | Open in IMG/M |
| 3300032261|Ga0306920_100069835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5145 | Open in IMG/M |
| 3300032805|Ga0335078_12639530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300032895|Ga0335074_11114754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 678 | Open in IMG/M |
| 3300032898|Ga0335072_10442724 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300033290|Ga0318519_10927308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300033544|Ga0316215_1008361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1017 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_104661942 | 3300001661 | Forest Soil | RPRETTPAPEGTDDLGELTWTLILPAGESSAVRHRFTVEHPAQVTVVGL* |
| JGIcombinedJ51221_101358141 | 3300003505 | Forest Soil | GDVKVRGRETSPPPAETDDLGELTWNLVLAPRASATIRHRFVVEHPVHVTVTGL* |
| Ga0066388_1077499692 | 3300005332 | Tropical Forest Soil | PATQTDLGELTWELPLDGGQAATVRYRFTVEHPAQVTVIGL* |
| Ga0070691_107876671 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPDSTDDLGELTWTLILPPGESAAVRHRFTVEHPAQVTVVGL* |
| Ga0070714_1000441164 | 3300005435 | Agricultural Soil | TPAPDSTDDLGELTWTLILPPGESAAVRHRFTVEHPAQVTVVGL* |
| Ga0070714_1006904963 | 3300005435 | Agricultural Soil | APAEQTDLGELSWEVRLDAGKSAEVRYRFTVEHPAQVTVAGL* |
| Ga0070713_1022757832 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLDDLGEITWDLTLDGGKSALIKHRFTVEHPANVQVAGL* |
| Ga0070708_1004266481 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SPSPAEQTDLGELTWDLTLEAGQSATIRHRFTVEHPAQVSIVGL* |
| Ga0070699_1000600724 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SPNPAEQTDLGELTWELSLDGGQAATIRHRFTVEHPAQVTIAGL* |
| Ga0070699_1005042771 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NPAEQTDLGELTWELSLDGGQAATIRHRFTVEHPAQVIIAGL* |
| Ga0070730_108546071 | 3300005537 | Surface Soil | AETDDLGELTWNLTLDPGGSSTITHRFTVEHPPQVTVTGL* |
| Ga0070733_102332162 | 3300005541 | Surface Soil | DPAAQNDLGELTWELPLEGGQAATVRYRFTVEHPAQVAVTGL* |
| Ga0070732_107568801 | 3300005542 | Surface Soil | AQNDLGELTWELPLEGGQAATVRYRFTVEHPAQVAVTGL* |
| Ga0068857_1001357154 | 3300005577 | Corn Rhizosphere | GELTWELALDGGQEAAVRYRFTVEHPAQVTVTGL* |
| Ga0070762_102677003 | 3300005602 | Soil | PPAETDDLGELTWNLVLTPRESATIRHRFTVEHPAQVAVTGL* |
| Ga0070717_106836211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TDDLGELTWTLILPAGESSAIRHRFTVEHPAQVTVSGL* |
| Ga0070717_107002301 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AEQTDLGELTWELSLDGGQAATIRHRFTVEHPAQVTIAGL* |
| Ga0070717_116247972 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DLGELTWELALDGGQEAAVRYRFTVEHPAQVTVTGL* |
| Ga0075017_1013284331 | 3300006059 | Watersheds | LRETSPDPAERNDLGELTWELSLDGGQTATIHHRFTVEHPAQVTVAGL* |
| Ga0070765_1007342471 | 3300006176 | Soil | APDSSDDLGELSWTLTLPPGESSAIRHRFTVEHPAQATVTGL* |
| Ga0075434_1009768291 | 3300006871 | Populus Rhizosphere | TPAPDSTDDLGELTWTLILPPGESAAVSHRFTVEHPAQVTVVGL* |
| Ga0099828_100726471 | 3300009089 | Vadose Zone Soil | LGELTWELSLEGGQTAAIRYRFTVEHPAQVTIAGL* |
| Ga0099827_102133862 | 3300009090 | Vadose Zone Soil | WEASPSPAGHSDLGELTWDLALDGGQAATIRYRFTVEHPAQVTVAGL* |
| Ga0105240_106906773 | 3300009093 | Corn Rhizosphere | VRSRETTPAPDSTDDLGELTWTLILPPGESAAVRHRFTVEHPAQVTVVGL* |
| Ga0099792_103653811 | 3300009143 | Vadose Zone Soil | LGELTWELSLDGGQEATVRYRFSVEHPAQVTVTGI* |
| Ga0116125_12596791 | 3300009628 | Peatland | LGELTWNLALAPRESATIKHRFTVEHPAQTAVTGL* |
| Ga0116217_108605782 | 3300009700 | Peatlands Soil | DLGELSWELSLDSGQSATIRYRFTVEHPAQVTITGL* |
| Ga0116219_103685072 | 3300009824 | Peatlands Soil | SPDPAAHSDLGELTWQLELDGGQAQTIRYRFTVEHPAQVTITGL* |
| Ga0134111_102501011 | 3300010329 | Grasslands Soil | GELTWELSLDGGQEATVRYRFTVEHPAQVTVTGI* |
| Ga0126376_115723721 | 3300010359 | Tropical Forest Soil | PDPAGQDDLGELTWELSLDGGQTTKIRYRFTVEHPAQVTVTGL* |
| Ga0134126_103075151 | 3300010396 | Terrestrial Soil | EQNDLGELTWDLSLEGGQAATIRHRFTVEHPAQVTIAGL* |
| Ga0126383_102180971 | 3300010398 | Tropical Forest Soil | RLRETSPNPAEQNDLGELTWELSLDGGQAAKIRYRFTVEHPAQVTVAGL* |
| Ga0126361_103886621 | 3300010876 | Boreal Forest Soil | PAEQNDLGELIWDLSLDGGQAATIRYRFTVEHPAQVTVVGL* |
| Ga0126361_107629751 | 3300010876 | Boreal Forest Soil | EQNDLGELTWDLSLEGGQAATIRHRFTVEHPAQVTITGL* |
| Ga0137393_101221494 | 3300011271 | Vadose Zone Soil | GELTWELSLEGGHTTTIRYRFTVEHPAQVTIAGL* |
| Ga0137362_110156471 | 3300012205 | Vadose Zone Soil | EQTDLGELTWELTLEAGQSATIRHRFTVEHPAQVSIVGL* |
| Ga0137386_104683043 | 3300012351 | Vadose Zone Soil | APATQTDLGELTWELSLEGGREATIRYRFTVEHPAQVTVTGL* |
| Ga0137384_115394431 | 3300012357 | Vadose Zone Soil | VRLRETSPDPAGHDDLGELTWELSLAGGQTATIRHRFTVEHPAQVTVAGL* |
| Ga0137385_112036451 | 3300012359 | Vadose Zone Soil | LGELTWDLSLEAGQSATIRHRFTIEHSAQVAVAGL* |
| Ga0137385_113361301 | 3300012359 | Vadose Zone Soil | PAPAEQTDLGELVWELPLDAGKSATIRYRFTVEHPAQVTVTGL* |
| Ga0137413_110816671 | 3300012924 | Vadose Zone Soil | TDLGELTWELALDGGQEATVRYRFTVEHPAQVTVSGL* |
| Ga0126369_114896371 | 3300012971 | Tropical Forest Soil | PAEQTDLGELTWELSLDGGQAATLRHRFTVEHPAQVTIAGL* |
| Ga0182033_107857221 | 3300016319 | Soil | PNPASQTDLGELTWDLSLEPGQAATIRHRFTVEHPAQVTITGL |
| Ga0182034_100361801 | 3300016371 | Soil | PASQTDLGELTWDLSLEPGQAATIRHRFTVEHPAQVTITGL |
| Ga0182039_114049891 | 3300016422 | Soil | QSDLGELTWNLTLDPGRAATIRYRFTVEHPAQLTVAGL |
| Ga0187812_11356591 | 3300017821 | Freshwater Sediment | DPAGHDDLGELTWELSLEGGQAAAIRYRFTVEHPAQVTVTGL |
| Ga0187814_100628091 | 3300017932 | Freshwater Sediment | EQTDLGELTWELSLEGGQAATIRHRFTVEHPAQVTITGL |
| Ga0187879_103348501 | 3300017946 | Peatland | QSDLGELTWELKLDGGQAASVRYRFTVEHPAQVVVTGL |
| Ga0187847_105995941 | 3300017948 | Peatland | RESSPPPAETDDLGELTWNLVLAPRESAAIRHRFTVEHPAQTTVTGL |
| Ga0187779_107556922 | 3300017959 | Tropical Peatland | QDDLGELTWELSLAGGQTATVRYRFTVEHPAQVIIAGL |
| Ga0187777_103736771 | 3300017974 | Tropical Peatland | DLGELTWVLPLDSGRSAAIRFRFTVEHPAQVTVAGL |
| Ga0187777_111529421 | 3300017974 | Tropical Peatland | AEQTDLGELTWELVLDAGQTATIRHRFTVEHPAQVTVAGL |
| Ga0187804_100707011 | 3300018006 | Freshwater Sediment | SDLGELTWELPLEGGQAATVRYRFTVEHPAQVGVTGL |
| Ga0187765_108780431 | 3300018060 | Tropical Peatland | EQTDLGELIWELPLDGGQTATIRHRFTVEHPAQVTVAGL |
| Ga0197907_105406091 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | SREASPAPAGLDDLGEITWDLTLDGGKSAVIKHRFTVEHPANVQVSGL |
| Ga0210399_111036201 | 3300020581 | Soil | DLGELTWELSLDAGQEATVRYRFTVEHPAQVTVTGI |
| Ga0210401_100919504 | 3300020583 | Soil | RETTPAPASTDDLGELTWNLILPAGESSAIRHRFTVEHPAQATVAGL |
| Ga0213881_100079941 | 3300021374 | Exposed Rock | PAEQTDLGELTWELPLEGGQAATIRHRFTVEHPAQVTVTGL |
| Ga0213881_100510931 | 3300021374 | Exposed Rock | LGELTWELPLEGGQAATIRHRFTVEHPAQVTVTGL |
| Ga0210385_104323463 | 3300021402 | Soil | PTDGDVKVRGRETSPPPAETDDLGELTWNLVLAPRASATIRHRFVVEHPVHVTVTGL |
| Ga0210385_107619041 | 3300021402 | Soil | LRETSPAPAEQDDLGELTWNLTLDRGQTATVRYRFTVEHPAQLTVVGL |
| Ga0210383_103864651 | 3300021407 | Soil | DLGELTWNLVLTPRASATIRHRFTVEHPAQVTVTGL |
| Ga0210391_100865394 | 3300021433 | Soil | ETDDLGELTWNLVLTPRESATIRHRFTVEHPAQITVTGL |
| Ga0210390_103584753 | 3300021474 | Soil | ETSPPPAATVDLGELTWNLVLTPRQSATIRHRFTVEHPAQVAVTGL |
| Ga0210402_119532861 | 3300021478 | Soil | EQNDLGELTWELSLEGGQAATIRHRFTIEHPAQVTIAGL |
| Ga0126371_114480842 | 3300021560 | Tropical Forest Soil | APAEQTDLGELTWEVRLDGGKAAEVRYRFTVEHPAQVTVAGL |
| Ga0224712_100544112 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | REASPAPAGLDDLGEITWDLTLDGGKSAVIKHRFTVEHPANVQVSGL |
| Ga0207684_102278951 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEQTDLGELTWELTLEAGQSATIRHRFTVEHPAQVSITGL |
| Ga0207652_115916722 | 3300025921 | Corn Rhizosphere | DLGELSWELRLDAGKSAAVRYRFTVEHPAQVTVTGL |
| Ga0207646_101338063 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AGQTDLGELTWDLALDGGQSATIRYRFTVEHPAQVTVAGL |
| Ga0207664_104814411 | 3300025929 | Agricultural Soil | LGELTWELALDGGQEAAVRYRFTVEHPAQVTVTGL |
| Ga0207664_120173431 | 3300025929 | Agricultural Soil | LGELTWELPLDAGKAATIRYRFTVEHPAQVTVTGL |
| Ga0208725_10325071 | 3300027158 | Forest Soil | PPAETDDLGEITWNLVLTPRAAATIRHRFTVEHPAQVSVTGL |
| Ga0208042_11508131 | 3300027568 | Peatlands Soil | DDLGELTWELPLEGGQAATIRYRFTVEHPAQVTVTGL |
| Ga0208827_10864211 | 3300027641 | Peatlands Soil | PAGHDDLGELTWELPLEGGQAATIRYRFTVEHPAQVTVTGL |
| Ga0209689_13924051 | 3300027748 | Soil | LGELTWELSLDGGQEATVRYRFTVEHPAQVTVTGI |
| Ga0209073_104725012 | 3300027765 | Agricultural Soil | EQTDLGELSWELRLDAGKSAAVRYRFTVEHPAQVTVTGL |
| Ga0209177_105113192 | 3300027775 | Agricultural Soil | GDIKVRSRETTPAPDSTDDLGELTWTLILPPGESAAVRHRFTVEHPAQVTVVGL |
| Ga0209275_103059163 | 3300027884 | Soil | PPAETDDLGELTWNLVLTPRESATIRHRFTVEHPAQVAVTGL |
| Ga0209380_101435062 | 3300027889 | Soil | VRSRETSPNPVERNDLGELTWELSLEGGQAATIRHRFTVEHPAQVTVVGL |
| Ga0209415_101011495 | 3300027905 | Peatlands Soil | LGELTWDLSLDRGQAATIRYRFTVEHPAQVSVAGL |
| Ga0302235_104562402 | 3300028877 | Palsa | PPAEADDLGELTWNLVLAPRKSAVITHRFTVEHPAQVAVTGL |
| Ga0311370_123364762 | 3300030503 | Palsa | PPAQTDDLGELTWNLTLGSRESATIKHRFTVEHPAQTTVTGL |
| Ga0310038_104515332 | 3300030707 | Peatlands Soil | DLGELSWELSLDSGQSATIRYRFTVEHPAQVTITGL |
| Ga0302311_104871503 | 3300030739 | Palsa | DLGELTWNLVLTPRESATIRHRFTVEHPAQVAVTGL |
| Ga0302311_105999122 | 3300030739 | Palsa | DLGELTWNLTLGSRESATIKHRFTVEHPAQTTVTGL |
| Ga0265461_136866442 | 3300030743 | Soil | IFSLIFFFLGELTWDLVLDSGKSGTIKYRFTVEHPASVTVTGL |
| Ga0302325_101673011 | 3300031234 | Palsa | DLGELTWNLALAPRESAVIKHRFTVEHPAQAAVTGL |
| Ga0307372_101744211 | 3300031671 | Soil | VRLREASPSPAGHTDLGELTWELALPAGQSATIRHRFTVEHPAQVSVAGL |
| Ga0318574_108995753 | 3300031680 | Soil | LRETSPNPAEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318572_100387193 | 3300031681 | Soil | RETSPNPASQTDLGELTWDLSLEPGQAATIRHRFTVEHPAQVTITGL |
| Ga0318496_100047091 | 3300031713 | Soil | PNPAEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0306918_112983472 | 3300031744 | Soil | PAEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318492_105060693 | 3300031748 | Soil | RLREASPDPAGQDDLGELTWELSLDGGQTATIRYRFTVEHPAQVTVAGL |
| Ga0307475_108058312 | 3300031754 | Hardwood Forest Soil | DDLGELTWTLVLPPGESSAIFHRFTVEHPAQVTVVGL |
| Ga0318498_101805771 | 3300031778 | Soil | TSPEPASQTDMGELTWDLSLEPGQAATIRHRFTVEHPAQVTIVGL |
| Ga0318566_105020281 | 3300031779 | Soil | DLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318548_101421263 | 3300031793 | Soil | TQSDLGELTWELPLDGGQAATVRYRFTVEHPAQVTVIGL |
| Ga0318557_103815851 | 3300031795 | Soil | ASPDPASQTDLGELTWDLSLDAGQTATIRHRFTVEHPAQVTIIGL |
| Ga0318568_108532781 | 3300031819 | Soil | LREASPDPAGQDDLGELTWELSLDGGQTATIRYRFTVEHPAQVTVAGL |
| Ga0318568_110351881 | 3300031819 | Soil | LGELTWELPLDGGQAATIRHRFTVEHPAQVTVAGL |
| Ga0318568_110375801 | 3300031819 | Soil | LGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318568_110382522 | 3300031819 | Soil | QTDLGELTWELSLDGGQEAAVRYRFTVEHPAQVTVTGL |
| Ga0318499_103576012 | 3300031832 | Soil | ETSPNPAEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318517_103729371 | 3300031835 | Soil | NDLGELTWELSLESGHAATIRHRFTVEHPAQVTITGL |
| Ga0318558_100249765 | 3300032044 | Soil | TDLGELTWDLSLDAGQTATIRHRFTVEHPAQVTIVGL |
| Ga0318510_104442981 | 3300032064 | Soil | NPAEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0318514_103983981 | 3300032066 | Soil | DLGELTWELSLDGGQEATVRYRFTVEHPAQVTVTGL |
| Ga0311301_109237281 | 3300032160 | Peatlands Soil | ERNDLGELTWQLSLDGGQAATIRHRFTVEHPAQVTVAGL |
| Ga0306920_10001724712 | 3300032261 | Soil | AEHDDLGELTWVLSLDSGQASTIRHRFTVEHPAQVTIAGL |
| Ga0306920_1000698351 | 3300032261 | Soil | DLGELTWDLSLEPGQAATIRHRFTVEHPAQVTITGL |
| Ga0335078_126395301 | 3300032805 | Soil | HTDLGELRWELTLAAGQSATIRHRFTVEHPPGVTLTGL |
| Ga0335074_111147542 | 3300032895 | Soil | TTPPPDQTHDLGELIWKLALGPRASAAVTHRFTVEHPAQVTVTGL |
| Ga0335072_104427241 | 3300032898 | Soil | RETTPAPVKADDLGELTWELPLDGGKSAAIRHRFTVEHPASVSVTGL |
| Ga0318519_109273082 | 3300033290 | Soil | LGELTWELSLDGGQTATIRYRFTVEHPAQVTVAGL |
| Ga0316215_10083613 | 3300033544 | Roots | APDSSDDLGELSWTLTLPPGESSAIRHRFTVEHPAQAAVTGL |
| ⦗Top⦘ |