Metagenome Family F078798

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F078798
Family Type	Metagenome
Number of Sequences	116
Average Sequence Length	43 residues
Representative Sequence	MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS
Number of Associated Samples	86
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	77.39 %
% of genes near scaffold ends (potentially truncated)	29.31 %
% of genes from short scaffolds (< 2000 bps)	81.03 %
Associated GOLD sequencing projects	82
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (76.724 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (14.655 % of family members)
Environment Ontology (ENVO)	Unclassified (33.621 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (55.172 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF00389	2-Hacid_dh	19.83
PF02826	2-Hacid_dh_C	16.38
PF00561	Abhydrolase_1	12.07
PF12697	Abhydrolase_6	10.34
PF08386	Abhydrolase_4	9.48
PF13432	TPR_16	4.31
PF01494	FAD_binding_3	1.72
PF13279	4HBT_2	1.72
PF13428	TPR_14	1.72
PF05170	AsmA	0.86
PF09084	NMT1	0.86
PF12688	TPR_5	0.86
PF02913	FAD-oxidase_C	0.86
PF12146	Hydrolase_4	0.86
PF07298	NnrU	0.86
PF00355	Rieske	0.86

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	3.45
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.72
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	1.72
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	1.72
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.86
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.86
COG2982	Uncharacterized conserved protein AsmA involved in outer membrane biogenesis	Cell wall/membrane/envelope biogenesis [M]	0.86
COG4094	Uncharacterized membrane protein	Function unknown [S]	0.86
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.86

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	74.14 %
Unclassified	root	N/A	23.28 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.86 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	63.79 %
Unclassified	root	N/A	23.28 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.86 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	32.76 %
Unclassified	root	N/A	23.28 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1.72 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	14.66 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	8.62 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	3.45 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.86 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.62 %
Nordella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella	3.45 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.59 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.86 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.62 %
unclassified Nordella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella	3.45 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.86 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.86 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.62 %
Nordella sp. HKS 07	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	3.45 %
unclassified Nocardioides	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides	0.86 %
Bradyrhizobium sp. SHOUNA76	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76	0.86 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.62 %
Nordella sp. HKS 07	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	3.45 %
Nocardioides sp. WL0053	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. WL0053	0.86 %
Bradyrhizobium sp. SHOUNA76	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76	0.86 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9276533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1108	Open in IMG/M
2199352025\|deepsgr__Contig_169595	All Organisms → cellular organisms → Bacteria	3148	Open in IMG/M
2228664021\|ICCgaii200_c0842509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1396	Open in IMG/M
3300000044\|ARSoilOldRDRAFT_c002928	Not Available	1483	Open in IMG/M
3300000156\|NODE_c0718922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5618	Open in IMG/M
3300000550\|F24TB_10458754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1038	Open in IMG/M
3300000559\|F14TC_102100117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1064	Open in IMG/M
3300003911\|JGI25405J52794_10031317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1105	Open in IMG/M
3300004024\|Ga0055436_10000894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4769	Open in IMG/M
3300004058\|Ga0055498_10090273	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. WL0053	606	Open in IMG/M
3300004479\|Ga0062595_101314412	Not Available	652	Open in IMG/M
3300004479\|Ga0062595_102649887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	504	Open in IMG/M
3300005147\|Ga0066821_1018145	All Organisms → cellular organisms → Bacteria → Proteobacteria	574	Open in IMG/M
3300005204\|Ga0068997_10073979	All Organisms → cellular organisms → Bacteria → Proteobacteria	698	Open in IMG/M
3300005205\|Ga0068999_10004533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1596	Open in IMG/M
3300005213\|Ga0068998_10177979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	521	Open in IMG/M
3300005294\|Ga0065705_10106434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	6639	Open in IMG/M
3300005295\|Ga0065707_10011049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2470	Open in IMG/M
3300005332\|Ga0066388_100002265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11614	Open in IMG/M
3300005332\|Ga0066388_100026309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5310	Open in IMG/M
3300005332\|Ga0066388_100113593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3211	Open in IMG/M
3300005332\|Ga0066388_100286270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2291	Open in IMG/M
3300005332\|Ga0066388_101144305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1323	Open in IMG/M
3300005332\|Ga0066388_101192164	Not Available	1300	Open in IMG/M
3300005332\|Ga0066388_101580728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1152	Open in IMG/M
3300005332\|Ga0066388_103263353	Not Available	829	Open in IMG/M
3300005332\|Ga0066388_103966627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	755	Open in IMG/M
3300005332\|Ga0066388_104435593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	715	Open in IMG/M
3300005444\|Ga0070694_100900842	Not Available	730	Open in IMG/M
3300005445\|Ga0070708_101674906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	591	Open in IMG/M
3300005713\|Ga0066905_100038242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2814	Open in IMG/M
3300005713\|Ga0066905_100043929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2676	Open in IMG/M
3300005713\|Ga0066905_100135057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1749	Open in IMG/M
3300005713\|Ga0066905_100397030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1117	Open in IMG/M
3300005713\|Ga0066905_101257418	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300005713\|Ga0066905_101458351	Not Available	621	Open in IMG/M
3300005713\|Ga0066905_101864331	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300005937\|Ga0081455_10363349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1017	Open in IMG/M
3300006049\|Ga0075417_10000028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	28772	Open in IMG/M
3300006050\|Ga0075028_100325209	Not Available	863	Open in IMG/M
3300006057\|Ga0075026_100201847	All Organisms → cellular organisms → Bacteria → Proteobacteria	1046	Open in IMG/M
3300006354\|Ga0075021_10306029	Not Available	986	Open in IMG/M
3300006845\|Ga0075421_101344844	Not Available	789	Open in IMG/M
3300006852\|Ga0075433_11107170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	689	Open in IMG/M
3300006854\|Ga0075425_100011786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	9364	Open in IMG/M
3300006954\|Ga0079219_10759610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	752	Open in IMG/M
3300009012\|Ga0066710_101292519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1131	Open in IMG/M
3300009094\|Ga0111539_10000299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	60010	Open in IMG/M
3300010047\|Ga0126382_10141892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1630	Open in IMG/M
3300010047\|Ga0126382_12476904	Not Available	505	Open in IMG/M
3300010358\|Ga0126370_10662013	All Organisms → cellular organisms → Bacteria → Proteobacteria	911	Open in IMG/M
3300010359\|Ga0126376_11132818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	793	Open in IMG/M
3300010359\|Ga0126376_12625403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	552	Open in IMG/M
3300010362\|Ga0126377_10380028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1417	Open in IMG/M
3300010362\|Ga0126377_12474367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	595	Open in IMG/M
3300010366\|Ga0126379_11532739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	772	Open in IMG/M
3300010376\|Ga0126381_100520522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76	1681	Open in IMG/M
3300010376\|Ga0126381_104739012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	523	Open in IMG/M
3300010400\|Ga0134122_10047667	All Organisms → cellular organisms → Bacteria → Proteobacteria	3281	Open in IMG/M
3300012208\|Ga0137376_10314070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1360	Open in IMG/M
3300012488\|Ga0157343_1009846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	713	Open in IMG/M
3300012490\|Ga0157322_1015005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	685	Open in IMG/M
3300012500\|Ga0157314_1049881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	532	Open in IMG/M
3300012948\|Ga0126375_10089849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1786	Open in IMG/M
3300012948\|Ga0126375_10461753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	936	Open in IMG/M
3300012957\|Ga0164303_10047080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1888	Open in IMG/M
3300012971\|Ga0126369_11167024	Not Available	860	Open in IMG/M
3300012971\|Ga0126369_11611683	All Organisms → cellular organisms → Bacteria → Proteobacteria	739	Open in IMG/M
3300014308\|Ga0075354_1029998	Not Available	919	Open in IMG/M
3300014745\|Ga0157377_10078009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1930	Open in IMG/M
3300015371\|Ga0132258_11954302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1476	Open in IMG/M
3300015371\|Ga0132258_13118705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1145	Open in IMG/M
3300015374\|Ga0132255_102750802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	752	Open in IMG/M
3300017939\|Ga0187775_10304388	All Organisms → cellular organisms → Bacteria → Proteobacteria	630	Open in IMG/M
3300017939\|Ga0187775_10477482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	529	Open in IMG/M
3300017944\|Ga0187786_10017429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1858	Open in IMG/M
3300017944\|Ga0187786_10106428	Not Available	953	Open in IMG/M
3300017947\|Ga0187785_10108331	Not Available	1121	Open in IMG/M
3300017961\|Ga0187778_10193133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1296	Open in IMG/M
3300018028\|Ga0184608_10038660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1832	Open in IMG/M
3300018029\|Ga0187787_10211155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	691	Open in IMG/M
3300018032\|Ga0187788_10543913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	507	Open in IMG/M
3300018058\|Ga0187766_10193350	All Organisms → cellular organisms → Bacteria → Proteobacteria	1282	Open in IMG/M
3300018060\|Ga0187765_10005672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5333	Open in IMG/M
3300018064\|Ga0187773_10981408	Not Available	552	Open in IMG/M
3300018064\|Ga0187773_11159313	Not Available	517	Open in IMG/M
3300018066\|Ga0184617_1020795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1456	Open in IMG/M
3300018067\|Ga0184611_1175241	Not Available	762	Open in IMG/M
3300019867\|Ga0193704_1055599	Not Available	767	Open in IMG/M
3300021560\|Ga0126371_10858734	Not Available	1052	Open in IMG/M
3300021560\|Ga0126371_11427828	All Organisms → cellular organisms → Bacteria → Proteobacteria	822	Open in IMG/M
3300021560\|Ga0126371_12968990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	574	Open in IMG/M
3300022756\|Ga0222622_11357749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	523	Open in IMG/M
3300024232\|Ga0247664_1173369	Not Available	510	Open in IMG/M
3300025315\|Ga0207697_10175318	Not Available	938	Open in IMG/M
3300025914\|Ga0207671_10315338	All Organisms → cellular organisms → Bacteria → Proteobacteria	1237	Open in IMG/M
3300025923\|Ga0207681_10605362	Not Available	906	Open in IMG/M
3300025936\|Ga0207670_10273308	Not Available	1314	Open in IMG/M
3300027894\|Ga0209068_10211126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1070	Open in IMG/M
3300028715\|Ga0307313_10184537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	646	Open in IMG/M
3300028720\|Ga0307317_10275094	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300028876\|Ga0307286_10237253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	666	Open in IMG/M
3300028884\|Ga0307308_10012229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3836	Open in IMG/M
3300031199\|Ga0307495_10003864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1799	Open in IMG/M
3300031231\|Ga0170824_118142154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3454	Open in IMG/M
3300031720\|Ga0307469_10317559	Not Available	1292	Open in IMG/M
3300031720\|Ga0307469_11725397	Not Available	604	Open in IMG/M
3300031820\|Ga0307473_10013867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3050	Open in IMG/M
3300032003\|Ga0310897_10010076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2781	Open in IMG/M
3300032174\|Ga0307470_10110794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1597	Open in IMG/M
3300032782\|Ga0335082_10583990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	979	Open in IMG/M
3300033412\|Ga0310810_10092790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3612	Open in IMG/M
3300033433\|Ga0326726_10239171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1687	Open in IMG/M
3300033513\|Ga0316628_100519305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07	1540	Open in IMG/M
3300033513\|Ga0316628_102621997	Not Available	664	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.62%
Host-Associated	Host-Associated	15.52%
Engineered	Engineered	0.86%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	72.41%
Plants	Host-Associated → Plants	15.52%
Aquatic	Environmental → Aquatic	11.21%
Solid Waste	Engineered → Solid Waste	0.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.76%
Sediment	Environmental → Aquatic → Sediment	6.90%
Marine	Environmental → Aquatic → Marine	4.31%
Peat	Environmental → Terrestrial → Peat	0.86%
Grass	Engineered → Solid Waste → Grass	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.79%
Loam	Environmental → Terrestrial → Soil → Loam	18.97%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	13.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.03%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.17%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.86%
Composting	Engineered → Solid Waste → Grass → Composting	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.59%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	14.66%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	13.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.17%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	4.31%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.59%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.59%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.72%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.86%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.86%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.86%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	14.66%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	10.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.76%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	4.31%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.31%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.45%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.45%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.59%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.59%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.59%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	2.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.72%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.72%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.86%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.86%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.86%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.86%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.86%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.86%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.86%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.86%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.86%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.86%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old	Host-Associated	Open in IMG/M
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005147	Soil and rhizosphere microbial communities from Laval, Canada - mgLMC	Environmental	Open in IMG/M
3300005204	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2	Environmental	Open in IMG/M
3300005205	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2	Environmental	Open in IMG/M
3300005213	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Host-Associated	Open in IMG/M
3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Host-Associated	Open in IMG/M
3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Host-Associated	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300019867	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024232	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICI_01154870	2088090015	Soil	MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVR
deepsgr_02851780	2199352025	Soil	MLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQAIWYVYS
ICCgaii200_08425093	2228664021	Soil	MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS
ARSoilOldRDRAFT_0029283	3300000044	Arabidopsis Rhizosphere	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT*
NODE_07189226	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQPEAVWYINI*
F24TB_104587541	3300000550	Soil	LGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
F14TC_1021001172	3300000559	Soil	TVARGTYVVVLAAMIVAWVFSLNKEAPADPQGSQVIWYLHS*
JGI25405J52794_100313172	3300003911	Tabebuia Heterophylla Rhizosphere	MLGRVARGTYVFVLAAMIVAWVFSLNREAPAEPQANQVIWYLHS*
Ga0055436_100008943	3300004024	Natural And Restored Wetlands	MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEAQPDQQIWYIYS*
Ga0055498_100902731	3300004058	Natural And Restored Wetlands	MLGTVARGTYVLVLTAMIVAWVVSLGKVAPADTQPDQVWYIHI*
Ga0062595_1013144121	3300004479	Soil	MLRTVARGTYVLVLTAMVVAWVVSLGKDAPAGAQPSEQQTWYLHS*
Ga0062595_1026498871	3300004479	Soil	MLGRVARGTYVLVLTAMIVAWVFSLNKEAPAEPQAEQVIW
Ga0066821_10181451	3300005147	Soil	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINI*
Ga0068997_100739792	3300005204	Natural And Restored Wetlands	MLGKVARGTYVLVLATMIVAWVISFNREVPADPQPGQEFSRAYS*
Ga0068999_100045332	3300005205	Natural And Restored Wetlands	MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEVQPDQQIWYIYS*
Ga0068998_101779792	3300005213	Natural And Restored Wetlands	MFGTVARGTCVLVLTAIIVAWAVSLGKEAPAEGQPDQQIWDIYS*
Ga0065705_101064342	3300005294	Switchgrass Rhizosphere	MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQVIWYIYS*
Ga0065707_100110492	3300005295	Switchgrass Rhizosphere	MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQXIWYIYS*
Ga0066388_1000022654	3300005332	Tropical Forest Soil	MLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC*
Ga0066388_1000263092	3300005332	Tropical Forest Soil	MIGMVARGTYVLVLTAMIVTWVFSFNKEIPVAPQSDQVIWYIHT*
Ga0066388_1001135933	3300005332	Tropical Forest Soil	MLGMVARGTYVFVLTAMVVAWIFSLNKEVPAEAQADQVIWYIHI*
Ga0066388_1002862701	3300005332	Tropical Forest Soil	MLGTVARRTYVVVLATMIVAWVVSFNKEAPAETQPSDAIWYINT*
Ga0066388_1011443052	3300005332	Tropical Forest Soil	MLGTVARGTYMVVLATMIVAWVLSLNKEAPADTQPIWYIYS*
Ga0066388_1011921642	3300005332	Tropical Forest Soil	MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQSSQEVWYINI*
Ga0066388_1015807282	3300005332	Tropical Forest Soil	MLGMVARGTYVFVLTAMVVAWVYSLNKEVPAEPQSDQVIWYIHI*
Ga0066388_1032633531	3300005332	Tropical Forest Soil	MLGMMARGTYVLALTAMIVAWVFSLNKEVPAEPQSDQVIWYIHI*
Ga0066388_1039666272	3300005332	Tropical Forest Soil	MLGMVARGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT*
Ga0066388_1044355932	3300005332	Tropical Forest Soil	ARGTYMLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
Ga0070694_1009008422	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYIN
Ga0070708_1016749061	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	YGGGGMLGTVARGTYVLVLTAMIVAWVFSLNREAPAEPQAGQQTWYIHS*
Ga0066905_1000382423	3300005713	Tropical Forest Soil	MLGTVARGTYMLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
Ga0066905_1000439292	3300005713	Tropical Forest Soil	MLGTVARGTYVLVLATMIVAWVFSLNKEAPAEPQSDQVIWYIHS*
Ga0066905_1001350572	3300005713	Tropical Forest Soil	MLGRVARGTYVLVLAAMIVAWVFSLNKDAPAEPQANQVTWYIHS*
Ga0066905_1003970302	3300005713	Tropical Forest Soil	MLGRVARGTYVLVLTAMIVAWVFSLNKEVPAEPQANQVIWYLHS*
Ga0066905_1012574182	3300005713	Tropical Forest Soil	MLGMVARGTYVFVLTAMVVAWVFSLNKEVPAEAQSDQVIWYIHI*
Ga0066905_1014583512	3300005713	Tropical Forest Soil	MLGRVARGTYVVVLAAMIVAWVFSLNKDAPAEPQANQV
Ga0066905_1018643312	3300005713	Tropical Forest Soil	MLGRVARGTYVLVLTAMIVAWVFSFNKEAPSEPETNQMIWYIHS*
Ga0081455_103633492	3300005937	Tabebuia Heterophylla Rhizosphere	MLGTVARGTYVLVLATMIVAWVFSLNKEAPAELQSDQVIWYIHS*
Ga0075417_1000002811	3300006049	Populus Rhizosphere	MLGTVARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
Ga0075028_1003252092	3300006050	Watersheds	MEAQVMFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA*
Ga0075026_1002018471	3300006057	Watersheds	KNLEATMLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPSQPTWYMYS*
Ga0075021_103060292	3300006354	Watersheds	MFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA*
Ga0075421_1013448441	3300006845	Populus Rhizosphere	MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKP
Ga0075433_111071702	3300006852	Populus Rhizosphere	MLGTVARGTYVLVLAAMIVAWVFSLNKAPGEPQSNQAIWYIHS*
Ga0075425_1000117865	3300006854	Populus Rhizosphere	MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQAIWYIYS*
Ga0079219_107596102	3300006954	Agricultural Soil	MLGKLARGTYVFVVTAMIVAWVFSLGKEGPAEPQPTQEISYAWA*
Ga0066710_1012925192	3300009012	Grasslands Soil	MIGTVARGTYVVVLAALIVAWVVSFNKEAPAEPQAEPQVWYIYS
Ga0111539_1000029951	3300009094	Populus Rhizosphere	MARGTYVVVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
Ga0126382_101418922	3300010047	Tropical Forest Soil	MLGMVARGTYVLVLTAMIVTWVFSFNKEIPVAPQSDQVIWYIHT*
Ga0126382_124769042	3300010047	Tropical Forest Soil	MLVLAAMIVAWVFSLNKEAPAEPQADQVIWYIHS*
Ga0126370_106620132	3300010358	Tropical Forest Soil	GTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC*
Ga0126376_111328181	3300010359	Tropical Forest Soil	MLGMVAQGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT*
Ga0126376_126254031	3300010359	Tropical Forest Soil	MLGTVARGTYVVVLATMIVAWVLSLNKEAPADTQPEAVWYINI*
Ga0126377_103800282	3300010362	Tropical Forest Soil	MLGRVARGTYVLVITAMIVAWVFSLNKEAPAEPQANQVIWYLHS*
Ga0126377_124743672	3300010362	Tropical Forest Soil	RGTYVLVLTAMVVAWVFSFNKEVPVAPQSDQVIWYIHT*
Ga0126379_115327392	3300010366	Tropical Forest Soil	MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVIYYVYA*
Ga0126381_1005205221	3300010376	Tropical Forest Soil	RRMLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC*
Ga0126381_1047390121	3300010376	Tropical Forest Soil	MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVTYYVFA*
Ga0134122_100476674	3300010400	Terrestrial Soil	MLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPSQPTWYMYS*
Ga0137376_103140702	3300012208	Vadose Zone Soil	MEAAMLGLVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS*
Ga0157343_10098461	3300012488	Arabidopsis Rhizosphere	GTYVVVLATMIVAWVVSFNKEAPADTQPSDAIGYINI*
Ga0157322_10150051	3300012490	Arabidopsis Rhizosphere	TEATAMLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT*
Ga0157314_10498811	3300012500	Arabidopsis Rhizosphere	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWY
Ga0126375_100898492	3300012948	Tropical Forest Soil	MIGMVARGTYVLVLTAMIVTWVSSFNKEIPVAPQSDQVIWYIHT*
Ga0126375_104617532	3300012948	Tropical Forest Soil	MLGTVARGTYVLVLATMIAAWVFSLNKEAPAEPQSDQVIWYIHS*
Ga0164303_100470801	3300012957	Soil	YMVFLATMIVAWVLSFNKEAPADTQPSQVIWYIYS*
Ga0164301_100860622	3300012960	Soil	VLVLTAMIAAWVVSLNKEAPTEPEASPQTWYIHS*
Ga0126369_111670242	3300012971	Tropical Forest Soil	MLGKMARGTYVLVVGAMVVAWVISINQEIPADPQSTQEAIYYVFA*
Ga0126369_116116831	3300012971	Tropical Forest Soil	KMARGTYVLVVGAMVVAWVISINQEIPADPQPTTQEVTYYVFA*
Ga0075354_10299981	3300014308	Natural And Restored Wetlands	MLGTVARGTYVLVLTAMIVAWVVSLGKVAPADTQP
Ga0157377_100780092	3300014745	Miscanthus Rhizosphere	MLGTLARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINT*
Ga0132258_119543021	3300015371	Arabidopsis Rhizosphere	KNTEATAMLGTVARGTYMVVLATMIVAWVLSFNKEAPADTQPSQAIWYIYS*
Ga0132258_131187051	3300015371	Arabidopsis Rhizosphere	MLGKLARGTYVVVVTAMIIAWVFSLGTEVPAEPQPTQEISYAYA*
Ga0132255_1027508022	3300015374	Arabidopsis Rhizosphere	MLGKLARGTYVLVVTAMIVAWVFSLGKEVPAEPQPTQEISYAYA*
Ga0187775_103043881	3300017939	Tropical Peatland	MLGTVARGTYVLLLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS
Ga0187775_104774822	3300017939	Tropical Peatland	MLSKLARGAYVLVVTAMIVAWVFSFGKQIPAEPQPSQEITYAYA
Ga0187786_100174292	3300017944	Tropical Peatland	MLGTVARGTYVFVLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS
Ga0187786_101064281	3300017944	Tropical Peatland	MLGTVARGTYVVVLATMVVAWVISLNKEAPADTQPEAVWYINI
Ga0187785_101083311	3300017947	Tropical Peatland	MLGTIARGTYVVVLATMIVAWVVSFNKEAPAETQP
Ga0187778_101931332	3300017961	Tropical Peatland	MLGKAARGTYVLVVTAMIVAWVLSFGKEVPAEPQPTQEISYIYC
Ga0184608_100386602	3300018028	Groundwater Sediment	MLGTVARGTYVVVLTAMIVAWVFSLNREVPTESQPSQGIWYIHI
Ga0187787_102111551	3300018029	Tropical Peatland	MLGTVARGTYVLVLTAMIVAWAVSLGKEAPAEAQPDQQIWYIYS
Ga0187788_105439131	3300018032	Tropical Peatland	TYVLVLTAMVVAWVVSLGKEVPSDPQSSQQVYYLHS
Ga0187766_101933501	3300018058	Tropical Peatland	RNATLGKFARASYVLVVTAMIVAWVVSLGKEVPAEAQPTQEITYANA
Ga0187765_100056724	3300018060	Tropical Peatland	MLGTIARGTYVVVLATMIVAWVVSFNKEAPAETQPDAIWYINI
Ga0187773_109814081	3300018064	Tropical Peatland	MLGTVARGTYVLVLTAMIVAWVVSLGKEAPTEAQPSQQTWYIYS
Ga0187773_111593132	3300018064	Tropical Peatland	MLGTVARGTYVLVLTAMIVAWVVSLGKEAPAEAQPDQQIWYIHS
Ga0184617_10207952	3300018066	Groundwater Sediment	MEAAMLGLMARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS
Ga0184611_11752412	3300018067	Groundwater Sediment	MLGAVARSTYVLVLGAMIVAWVFSLNRDTTPAGSQPSQVTWSIYA
Ga0193704_10555992	3300019867	Soil	MLGLVARGTYVVVLATMIVAWVVSFNKEAPTEIQPSQAIWYVYS
Ga0126371_108587342	3300021560	Tropical Forest Soil	MLRTIARGTYVVVLATMIVAWVVSFNKEAPAETQPSDAIWYINT
Ga0126371_114278282	3300021560	Tropical Forest Soil	MLGKMARGTYVLVVTAMVVAWVFPYDKEIRVQPQPTQEISYIYC
Ga0126371_129689901	3300021560	Tropical Forest Soil	MLGNLARGTYVVVVTAMIVAWVFSLGKEVPAEPQPYQEITYANA
Ga0222622_113577492	3300022756	Groundwater Sediment	MLGAVARSTYVLVLGAMIVAWVFSLNRETTPAGSQPSQVTWSIYA
Ga0247664_11733692	3300024232	Soil	MLGTVARGTYVVVLATMIVAWVVSFNKEVSVDIQPSDAIWYINI
Ga0207697_101753183	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MLGTVARGTYVVVLATMIVAWVISFNKEVPARPQTGPQVWYIYS
Ga0207671_103153381	3300025914	Corn Rhizosphere	RGTYVVVLATMIVAWVVSFNKEAPADTQPSDAIWYINI
Ga0207681_106053621	3300025923	Switchgrass Rhizosphere	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSDAI
Ga0207670_102733082	3300025936	Switchgrass Rhizosphere	MVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQT
Ga0209068_102111262	3300027894	Watersheds	MFGTVARGTYVVVLTAMIVAWVFSLGKEAPAEPQPSQQVWDIYA
Ga0307313_101845372	3300028715	Soil	MLGLVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS
Ga0307317_102750941	3300028720	Soil	MEAAMLGLVARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS
Ga0307286_102372532	3300028876	Soil	LVARGTYVVVLATMIVAWVVSFNKEASLDTQPSQATWHMYS
Ga0307308_100122293	3300028884	Soil	MLGLVARGTYVVVLATMIVAWVVSFNKLDTQPSQATWHMYS
Ga0307495_100038641	3300031199	Soil	NTEAAMLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQAIWYVYS
Ga0170824_1181421542	3300031231	Forest Soil	MLGLVARGTYVVALATMIVAWVVSFNKEAPTEIQPSQDIWYVYS
Ga0307469_103175591	3300031720	Hardwood Forest Soil	MLGTVARGTYMVFLATMIVAWVLSFNKEAPADTQPSQAIWY
Ga0307469_117253972	3300031720	Hardwood Forest Soil	MLGIVARGTYVVVLATMIAAWVVSFNKEAPAETQPGQATWYMYS
Ga0307473_100138674	3300031820	Hardwood Forest Soil	MIGTVARGTYVLVLTAMIVAWVFSLGKDVPAESQPTQEITYIYS
Ga0310897_100100764	3300032003	Soil	MLGTVARGTYVVVLATMIVAWVVSFNKEAPADTQPSD
Ga0307470_101107943	3300032174	Hardwood Forest Soil	GGDMIGAVARSTYVLVLGAMIVAWVFSFNKEVPAGQDPSQVTWNIWA
Ga0335082_105839902	3300032782	Soil	ARQMLGKLARGTYVLVLTAMIVAWVVSLGKEAPAETQPTQEISYTYT
Ga0310810_100927903	3300033412	Soil	MLRTVARGTYVLVLTAMVVAWVVSLGKDAPAGAQPSEQQTWYLHS
Ga0326726_102391712	3300033433	Peat Soil	MFGTVARGTYVLVLTAIIVAWAVSLGKEAPAEAQPDQQIWYIYS
Ga0316628_1005193052	3300033513	Soil	MLGTLARGTYVFVLATMIVVWIFSFNKEAPAEPQQPGEQTWEIGA
Ga0316628_1026219971	3300033513	Soil	MIGTLARGTYVLVLATMIVVWIFSFNKEAPAEPQQPGEQTWEIGA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F078798

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences