| Basic Information | |
|---|---|
| Family ID | F078798 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.39 % |
| % of genes near scaffold ends (potentially truncated) | 29.31 % |
| % of genes from short scaffolds (< 2000 bps) | 81.03 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.724 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.621 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.172 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00389 | 2-Hacid_dh | 19.83 |
| PF02826 | 2-Hacid_dh_C | 16.38 |
| PF00561 | Abhydrolase_1 | 12.07 |
| PF12697 | Abhydrolase_6 | 10.34 |
| PF08386 | Abhydrolase_4 | 9.48 |
| PF13432 | TPR_16 | 4.31 |
| PF01494 | FAD_binding_3 | 1.72 |
| PF13279 | 4HBT_2 | 1.72 |
| PF13428 | TPR_14 | 1.72 |
| PF05170 | AsmA | 0.86 |
| PF09084 | NMT1 | 0.86 |
| PF12688 | TPR_5 | 0.86 |
| PF02913 | FAD-oxidase_C | 0.86 |
| PF12146 | Hydrolase_4 | 0.86 |
| PF07298 | NnrU | 0.86 |
| PF00355 | Rieske | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.45 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.72 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.72 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.72 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.86 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.86 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.72 % |
| Unclassified | root | N/A | 23.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9276533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
| 2199352025|deepsgr__Contig_169595 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 2228664021|ICCgaii200_c0842509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c002928 | Not Available | 1483 | Open in IMG/M |
| 3300000156|NODE_c0718922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5618 | Open in IMG/M |
| 3300000550|F24TB_10458754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1038 | Open in IMG/M |
| 3300000559|F14TC_102100117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1064 | Open in IMG/M |
| 3300003911|JGI25405J52794_10031317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300004024|Ga0055436_10000894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4769 | Open in IMG/M |
| 3300004058|Ga0055498_10090273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. WL0053 | 606 | Open in IMG/M |
| 3300004479|Ga0062595_101314412 | Not Available | 652 | Open in IMG/M |
| 3300004479|Ga0062595_102649887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 504 | Open in IMG/M |
| 3300005147|Ga0066821_1018145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300005204|Ga0068997_10073979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005205|Ga0068999_10004533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1596 | Open in IMG/M |
| 3300005213|Ga0068998_10177979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 521 | Open in IMG/M |
| 3300005294|Ga0065705_10106434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 6639 | Open in IMG/M |
| 3300005295|Ga0065707_10011049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2470 | Open in IMG/M |
| 3300005332|Ga0066388_100002265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11614 | Open in IMG/M |
| 3300005332|Ga0066388_100026309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5310 | Open in IMG/M |
| 3300005332|Ga0066388_100113593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3211 | Open in IMG/M |
| 3300005332|Ga0066388_100286270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2291 | Open in IMG/M |
| 3300005332|Ga0066388_101144305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1323 | Open in IMG/M |
| 3300005332|Ga0066388_101192164 | Not Available | 1300 | Open in IMG/M |
| 3300005332|Ga0066388_101580728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1152 | Open in IMG/M |
| 3300005332|Ga0066388_103263353 | Not Available | 829 | Open in IMG/M |
| 3300005332|Ga0066388_103966627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 755 | Open in IMG/M |
| 3300005332|Ga0066388_104435593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 715 | Open in IMG/M |
| 3300005444|Ga0070694_100900842 | Not Available | 730 | Open in IMG/M |
| 3300005445|Ga0070708_101674906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 591 | Open in IMG/M |
| 3300005713|Ga0066905_100038242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2814 | Open in IMG/M |
| 3300005713|Ga0066905_100043929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2676 | Open in IMG/M |
| 3300005713|Ga0066905_100135057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1749 | Open in IMG/M |
| 3300005713|Ga0066905_100397030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1117 | Open in IMG/M |
| 3300005713|Ga0066905_101257418 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005713|Ga0066905_101458351 | Not Available | 621 | Open in IMG/M |
| 3300005713|Ga0066905_101864331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300005937|Ga0081455_10363349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
| 3300006049|Ga0075417_10000028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 28772 | Open in IMG/M |
| 3300006050|Ga0075028_100325209 | Not Available | 863 | Open in IMG/M |
| 3300006057|Ga0075026_100201847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300006354|Ga0075021_10306029 | Not Available | 986 | Open in IMG/M |
| 3300006845|Ga0075421_101344844 | Not Available | 789 | Open in IMG/M |
| 3300006852|Ga0075433_11107170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300006854|Ga0075425_100011786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 9364 | Open in IMG/M |
| 3300006954|Ga0079219_10759610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300009012|Ga0066710_101292519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
| 3300009094|Ga0111539_10000299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 60010 | Open in IMG/M |
| 3300010047|Ga0126382_10141892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1630 | Open in IMG/M |
| 3300010047|Ga0126382_12476904 | Not Available | 505 | Open in IMG/M |
| 3300010358|Ga0126370_10662013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
| 3300010359|Ga0126376_11132818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 793 | Open in IMG/M |
| 3300010359|Ga0126376_12625403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 552 | Open in IMG/M |
| 3300010362|Ga0126377_10380028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1417 | Open in IMG/M |
| 3300010362|Ga0126377_12474367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 595 | Open in IMG/M |
| 3300010366|Ga0126379_11532739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 772 | Open in IMG/M |
| 3300010376|Ga0126381_100520522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76 | 1681 | Open in IMG/M |
| 3300010376|Ga0126381_104739012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 523 | Open in IMG/M |
| 3300010400|Ga0134122_10047667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3281 | Open in IMG/M |
| 3300012208|Ga0137376_10314070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1360 | Open in IMG/M |
| 3300012488|Ga0157343_1009846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 713 | Open in IMG/M |
| 3300012490|Ga0157322_1015005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 685 | Open in IMG/M |
| 3300012500|Ga0157314_1049881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 532 | Open in IMG/M |
| 3300012948|Ga0126375_10089849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1786 | Open in IMG/M |
| 3300012948|Ga0126375_10461753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300012957|Ga0164303_10047080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1888 | Open in IMG/M |
| 3300012971|Ga0126369_11167024 | Not Available | 860 | Open in IMG/M |
| 3300012971|Ga0126369_11611683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300014308|Ga0075354_1029998 | Not Available | 919 | Open in IMG/M |
| 3300014745|Ga0157377_10078009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1930 | Open in IMG/M |
| 3300015371|Ga0132258_11954302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1476 | Open in IMG/M |
| 3300015371|Ga0132258_13118705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1145 | Open in IMG/M |
| 3300015374|Ga0132255_102750802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300017939|Ga0187775_10304388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300017939|Ga0187775_10477482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 529 | Open in IMG/M |
| 3300017944|Ga0187786_10017429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1858 | Open in IMG/M |
| 3300017944|Ga0187786_10106428 | Not Available | 953 | Open in IMG/M |
| 3300017947|Ga0187785_10108331 | Not Available | 1121 | Open in IMG/M |
| 3300017961|Ga0187778_10193133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300018028|Ga0184608_10038660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1832 | Open in IMG/M |
| 3300018029|Ga0187787_10211155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 691 | Open in IMG/M |
| 3300018032|Ga0187788_10543913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 507 | Open in IMG/M |
| 3300018058|Ga0187766_10193350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300018060|Ga0187765_10005672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5333 | Open in IMG/M |
| 3300018064|Ga0187773_10981408 | Not Available | 552 | Open in IMG/M |
| 3300018064|Ga0187773_11159313 | Not Available | 517 | Open in IMG/M |
| 3300018066|Ga0184617_1020795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
| 3300018067|Ga0184611_1175241 | Not Available | 762 | Open in IMG/M |
| 3300019867|Ga0193704_1055599 | Not Available | 767 | Open in IMG/M |
| 3300021560|Ga0126371_10858734 | Not Available | 1052 | Open in IMG/M |
| 3300021560|Ga0126371_11427828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300021560|Ga0126371_12968990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 574 | Open in IMG/M |
| 3300022756|Ga0222622_11357749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 523 | Open in IMG/M |
| 3300024232|Ga0247664_1173369 | Not Available | 510 | Open in IMG/M |
| 3300025315|Ga0207697_10175318 | Not Available | 938 | Open in IMG/M |
| 3300025914|Ga0207671_10315338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300025923|Ga0207681_10605362 | Not Available | 906 | Open in IMG/M |
| 3300025936|Ga0207670_10273308 | Not Available | 1314 | Open in IMG/M |
| 3300027894|Ga0209068_10211126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1070 | Open in IMG/M |
| 3300028715|Ga0307313_10184537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 646 | Open in IMG/M |
| 3300028720|Ga0307317_10275094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300028876|Ga0307286_10237253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 666 | Open in IMG/M |
| 3300028884|Ga0307308_10012229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3836 | Open in IMG/M |
| 3300031199|Ga0307495_10003864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1799 | Open in IMG/M |
| 3300031231|Ga0170824_118142154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3454 | Open in IMG/M |
| 3300031720|Ga0307469_10317559 | Not Available | 1292 | Open in IMG/M |
| 3300031720|Ga0307469_11725397 | Not Available | 604 | Open in IMG/M |
| 3300031820|Ga0307473_10013867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3050 | Open in IMG/M |
| 3300032003|Ga0310897_10010076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2781 | Open in IMG/M |
| 3300032174|Ga0307470_10110794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1597 | Open in IMG/M |
| 3300032782|Ga0335082_10583990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 979 | Open in IMG/M |
| 3300033412|Ga0310810_10092790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3612 | Open in IMG/M |
| 3300033433|Ga0326726_10239171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
| 3300033513|Ga0316628_100519305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1540 | Open in IMG/M |
| 3300033513|Ga0316628_102621997 | Not Available | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_01154870 | 2088090015 | Soil | MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVR |
| deepsgr_02851780 | 2199352025 | Soil | MLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQAIWYVYS |
| ICCgaii200_08425093 | 2228664021 | Soil | MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS |
| ARSoilOldRDRAFT_0029283 | 3300000044 | Arabidopsis Rhizosphere | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT* |
| NODE_07189226 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQPEAVWYINI* |
| F24TB_104587541 | 3300000550 | Soil | LGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| F14TC_1021001172 | 3300000559 | Soil | TVARGTYVVVLAAMIVAWVFSLNKEAPADPQGSQVIWYLHS* |
| JGI25405J52794_100313172 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLGRVARGTYVFVLAAMIVAWVFSLNREAPAEPQANQVIWYLHS* |
| Ga0055436_100008943 | 3300004024 | Natural And Restored Wetlands | MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEAQPDQQIWYIYS* |
| Ga0055498_100902731 | 3300004058 | Natural And Restored Wetlands | MLGTVARGTYVLVLTAMIVAWVVSLGKVAPADTQPDQVWYIHI* |
| Ga0062595_1013144121 | 3300004479 | Soil | MLRTVARGTYVLVLTAMVVAWVVSLGKDAPAGAQPSEQQTWYLHS* |
| Ga0062595_1026498871 | 3300004479 | Soil | MLGRVARGTYVLVLTAMIVAWVFSLNKEAPAEPQAEQVIW |
| Ga0066821_10181451 | 3300005147 | Soil | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINI* |
| Ga0068997_100739792 | 3300005204 | Natural And Restored Wetlands | MLGKVARGTYVLVLATMIVAWVISFNREVPADPQPGQEFSRAYS* |
| Ga0068999_100045332 | 3300005205 | Natural And Restored Wetlands | MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEVQPDQQIWYIYS* |
| Ga0068998_101779792 | 3300005213 | Natural And Restored Wetlands | MFGTVARGTCVLVLTAIIVAWAVSLGKEAPAEGQPDQQIWDIYS* |
| Ga0065705_101064342 | 3300005294 | Switchgrass Rhizosphere | MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQVIWYIYS* |
| Ga0065707_100110492 | 3300005295 | Switchgrass Rhizosphere | MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQXIWYIYS* |
| Ga0066388_1000022654 | 3300005332 | Tropical Forest Soil | MLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC* |
| Ga0066388_1000263092 | 3300005332 | Tropical Forest Soil | MIGMVARGTYVLVLTAMIVTWVFSFNKEIPVAPQSDQVIWYIHT* |
| Ga0066388_1001135933 | 3300005332 | Tropical Forest Soil | MLGMVARGTYVFVLTAMVVAWIFSLNKEVPAEAQADQVIWYIHI* |
| Ga0066388_1002862701 | 3300005332 | Tropical Forest Soil | MLGTVARRTYVVVLATMIVAWVVSFNKEAPAETQPSDAIWYINT* |
| Ga0066388_1011443052 | 3300005332 | Tropical Forest Soil | MLGTVARGTYMVVLATMIVAWVLSLNKEAPADTQPIWYIYS* |
| Ga0066388_1011921642 | 3300005332 | Tropical Forest Soil | MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQSSQEVWYINI* |
| Ga0066388_1015807282 | 3300005332 | Tropical Forest Soil | MLGMVARGTYVFVLTAMVVAWVYSLNKEVPAEPQSDQVIWYIHI* |
| Ga0066388_1032633531 | 3300005332 | Tropical Forest Soil | MLGMMARGTYVLALTAMIVAWVFSLNKEVPAEPQSDQVIWYIHI* |
| Ga0066388_1039666272 | 3300005332 | Tropical Forest Soil | MLGMVARGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT* |
| Ga0066388_1044355932 | 3300005332 | Tropical Forest Soil | ARGTYMLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| Ga0070694_1009008422 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYIN |
| Ga0070708_1016749061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YGGGGMLGTVARGTYVLVLTAMIVAWVFSLNREAPAEPQAGQQTWYIHS* |
| Ga0066905_1000382423 | 3300005713 | Tropical Forest Soil | MLGTVARGTYMLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| Ga0066905_1000439292 | 3300005713 | Tropical Forest Soil | MLGTVARGTYVLVLATMIVAWVFSLNKEAPAEPQSDQVIWYIHS* |
| Ga0066905_1001350572 | 3300005713 | Tropical Forest Soil | MLGRVARGTYVLVLAAMIVAWVFSLNKDAPAEPQANQVTWYIHS* |
| Ga0066905_1003970302 | 3300005713 | Tropical Forest Soil | MLGRVARGTYVLVLTAMIVAWVFSLNKEVPAEPQANQVIWYLHS* |
| Ga0066905_1012574182 | 3300005713 | Tropical Forest Soil | MLGMVARGTYVFVLTAMVVAWVFSLNKEVPAEAQSDQVIWYIHI* |
| Ga0066905_1014583512 | 3300005713 | Tropical Forest Soil | MLGRVARGTYVVVLAAMIVAWVFSLNKDAPAEPQANQV |
| Ga0066905_1018643312 | 3300005713 | Tropical Forest Soil | MLGRVARGTYVLVLTAMIVAWVFSFNKEAPSEPETNQMIWYIHS* |
| Ga0081455_103633492 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLGTVARGTYVLVLATMIVAWVFSLNKEAPAELQSDQVIWYIHS* |
| Ga0075417_1000002811 | 3300006049 | Populus Rhizosphere | MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| Ga0075028_1003252092 | 3300006050 | Watersheds | MEAQVMFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA* |
| Ga0075026_1002018471 | 3300006057 | Watersheds | KNLEATMLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPSQPTWYMYS* |
| Ga0075021_103060292 | 3300006354 | Watersheds | MFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA* |
| Ga0075421_1013448441 | 3300006845 | Populus Rhizosphere | MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKP |
| Ga0075433_111071702 | 3300006852 | Populus Rhizosphere | MLGTVARGTYVLVLAAMIVAWVFSLNKAPGEPQSNQAIWYIHS* |
| Ga0075425_1000117865 | 3300006854 | Populus Rhizosphere | MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQAIWYIYS* |
| Ga0079219_107596102 | 3300006954 | Agricultural Soil | MLGKLARGTYVFVVTAMIVAWVFSLGKEGPAEPQPTQEISYAWA* |
| Ga0066710_1012925192 | 3300009012 | Grasslands Soil | MIGTVARGTYVVVLAALIVAWVVSFNKEAPAEPQAEPQVWYIYS |
| Ga0111539_1000029951 | 3300009094 | Populus Rhizosphere | MARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| Ga0126382_101418922 | 3300010047 | Tropical Forest Soil | MLGMVARGTYVLVLTAMIVTWVFSFNKEIPVAPQSDQVIWYIHT* |
| Ga0126382_124769042 | 3300010047 | Tropical Forest Soil | MLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS* |
| Ga0126370_106620132 | 3300010358 | Tropical Forest Soil | GTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC* |
| Ga0126376_111328181 | 3300010359 | Tropical Forest Soil | MLGMVAQGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT* |
| Ga0126376_126254031 | 3300010359 | Tropical Forest Soil | MLGTVARGTYVVVLATMIVAWVLSLNKEAPADTQPEAVWYINI* |
| Ga0126377_103800282 | 3300010362 | Tropical Forest Soil | MLGRVARGTYVLVITAMIVAWVFSLNKEAPAEPQANQVIWYLHS* |
| Ga0126377_124743672 | 3300010362 | Tropical Forest Soil | RGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT* |
| Ga0126379_115327392 | 3300010366 | Tropical Forest Soil | MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVIYYVYA* |
| Ga0126381_1005205221 | 3300010376 | Tropical Forest Soil | RRMLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC* |
| Ga0126381_1047390121 | 3300010376 | Tropical Forest Soil | MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVTYYVFA* |
| Ga0134122_100476674 | 3300010400 | Terrestrial Soil | MLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPSQPTWYMYS* |
| Ga0137376_103140702 | 3300012208 | Vadose Zone Soil | MEAAMLGLVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS* |
| Ga0157343_10098461 | 3300012488 | Arabidopsis Rhizosphere | GTYVVVLATMIVAWVVSFNKEAPADTQPSDAIGYINI* |
| Ga0157322_10150051 | 3300012490 | Arabidopsis Rhizosphere | TEATAMLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT* |
| Ga0157314_10498811 | 3300012500 | Arabidopsis Rhizosphere | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWY |
| Ga0126375_100898492 | 3300012948 | Tropical Forest Soil | MIGMVARGTYVLVLTAMIVTWVSSFNKEIPVAPQSDQVIWYIHT* |
| Ga0126375_104617532 | 3300012948 | Tropical Forest Soil | MLGTVARGTYVLVLATMIAAWVFSLNKEAPAEPQSDQVIWYIHS* |
| Ga0164303_100470801 | 3300012957 | Soil | YMVFLATMIVAWVLSFNKEAPADTQPSQVIWYIYS* |
| Ga0164301_100860622 | 3300012960 | Soil | VLVLTAMIAAWVVSLNKEAPTEPEASPQTWYIHS* |
| Ga0126369_111670242 | 3300012971 | Tropical Forest Soil | MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQSTQEAIYYVFA* |
| Ga0126369_116116831 | 3300012971 | Tropical Forest Soil | KMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVTYYVFA* |
| Ga0075354_10299981 | 3300014308 | Natural And Restored Wetlands | MLGTVARGTYVLVLTAMIVAWVVSLGKVAPADTQP |
| Ga0157377_100780092 | 3300014745 | Miscanthus Rhizosphere | MLGTLARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT* |
| Ga0132258_119543021 | 3300015371 | Arabidopsis Rhizosphere | KNTEATAMLGTVARGTYMVVLATMIVAWVLSFNKEAPADTQPSQAIWYIYS* |
| Ga0132258_131187051 | 3300015371 | Arabidopsis Rhizosphere | MLGKLARGTYVVVVTAMIIAWVFSLGTEVPAEPQPTQEISYAYA* |
| Ga0132255_1027508022 | 3300015374 | Arabidopsis Rhizosphere | MLGKLARGTYVLVVTAMIVAWVFSLGKEVPAEPQPTQEISYAYA* |
| Ga0187775_103043881 | 3300017939 | Tropical Peatland | MLGTVARGTYVLLLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS |
| Ga0187775_104774822 | 3300017939 | Tropical Peatland | MLSKLARGAYVLVVTAMIVAWVFSFGKQIPAEPQPSQEITYAYA |
| Ga0187786_100174292 | 3300017944 | Tropical Peatland | MLGTVARGTYVFVLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS |
| Ga0187786_101064281 | 3300017944 | Tropical Peatland | MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQPEAVWYINI |
| Ga0187785_101083311 | 3300017947 | Tropical Peatland | MLGTIARGTYVVVLATMIVAWVVSFNKEAPAETQP |
| Ga0187778_101931332 | 3300017961 | Tropical Peatland | MLGKAARGTYVLVVTAMIVAWVLSFGKEVPAEPQPTQEISYIYC |
| Ga0184608_100386602 | 3300018028 | Groundwater Sediment | MLGTVARGTYVVVLTAMIVAWVFSLNREVPTESQPSQGIWYIHI |
| Ga0187787_102111551 | 3300018029 | Tropical Peatland | MLGTVARGTYVLVLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS |
| Ga0187788_105439131 | 3300018032 | Tropical Peatland | TYVLVLTAMVVAWVVSLGKEVPSDPQSSQQVYYLHS |
| Ga0187766_101933501 | 3300018058 | Tropical Peatland | RNATLGKFARASYVLVVTAMIVAWVVSLGKEVPAEAQPTQEITYANA |
| Ga0187765_100056724 | 3300018060 | Tropical Peatland | MLGTIARGTYVVVLATMIVAWVVSFNKEAPAETQPDAIWYINI |
| Ga0187773_109814081 | 3300018064 | Tropical Peatland | MLGTVARGTYVLVLTAMIVAWVVSLGKEAPTEAQPSQQTWYIYS |
| Ga0187773_111593132 | 3300018064 | Tropical Peatland | MLGTVARGTYVLVLTAMIVAWVVSLGKEAPAEAQPDQQIWYIHS |
| Ga0184617_10207952 | 3300018066 | Groundwater Sediment | MEAAMLGLMARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS |
| Ga0184611_11752412 | 3300018067 | Groundwater Sediment | MLGAVARSTYVLVLGAMIVAWVFSLNRDTTPAGSQPSQVTWSIYA |
| Ga0193704_10555992 | 3300019867 | Soil | MLGLVARGTYVVVLATMIVAWVVSFNKEAPTEIQPSQAIWYVYS |
| Ga0126371_108587342 | 3300021560 | Tropical Forest Soil | MLRTIARGTYVVVLATMIVAWVVSFNKEAPAETQPSDAIWYINT |
| Ga0126371_114278282 | 3300021560 | Tropical Forest Soil | MLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC |
| Ga0126371_129689901 | 3300021560 | Tropical Forest Soil | MLGNLARGTYVVVVTAMIVAWVFSLGKEVPAEPQPYQEITYANA |
| Ga0222622_113577492 | 3300022756 | Groundwater Sediment | MLGAVARSTYVLVLGAMIVAWVFSLNRETTPAGSQPSQVTWSIYA |
| Ga0247664_11733692 | 3300024232 | Soil | MLGTVARGTYVVVLATMIVAWVVSFNKEVSVDIQPSDAIWYINI |
| Ga0207697_101753183 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGTVARGTYVVVLATMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207671_103153381 | 3300025914 | Corn Rhizosphere | RGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINI |
| Ga0207681_106053621 | 3300025923 | Switchgrass Rhizosphere | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAI |
| Ga0207670_102733082 | 3300025936 | Switchgrass Rhizosphere | MVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQT |
| Ga0209068_102111262 | 3300027894 | Watersheds | MFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA |
| Ga0307313_101845372 | 3300028715 | Soil | MLGLVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS |
| Ga0307317_102750941 | 3300028720 | Soil | MEAAMLGLVARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS |
| Ga0307286_102372532 | 3300028876 | Soil | LVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS |
| Ga0307308_100122293 | 3300028884 | Soil | MLGLVARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS |
| Ga0307495_100038641 | 3300031199 | Soil | NTEAAMLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQAIWYVYS |
| Ga0170824_1181421542 | 3300031231 | Forest Soil | MLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQDIWYVYS |
| Ga0307469_103175591 | 3300031720 | Hardwood Forest Soil | MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQAIWY |
| Ga0307469_117253972 | 3300031720 | Hardwood Forest Soil | MLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPGQATWYMYS |
| Ga0307473_100138674 | 3300031820 | Hardwood Forest Soil | MIGTVARGTYVLVLTAMIVAWVFSLGKDVPAESQPTQEITYIYS |
| Ga0310897_100100764 | 3300032003 | Soil | MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSD |
| Ga0307470_101107943 | 3300032174 | Hardwood Forest Soil | GGDMIGAVARSTYVLVLGAMIVAWVFSFNKEVPAGQDPSQVTWNIWA |
| Ga0335082_105839902 | 3300032782 | Soil | ARQMLGKLARGTYVLVLTAMIVAWVVSLGKEAPAETQPTQEISYTYT |
| Ga0310810_100927903 | 3300033412 | Soil | MLRTVARGTYVLVLTAMVVAWVVSLGKDAPAGAQPSEQQTWYLHS |
| Ga0326726_102391712 | 3300033433 | Peat Soil | MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEAQPDQQIWYIYS |
| Ga0316628_1005193052 | 3300033513 | Soil | MLGTLARGTYVFVLATMIVVWIFSFNKEAPAEPQQPGEQTWEIGA |
| Ga0316628_1026219971 | 3300033513 | Soil | MIGTLARGTYVLVLATMIVVWIFSFNKEAPAEPQQPGEQTWEIGA |
| ⦗Top⦘ |