| Basic Information | |
|---|---|
| Family ID | F078889 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.62 % |
| % of genes near scaffold ends (potentially truncated) | 93.10 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.517 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 37.07 |
| PF13714 | PEP_mutase | 15.52 |
| PF13847 | Methyltransf_31 | 2.59 |
| PF07883 | Cupin_2 | 1.72 |
| PF11306 | DUF3108 | 1.72 |
| PF03401 | TctC | 0.86 |
| PF02627 | CMD | 0.86 |
| PF13649 | Methyltransf_25 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.86 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.86 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.52 % |
| Unclassified | root | N/A | 9.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001108|JGI12647J13326_105660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300004633|Ga0066395_10348298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300005332|Ga0066388_100611967 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300005332|Ga0066388_107919149 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005363|Ga0008090_10123232 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300005366|Ga0070659_102110024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300005367|Ga0070667_100943797 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005445|Ga0070708_101599385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium tusciae | 606 | Open in IMG/M |
| 3300005454|Ga0066687_10561993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300005471|Ga0070698_101567238 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005518|Ga0070699_101612594 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005552|Ga0066701_10388299 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005764|Ga0066903_106715259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300005764|Ga0066903_107163511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300005841|Ga0068863_102722774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300006028|Ga0070717_11010696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300006028|Ga0070717_11487521 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006196|Ga0075422_10396929 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006854|Ga0075425_100148435 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300009012|Ga0066710_104635307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300009089|Ga0099828_11381143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300009147|Ga0114129_10299112 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300010046|Ga0126384_10421235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300010047|Ga0126382_10857069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300010358|Ga0126370_11902107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300010361|Ga0126378_12616986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010362|Ga0126377_12841989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300010366|Ga0126379_10928601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300010366|Ga0126379_11219338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300010366|Ga0126379_11431646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300010371|Ga0134125_10464056 | Not Available | 1404 | Open in IMG/M |
| 3300010376|Ga0126381_103236979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300011271|Ga0137393_11356615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300012206|Ga0137380_11226983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 635 | Open in IMG/M |
| 3300012362|Ga0137361_10412966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300012944|Ga0137410_10712266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300012957|Ga0164303_10253424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300012961|Ga0164302_10418812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
| 3300012971|Ga0126369_10379842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
| 3300012989|Ga0164305_11565603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300015200|Ga0173480_10879197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300015372|Ga0132256_100408515 | Not Available | 1460 | Open in IMG/M |
| 3300015372|Ga0132256_102218138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300015373|Ga0132257_101698865 | Not Available | 809 | Open in IMG/M |
| 3300015374|Ga0132255_106321601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300015374|Ga0132255_106355334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300016294|Ga0182041_10331077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
| 3300016341|Ga0182035_11220316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300016341|Ga0182035_11963173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300016371|Ga0182034_11319691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300016445|Ga0182038_10667056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300017792|Ga0163161_10960622 | Not Available | 727 | Open in IMG/M |
| 3300018028|Ga0184608_10266388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 754 | Open in IMG/M |
| 3300018433|Ga0066667_11454373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300019887|Ga0193729_1010197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4261 | Open in IMG/M |
| 3300020579|Ga0210407_10435577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300021344|Ga0193719_10171071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300021406|Ga0210386_10211653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1645 | Open in IMG/M |
| 3300021560|Ga0126371_11509400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300021560|Ga0126371_11944405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300021560|Ga0126371_13570951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300022756|Ga0222622_10465362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300025315|Ga0207697_10090778 | Not Available | 1294 | Open in IMG/M |
| 3300025916|Ga0207663_10086250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2070 | Open in IMG/M |
| 3300025924|Ga0207694_10375494 | Not Available | 1179 | Open in IMG/M |
| 3300026310|Ga0209239_1249503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300026322|Ga0209687_1228540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300026330|Ga0209473_1228685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300026351|Ga0257170_1067428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300027671|Ga0209588_1208197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300027846|Ga0209180_10150551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
| 3300027908|Ga0209006_10468098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300028708|Ga0307295_10200126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300028712|Ga0307285_10155570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300028713|Ga0307303_10059804 | Not Available | 822 | Open in IMG/M |
| 3300028720|Ga0307317_10278815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300028720|Ga0307317_10300825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300028796|Ga0307287_10062893 | Not Available | 1376 | Open in IMG/M |
| 3300028811|Ga0307292_10098252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300028828|Ga0307312_10491805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300028881|Ga0307277_10513867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300031446|Ga0170820_11175332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031544|Ga0318534_10003541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7029 | Open in IMG/M |
| 3300031546|Ga0318538_10235102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 982 | Open in IMG/M |
| 3300031549|Ga0318571_10180432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300031564|Ga0318573_10044131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2149 | Open in IMG/M |
| 3300031681|Ga0318572_10719020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031682|Ga0318560_10073508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1730 | Open in IMG/M |
| 3300031713|Ga0318496_10602676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031763|Ga0318537_10224838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300031768|Ga0318509_10720256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031779|Ga0318566_10116029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1319 | Open in IMG/M |
| 3300031782|Ga0318552_10440437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300031782|Ga0318552_10671228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031795|Ga0318557_10182526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300031819|Ga0318568_11050319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031860|Ga0318495_10130376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1133 | Open in IMG/M |
| 3300031910|Ga0306923_10169634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2492 | Open in IMG/M |
| 3300031912|Ga0306921_10225724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2195 | Open in IMG/M |
| 3300031912|Ga0306921_11179983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300031941|Ga0310912_11005016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300031944|Ga0310884_10439233 | Not Available | 757 | Open in IMG/M |
| 3300031947|Ga0310909_10572609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 944 | Open in IMG/M |
| 3300032010|Ga0318569_10179784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300032012|Ga0310902_10605156 | Not Available | 728 | Open in IMG/M |
| 3300032013|Ga0310906_10594891 | Not Available | 761 | Open in IMG/M |
| 3300032035|Ga0310911_10261175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300032054|Ga0318570_10200246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300032063|Ga0318504_10242575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300032065|Ga0318513_10469238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300032066|Ga0318514_10075000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
| 3300032094|Ga0318540_10534479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300032180|Ga0307471_104115095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300032205|Ga0307472_100143896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1729 | Open in IMG/M |
| 3300034147|Ga0364925_0059017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1315 | Open in IMG/M |
| 3300034151|Ga0364935_0038467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1366 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12647J13326_1056601 | 3300001108 | Forest Soil | LGATPVQYQWVDCERAFIARRYDRIAGFMALFDWLFWFPPHLRDLAAER |
| Ga0066395_103482982 | 3300004633 | Tropical Forest Soil | VGGEQVTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPP |
| Ga0066388_1006119671 | 3300005332 | Tropical Forest Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRA |
| Ga0066388_1079191492 | 3300005332 | Tropical Forest Soil | VAYQWADCDSAFIAARYDRLAGLIGFIDWLFFVPPRFRAR |
| Ga0008090_101232321 | 3300005363 | Tropical Rainforest Soil | VTYQWVDCDPAFIARRYDRFAGLIGLFDLLLLLPQHLRGRAVARLNLKPGER |
| Ga0070659_1021100241 | 3300005366 | Corn Rhizosphere | VAYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVK |
| Ga0070667_1009437972 | 3300005367 | Switchgrass Rhizosphere | VTYQWADCERAFIAARYDRIAGLIGFIDWLFFVPPRFRAHAVKRLALRPGQRVLEI |
| Ga0070708_1015993851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLDLKPGN |
| Ga0066687_105619931 | 3300005454 | Soil | VACQWVDCERAFIAQRYDRLAGLIGWFDWLLFVPPHLRRHAAARL* |
| Ga0070698_1015672382 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSQWVDCERAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLDL |
| Ga0070699_1016125942 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSQWVDCERAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLDLKPG |
| Ga0066701_103882992 | 3300005552 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLDLKPGDRVL |
| Ga0066903_1067152591 | 3300005764 | Tropical Forest Soil | VAYQWADCDSAFIAARYDRLAGLIGFIDWLFFVPPR |
| Ga0066903_1071635112 | 3300005764 | Tropical Forest Soil | VSYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0068863_1027227742 | 3300005841 | Switchgrass Rhizosphere | LTHQWVDCERAFIARRYDRISGLIGLFDWVFCFPPHLRALAATR |
| Ga0070717_110106961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAYQWVDCERAFIARRYDRISGLIGLFDWVFCFPPHLRALA |
| Ga0070717_114875211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLDLKP |
| Ga0075422_103969292 | 3300006196 | Populus Rhizosphere | VSHQWADCERAFIAARYDRIAGLIGFIDWLLFVPRHFRAHAVKRLGLRPG |
| Ga0075425_1001484356 | 3300006854 | Populus Rhizosphere | VTSQWADCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRR |
| Ga0066710_1046353071 | 3300009012 | Grasslands Soil | VTSQWVDCKPAFVTERYDRIARLIGLFDWLFFFPPHLRRRATACLG |
| Ga0099828_113811431 | 3300009089 | Vadose Zone Soil | MAYQWTDCESAFIARRYDRIAGLIGFIDWLFFVPAEFRQRAAG* |
| Ga0114129_102991121 | 3300009147 | Populus Rhizosphere | VAYQWADCERAFIAARYDRIAGLIGFIDWLFFVPPHFRKQAAQRLRLRPGDRV |
| Ga0126384_104212352 | 3300010046 | Tropical Forest Soil | VGGEQVAYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRR |
| Ga0126382_108570691 | 3300010047 | Tropical Forest Soil | VTYHWEDCDRAFVAQRYDRIASLIGVFDRLFFLPPHL |
| Ga0126370_119021071 | 3300010358 | Tropical Forest Soil | VDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLNLK |
| Ga0126378_126169862 | 3300010361 | Tropical Forest Soil | VDCDRAFIAQRYDHIASLIGVFDRLFFLPPHLRRRAAA |
| Ga0126377_128419891 | 3300010362 | Tropical Forest Soil | VAYQWADCDSAFIAARYDRLAGLIGFIDWLFFVPPRF |
| Ga0126379_109286012 | 3300010366 | Tropical Forest Soil | VGGEQVTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHL |
| Ga0126379_112193382 | 3300010366 | Tropical Forest Soil | VTYQWADCERAFIARRYDRIAGLIGLFDWLFFFPPHLRGLAARRLNAKPGDRVL |
| Ga0126379_114316461 | 3300010366 | Tropical Forest Soil | VTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPH |
| Ga0134125_104640562 | 3300010371 | Terrestrial Soil | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAV |
| Ga0126381_1032369791 | 3300010376 | Tropical Forest Soil | VDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARL |
| Ga0137393_113566151 | 3300011271 | Vadose Zone Soil | VDCERAFIAQRYDRIAGLINLFDWVFFFPPQLRGLAA |
| Ga0137380_112269832 | 3300012206 | Vadose Zone Soil | VPYQWTDCERTFIAQRYDRIAGLIGFIDWLFFVPAEFRQRAA |
| Ga0137361_104129662 | 3300012362 | Vadose Zone Soil | VGGEQLTYQWEDCERAFIAQRYDRIAGLIGVFDRLFFLPPHLRKRAAARLNLK |
| Ga0137410_107122662 | 3300012944 | Vadose Zone Soil | VSHQWTDCESTFIAARYDRIAGMIGFIDWLLFVPRHFRAHAAKRLALRPGQRVL |
| Ga0164303_102534241 | 3300012957 | Soil | VDCERAFIARRYDRIAGFMALFDWLFWFPPHLRDLAAD |
| Ga0164302_104188122 | 3300012961 | Soil | VDCERAFIARRYDRIAGFMALFDWLFWFPPHLRDLAA* |
| Ga0126369_103798422 | 3300012971 | Tropical Forest Soil | VTYQWVDCDPAFIARRYDRFAGLIGLFDLLLFLPQHLRGRAVARLNLKPG |
| Ga0164305_115656032 | 3300012989 | Soil | VQYQWVDCERAFIARRYDRIAGFMALFDWLFWFPPHLRD |
| Ga0173480_108791971 | 3300015200 | Soil | VTYQWADCERAFIAARYDRIAGLIGFIDWLFFVPPRFR |
| Ga0132256_1004085151 | 3300015372 | Arabidopsis Rhizosphere | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVK |
| Ga0132256_1022181381 | 3300015372 | Arabidopsis Rhizosphere | VTSLWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAA |
| Ga0132257_1016988651 | 3300015373 | Arabidopsis Rhizosphere | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHF |
| Ga0132255_1063216012 | 3300015374 | Arabidopsis Rhizosphere | MTCEWVDCDRDFVGRRYDRIASLIVLFEWLLFVPPALRRT |
| Ga0132255_1063553342 | 3300015374 | Arabidopsis Rhizosphere | MPQGATVTYQWADCERAFIAARYDRIAGLIGFIDWLF |
| Ga0182041_103310773 | 3300016294 | Soil | VTSQWADCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0182035_112203162 | 3300016341 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLNLKPGNRVLEI |
| Ga0182035_119631732 | 3300016341 | Soil | VTSQWADCDRAFIAQRYDRIAGLIGVFDRLFFLPP |
| Ga0182034_113196911 | 3300016371 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLNLKPGN |
| Ga0182038_106670563 | 3300016445 | Soil | VGYHWVDCERAFIARRYDRIAGLITLFDWVFFFPPHLRELAARRLAVKPG |
| Ga0163161_109606221 | 3300017792 | Switchgrass Rhizosphere | VSYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKR |
| Ga0184608_102663882 | 3300018028 | Groundwater Sediment | VAYQWVDCERSEIARRYDRIAGLIGFIDWLFFVPPHF |
| Ga0066667_114543731 | 3300018433 | Grasslands Soil | VTSQWVDCERAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0193729_10101974 | 3300019887 | Soil | VSHQWADCESTFIAARYDRIAGMIGFIDWLLFVPRHFRAH |
| Ga0210407_104355772 | 3300020579 | Soil | VDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAAR |
| Ga0193719_101710711 | 3300021344 | Soil | VSHQWTDCESTFIAARYDRIAGMIGFIDWLLFVPRHFRAHAAKRLALRPGQR |
| Ga0210386_102116531 | 3300021406 | Soil | VQYQWVDCERAFIARRYDRLAGFMALFDWLFWFPPHLRDLAA |
| Ga0126371_115094001 | 3300021560 | Tropical Forest Soil | VTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARL |
| Ga0126371_119444051 | 3300021560 | Tropical Forest Soil | VTQQWVDCERAFIAQRYDRIANLIGLFDWLLFVPPHLRQRAAARLA |
| Ga0126371_135709512 | 3300021560 | Tropical Forest Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0222622_104653621 | 3300022756 | Groundwater Sediment | VSYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFR |
| Ga0207697_100907782 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGLRPGQ |
| Ga0207663_100862501 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VQYQWVDCERAFIARRYDRIAGFMALFDWLFWFPPHLRDLAAERLAVRPG |
| Ga0207694_103754941 | 3300025924 | Corn Rhizosphere | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAH |
| Ga0209239_12495031 | 3300026310 | Grasslands Soil | VTSQWVDCERAFIAQRYDRIAGLIGVFDRLFFLPPHLRR |
| Ga0209687_12285402 | 3300026322 | Soil | VTYQWVDCEPAFIAQRYDRIAGLIGLFDRLLFLPPQLRRRAAAG |
| Ga0209473_12286851 | 3300026330 | Soil | VACQWVDCERAFIAQRYDRLAGLIGLFDWLLLFPSH |
| Ga0257170_10674281 | 3300026351 | Soil | VTYQWVDCERAFIADRYDRIAGLIGLFDRLLFLPPDLRRRAAACLNL |
| Ga0209588_12081972 | 3300027671 | Vadose Zone Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRGAARLNLKPGNRVLEI |
| Ga0209180_101505511 | 3300027846 | Vadose Zone Soil | VTYQWVDCERAFIAQRYDRIANLIGLFDWLLFVPPHLRRRAAARLQ |
| Ga0209006_104680982 | 3300027908 | Forest Soil | VQHQWVDCERAFIARRYDRIAGFMALFDWLFWFPPHLRDLAAE |
| Ga0307295_102001261 | 3300028708 | Soil | VSHQWADCESTFIAARYDRIAGMIGFIDWLFFVPRHFR |
| Ga0307285_101555701 | 3300028712 | Soil | VSHQWADCDRTFIAARYDRIAGMIGFIDWLFFVPRHFRAHAARRLALR |
| Ga0307303_100598041 | 3300028713 | Soil | VSYQWADCERAFIAARYDRIAGLIGFIDWLLFVPRHFRAHAV |
| Ga0307317_102788151 | 3300028720 | Soil | VSYQWADCERAFIAARYDRIAGLIGFIDWLLFVPRHFR |
| Ga0307317_103008251 | 3300028720 | Soil | VLYQWADCERAFIAARYDRIAGLIGFIDWLLFVPRHFRAHA |
| Ga0307287_100628931 | 3300028796 | Soil | VLYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGLRPGQRVLEIG |
| Ga0307292_100982522 | 3300028811 | Soil | VSHQWADCESTFIAARYDRIAGMIGFIDWLLFVPRHFR |
| Ga0307312_104918051 | 3300028828 | Soil | VSHQWADCDRTFIAARYDRIAGMIGFIDWLFFVPRHFRAHAAKRLALRPGQRVLEIG |
| Ga0307277_105138672 | 3300028881 | Soil | VAYQWADCERAFIAARYDRIAGLIGFIDWLFFVPPQFRTRAAQRL |
| Ga0170820_111753322 | 3300031446 | Forest Soil | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGLRPGQRVL |
| Ga0318534_100035417 | 3300031544 | Soil | VGGEQVTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0318538_102351021 | 3300031546 | Soil | VTYQWEDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLR |
| Ga0318571_101804322 | 3300031549 | Soil | VAYQWVDCERALVARRYDRLAGLISLSDWLLFVPRHLRRRAAARLE |
| Ga0318573_100441311 | 3300031564 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFVPPHLRRRAAARLNLKPGNRVLEIG |
| Ga0318572_107190202 | 3300031681 | Soil | VLHEWVDYDPAFIAQRYDRIAGLIGLFDWVFFFPPHLRNLAAERLALEPGARV |
| Ga0318560_100735083 | 3300031682 | Soil | VDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRDARPLG |
| Ga0318496_106026761 | 3300031713 | Soil | VTYQWVDCDPAFIARRYDRFAGLIGLFDRLLFLPPHLRARAVARLNLK |
| Ga0318537_102248381 | 3300031763 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRD |
| Ga0318509_107202561 | 3300031768 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRR |
| Ga0318566_101160291 | 3300031779 | Soil | VGGEQVTYQWEDCDRAFIAQRYDRIASLIGVFDRLFFLPPHLRR |
| Ga0318552_104404371 | 3300031782 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFVPPHLRRRAAARLNLKPGNRVLEI |
| Ga0318552_106712282 | 3300031782 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPH |
| Ga0318557_101825261 | 3300031795 | Soil | VGGEQVTYQWEDCDRAFIAQRYDRIAGLIGVFDRL |
| Ga0318568_110503191 | 3300031819 | Soil | VLHEWVDYDPAVIAQRYDRIAGLIGLFDWVFFFPPHLRNLAAERLA |
| Ga0318495_101303762 | 3300031860 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRDARPLG |
| Ga0306923_101696345 | 3300031910 | Soil | RAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRDARPLG |
| Ga0306921_102257241 | 3300031912 | Soil | VLHEWVDYDPAVIAQRYDRIAGLIGLFDWVFFFPPHLRNLAAERLALEPG |
| Ga0306921_111799832 | 3300031912 | Soil | VSYHWVDCERAFIARRYDRMAGLIGLFDWLFFFPPHLRRRAA |
| Ga0310912_110050162 | 3300031941 | Soil | VTYQWEDCDRAFIAQRYDRIASLIGVFDRLFFLPPHLRRR |
| Ga0310884_104392332 | 3300031944 | Soil | VSYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRL |
| Ga0310909_105726091 | 3300031947 | Soil | VTYQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRDARPLG |
| Ga0318569_101797842 | 3300032010 | Soil | VGGEQVTYQWEDCDRAFIAQRYDRIAGLIGVFDRLLFLPPHLR |
| Ga0310902_106051562 | 3300032012 | Soil | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGL |
| Ga0310906_105948911 | 3300032013 | Soil | VSHQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGLRPGQR |
| Ga0310911_102611752 | 3300032035 | Soil | VTSQWVDCDRAFIAQRYDRIASLIGVFDRVFFLPPHLRRRAAARLNLKPGNRVLEIG |
| Ga0318570_102002462 | 3300032054 | Soil | VTYQWEDCDRAFIAQRYDRIASLIGVFDRLFFLPPHLRG |
| Ga0318504_102425752 | 3300032063 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLNLKPGNRMLEI |
| Ga0318513_104692381 | 3300032065 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFVPPHLRRRAAARLNLKPGNRVL |
| Ga0318514_100750002 | 3300032066 | Soil | VTSQWVDCDRAFIAQRYDHIAGLIGVFDRLFFLPPHLRRRDARPLG |
| Ga0318540_105344791 | 3300032094 | Soil | VTSQWVDCDRAFIAQRYDRIAGLIGVFDRLFFLPPHLRRRAAARLNLK |
| Ga0307471_1041150951 | 3300032180 | Hardwood Forest Soil | MSCQWADCDRNFIRQRYDRLAGLIGFFERLLFMPPMLREIAAHRLNLGRG |
| Ga0307472_1001438961 | 3300032205 | Hardwood Forest Soil | VAGAKNVTYQWVDCERAFIAQRYDRIANLIGLFDRLLFLPPGLRRRAAARLNLKQGDRV |
| Ga0364925_0059017_1_159 | 3300034147 | Sediment | VDYRWVDCERAFIARRYDRIAGLITLFDWVFFLPPHLRRLASERLAVRQGARV |
| Ga0364935_0038467_1198_1365 | 3300034151 | Sediment | VSYQWADCERAFIAARYDRIAGLIGFIDWLFFVPRHFRAHAVKRLGLRPGQRVLEI |
| ⦗Top⦘ |