NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078796

Metagenome / Metatranscriptome Family F078796

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078796
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 44 residues
Representative Sequence VWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA
Number of Associated Samples 112
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.93 %
% of genes near scaffold ends (potentially truncated) 96.55 %
% of genes from short scaffolds (< 2000 bps) 94.83 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.655 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.655 % of family members)
Environment Ontology (ENVO) Unclassified
(16.379 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.517 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.28%    β-sheet: 0.00%    Coil/Unstructured: 50.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF04545Sigma70_r4 52.59
PF01070FMN_dh 6.90
PF08241Methyltransf_11 2.59
PF00486Trans_reg_C 0.86
PF01695IstB_IS21 0.86
PF00011HSP20 0.86
PF04392ABC_sub_bind 0.86
PF11953DUF3470 0.86
PF01370Epimerase 0.86
PF13237Fer4_10 0.86
PF02653BPD_transp_2 0.86
PF07592DDE_Tnp_ISAZ013 0.86
PF16576HlyD_D23 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 6.90
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 6.90
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.86
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.86
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.66 %
UnclassifiedrootN/A35.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_101164036Not Available641Open in IMG/M
3300004635|Ga0062388_102633916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300005172|Ga0066683_10760605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300005176|Ga0066679_10298161Not Available1047Open in IMG/M
3300005178|Ga0066688_10772511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300005179|Ga0066684_10834786Not Available606Open in IMG/M
3300005437|Ga0070710_10807756Not Available670Open in IMG/M
3300005437|Ga0070710_11431192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300005447|Ga0066689_10825366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300005553|Ga0066695_10368553Not Available897Open in IMG/M
3300005553|Ga0066695_10595044Not Available664Open in IMG/M
3300005574|Ga0066694_10338880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300005602|Ga0070762_11264892All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005921|Ga0070766_10901428Not Available605Open in IMG/M
3300006028|Ga0070717_11196898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300006057|Ga0075026_100798723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300006059|Ga0075017_100683694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria788Open in IMG/M
3300006354|Ga0075021_10922417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium567Open in IMG/M
3300006794|Ga0066658_10216828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1017Open in IMG/M
3300006795|Ga0075520_1135196Not Available1088Open in IMG/M
3300006969|Ga0075419_10571391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300007076|Ga0075435_100088589All Organisms → cellular organisms → Bacteria2551Open in IMG/M
3300007258|Ga0099793_10610928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium547Open in IMG/M
3300007265|Ga0099794_10480431Not Available653Open in IMG/M
3300007788|Ga0099795_10030352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1855Open in IMG/M
3300009038|Ga0099829_11261902Not Available611Open in IMG/M
3300009137|Ga0066709_102887258Not Available634Open in IMG/M
3300009177|Ga0105248_11156497Not Available875Open in IMG/M
3300009177|Ga0105248_11323124All Organisms → cellular organisms → Bacteria → Proteobacteria815Open in IMG/M
3300009523|Ga0116221_1329601Not Available662Open in IMG/M
3300009632|Ga0116102_1157110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300009636|Ga0116112_1019590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2327Open in IMG/M
3300009644|Ga0116121_1227333All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300009672|Ga0116215_1548211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium500Open in IMG/M
3300009683|Ga0116224_10615089Not Available519Open in IMG/M
3300009762|Ga0116130_1192298All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300009839|Ga0116223_10859329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300010142|Ga0127483_1278019Not Available611Open in IMG/M
3300010325|Ga0134064_10064191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1149Open in IMG/M
3300010335|Ga0134063_10247987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300010339|Ga0074046_10268087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1056Open in IMG/M
3300010343|Ga0074044_10957748Not Available560Open in IMG/M
3300010376|Ga0126381_105066965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300010398|Ga0126383_11070383Not Available896Open in IMG/M
3300010999|Ga0138505_100000653All Organisms → cellular organisms → Bacteria2664Open in IMG/M
3300011000|Ga0138513_100063408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300012096|Ga0137389_10626470Not Available924Open in IMG/M
3300012189|Ga0137388_11741120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria556Open in IMG/M
3300012357|Ga0137384_10696839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300012361|Ga0137360_11484368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300012363|Ga0137390_10993773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium791Open in IMG/M
3300012532|Ga0137373_10636736Not Available801Open in IMG/M
3300012922|Ga0137394_10538765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium990Open in IMG/M
3300012923|Ga0137359_10097703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2592Open in IMG/M
3300012924|Ga0137413_10962530Not Available667Open in IMG/M
3300012929|Ga0137404_12162118All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300012941|Ga0162652_100092367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300012951|Ga0164300_11172591Not Available507Open in IMG/M
3300012955|Ga0164298_10924259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300012988|Ga0164306_10772460Not Available771Open in IMG/M
3300013306|Ga0163162_11229200Not Available850Open in IMG/M
3300013306|Ga0163162_11517856All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300014158|Ga0181521_10034224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3792Open in IMG/M
3300014159|Ga0181530_10542464All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300014325|Ga0163163_12900335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei535Open in IMG/M
3300017822|Ga0187802_10408556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae538Open in IMG/M
3300017934|Ga0187803_10034949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae1996Open in IMG/M
3300017943|Ga0187819_10871160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300017999|Ga0187767_10026063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1307Open in IMG/M
3300018006|Ga0187804_10122798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1080Open in IMG/M
3300018027|Ga0184605_10391914All Organisms → cellular organisms → Bacteria → Proteobacteria622Open in IMG/M
3300018028|Ga0184608_10240299Not Available796Open in IMG/M
3300018057|Ga0187858_10768925All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300018084|Ga0184629_10375953Not Available747Open in IMG/M
3300018431|Ga0066655_10381883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium928Open in IMG/M
3300018476|Ga0190274_13849531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium508Open in IMG/M
3300021404|Ga0210389_11174433Not Available591Open in IMG/M
3300021478|Ga0210402_11224586Not Available678Open in IMG/M
3300025320|Ga0209171_10381087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300025898|Ga0207692_10937603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300026304|Ga0209240_1167843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300026326|Ga0209801_1198397Not Available806Open in IMG/M
3300026329|Ga0209375_1301291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300026377|Ga0257171_1048070All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M
3300026499|Ga0257181_1039061All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300027671|Ga0209588_1073987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1101Open in IMG/M
3300027698|Ga0209446_1084810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300027795|Ga0209139_10156480Not Available806Open in IMG/M
3300027875|Ga0209283_10426040Not Available862Open in IMG/M
3300027915|Ga0209069_10580055Not Available643Open in IMG/M
3300028536|Ga0137415_10220809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1709Open in IMG/M
3300028775|Ga0302231_10318943Not Available652Open in IMG/M
3300028780|Ga0302225_10007142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6063Open in IMG/M
3300028801|Ga0302226_10430704Not Available551Open in IMG/M
3300028814|Ga0307302_10421458Not Available660Open in IMG/M
3300029889|Ga0246001_1033739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1273Open in IMG/M
3300030659|Ga0316363_10316508All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300030831|Ga0308152_102722All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300030916|Ga0075386_10005965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300030990|Ga0308178_1128252Not Available565Open in IMG/M
3300031124|Ga0308151_1027902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300031170|Ga0307498_10220401All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300031446|Ga0170820_14479656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300031719|Ga0306917_10483787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria971Open in IMG/M
3300031720|Ga0307469_11372393Not Available673Open in IMG/M
3300031723|Ga0318493_10490234All Organisms → cellular organisms → Bacteria → Proteobacteria678Open in IMG/M
3300031736|Ga0318501_10465824Not Available687Open in IMG/M
3300031753|Ga0307477_10546262Not Available784Open in IMG/M
3300031780|Ga0318508_1170626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300031823|Ga0307478_10437857Not Available1086Open in IMG/M
3300031944|Ga0310884_10469380All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300032001|Ga0306922_11151016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium792Open in IMG/M
3300032039|Ga0318559_10373587Not Available664Open in IMG/M
3300032041|Ga0318549_10353146Not Available662Open in IMG/M
3300033289|Ga0310914_10818601All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300033887|Ga0334790_182823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria611Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.31%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.59%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil2.59%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.86%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.86%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.86%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.86%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.86%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031124Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10116403623300004152Bog Forest SoilVISIGIAHIEVNVGMILRRFISNALELAAASAHDRQPDFIMKLRIPFHLYRA
Ga0062388_10263391613300004635Bog Forest SoilDDLIGIAHIEVDVWVILRRQSANALQLAAANADDRHADFIVKLRITLPVQFNLTH*
Ga0066683_1076060523300005172SoilDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA*
Ga0066679_1029816123300005176SoilVWVILRWFIPNALELAAANAHDRYPDFIMKLRITFHLQRVA*
Ga0066688_1077251123300005178SoilVWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRVA*
Ga0066684_1083478613300005179SoilDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA*
Ga0070710_1080775623300005437Corn, Switchgrass And Miscanthus RhizosphereVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0070710_1143119213300005437Corn, Switchgrass And Miscanthus RhizosphereEVDVWVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQYAA*
Ga0066689_1082536613300005447SoilRAIGADDLTGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA*
Ga0066695_1036855313300005553SoilEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA*
Ga0066695_1059504423300005553SoilLEVDVWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0066694_1033888013300005574SoilTGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA*
Ga0070762_1126489223300005602SoilSPNALKLAAANADDRHSDFIVKLRITLHLRQFNLTQ*
Ga0070766_1090142823300005921SoilDVWVILRRFIPNALELAAANAHDRHPDFIMKFRITFHLQRAA*
Ga0070717_1119689813300006028Corn, Switchgrass And Miscanthus RhizosphereHIEIDVRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDV*
Ga0075026_10079872313300006057WatershedsLASPVEVDVWVIFRRHSPNALKLAAANADDRHPDFIVKLRITLHLQ
Ga0075017_10068369423300006059WatershedsVWVIFRRHSPNALKLAAANADDRHPDFIVKLRITLHLQRAV*
Ga0075021_1092241713300006354WatershedsVLRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0066658_1021682833300006794SoilRFIPNALELAAANAHDRHPDFIMKLRITFHLLRAA*
Ga0075520_113519623300006795Arctic Peat SoilDDLTGIAYLEVDVWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0075419_1057139123300006969Populus RhizosphereMWVILRRLSPNALELTAATAHDRHPDFIMKLRITFHLQR
Ga0075435_10008858913300007076Populus RhizosphereMWVILRRLVPNALELTAANAHDRHPDFIMKLRITFHL
Ga0099793_1061092823300007258Vadose Zone SoilRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0099794_1048043123300007265Vadose Zone SoilAYLEVDVWVILRRFIPNALELAAANAHDRHPDFIMKLRIPFHLQRAA*
Ga0099795_1003035233300007788Vadose Zone SoilMGAEDLTGIAHIEIDVRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRAA*
Ga0099829_1126190223300009038Vadose Zone SoilWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA*
Ga0066709_10288725823300009137Grasslands SoilDVWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRVA*
Ga0105248_1115649713300009177Switchgrass RhizosphereIAHIEVDVWVILRWLIPNALELTAANSHDRHPDFIMKLRITFHLQPPA*
Ga0105248_1132312423300009177Switchgrass RhizosphereGADNLTGIAYLEVDVWVILRRFIPNALELAAANAHDRHPDFIKKRRITFHLQRAA*
Ga0116221_132960113300009523Peatlands SoilLRRLSPNAFKLAAADADDRHPNFIVKLRIILHLQRAG*
Ga0116102_115711023300009632PeatlandVWVILRRLSPNALKLAAANADDRHPNFIVKLRITLHHNGARH
Ga0116112_101959043300009636PeatlandVWVIFRRPSPNAFKLAAANADDRHPNFIVKLRITLHHNGARHSLAK
Ga0116121_122733323300009644PeatlandRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA*
Ga0116215_154821113300009672Peatlands SoilIGANDLTRIAHMEVNVWVILRRFIANALELATANAHDRRPNFIMKLRIIFHLQLVA*
Ga0116224_1061508923300009683Peatlands SoilRRYSPNALELAAANADDRHSDFIVKLRITLHLQQFNLTH*
Ga0116130_119229823300009762PeatlandVAHIEVDVWVILRRLSPNALKFAAANADDRHPDFIVKLWITLHQQRAA*
Ga0116223_1085932923300009839Peatlands SoilDVRVILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA*
Ga0127483_127801923300010142Grasslands SoilGIAYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA*
Ga0134064_1006419133300010325Grasslands SoilFIPNALELAAANAHDRHPDFIMKLRITFHLLRAA*
Ga0134063_1024798713300010335Grasslands SoilGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA*
Ga0074046_1026808713300010339Bog Forest SoilHIEVDVWVILRRFVPNALELAAADAHDRHPDLIMKLRITFHLQLAAWPPDR*
Ga0074044_1095774823300010343Bog Forest SoilGIAHIEVDVWVILRRHSPNALEITAANADDRHPNFIVKLRINLHLQQFNQ*
Ga0126381_10506696513300010376Tropical Forest SoilVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA*
Ga0126383_1107038313300010398Tropical Forest SoilGIAHIEVDVWVILRWSIPNALELAAANAHDRHPDFIMKLRTTFHLQRAA*
Ga0138505_10000065313300010999SoilVDVWVILRRFIPNALELAAANAHDRDPDFIMKLRVTFHLQRAAYAPER*
Ga0138513_10006340813300011000SoilVWVILRRLIPNALELAAANPHDRYPDFIMKLRIAFHLQRAA*
Ga0137389_1062647013300012096Vadose Zone SoilVWVILRRFIPNALELAAANAHDRHPDFIMKLQSAA*
Ga0137388_1174112023300012189Vadose Zone SoilVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA*
Ga0137384_1069683923300012357Vadose Zone SoilVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA*
Ga0137360_1148436823300012361Vadose Zone SoilVRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDV*
Ga0137390_1099377313300012363Vadose Zone SoilLTGSADLEVDVWVILRRFIPNALELAAANAHDRHPGFIMKRWITFHLQRAA*
Ga0137373_1063673623300012532Vadose Zone SoilALELAAANAHDRHPDFIVKRWITFHLQRAAWAPDQ*
Ga0137394_1053876513300012922Vadose Zone SoilQGSPAYLEVDVWVILRWFIPNALELAAANAHERHPDFIMKLRITFHLQRAA*
Ga0137359_1009770313300012923Vadose Zone SoilAVSNALELAAAYAHDRHPDFIMKLRITFHLQRVLRRPIVDV*
Ga0137413_1096253013300012924Vadose Zone SoilDLTGIAYLEVDVWVILRRFIPNALELVAANAHHRHPDFIMKLWITFHLQRAA*
Ga0137404_1216211823300012929Vadose Zone SoilGIADLEVDVWVILRWFIPNALELAAANANDRHPDFIMELRITFHLQRAA*
Ga0162652_10009236713300012941SoilVGHLAAVSPNTLELAAANAHDRHPDFIMKRRITFHL
Ga0164300_1117259113300012951SoilYSPNALKLAAANADDRHSDFIVKLRITLHLQQFNLTH*
Ga0164298_1092425913300012955SoilIGAADLTSIAHIEVDVWVILRRFIPNALELAAANAHDRDPDFIMKLRVTFHLQRAAYAPER*
Ga0164306_1077246023300012988SoilDMWVILRRLIPNALELTAANAHDRHPDFIMKLRISFHLQRAAQAR*
Ga0163162_1122920013300013306Switchgrass RhizosphereFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA*
Ga0163162_1151785623300013306Switchgrass RhizosphereGIAHLEVDVWVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA*
Ga0181521_1003422473300014158BogVILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA*
Ga0181530_1054246413300014159BogRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA*
Ga0163163_1290033513300014325Switchgrass RhizosphereVWVILRRFIPNALELAAANAHDRQPDFIMKRRISFHLQRAA*
Ga0187802_1040855613300017822Freshwater SedimentDLTGVPHIEVDVWVILRRLSPNALELAAATADDRRPNFIVKLRPQDE
Ga0187803_1003494913300017934Freshwater SedimentGVAHLEVDVWVLLRRLSPNALELAAATADDRHPNFIVKLRPQDE
Ga0187819_1087116023300017943Freshwater SedimentVWVILRRLSPNALKLAAANADDRHPNFIVKLRITLHL
Ga0187767_1002606313300017999Tropical PeatlandHCSEIEVDVWVILRRLSPNALKLAAANADDRYPNFIVKLR
Ga0187804_1012279813300018006Freshwater SedimentMEVDVWVILRRFIANALELATANAHDRRPDFIMKLRIL
Ga0184605_1039191413300018027Groundwater SedimentVWVILRRLIPNALELAAANAHDRHPNFIMKLRIAFHLQRAA
Ga0184608_1024029923300018028Groundwater SedimentILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0187858_1076892513300018057PeatlandRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA
Ga0184629_1037595323300018084Groundwater SedimentADDLTGIAYLEIDVWVILRRFIPNALELAAANAHDWHPDFIMKRRITFHLQRAA
Ga0066655_1038188333300018431Grasslands SoilRRAIGADDLTGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA
Ga0190274_1384953113300018476SoilAYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA
Ga0210389_1117443313300021404SoilRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA
Ga0210402_1122458613300021478SoilYSPNALKLAAANADDRHSDFIVKLRITLHLQQFNLTH
Ga0209171_1038108713300025320Iron-Sulfur Acid SpringADDSTRIAHIEVDVWVILRRHSPNALKLAAANADDRHSDFIVKLRITLHLQQFDLTH
Ga0207692_1093760323300025898Corn, Switchgrass And Miscanthus RhizosphereMDHLEVDVWVILRRFIPDALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0209240_116784313300026304Grasslands SoilVGDLAVFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0209801_119839713300026326SoilDLTGIAYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA
Ga0209375_130129113300026329SoilVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA
Ga0257171_104807023300026377SoilVWVILRWFIPNALELATANAHDRHPDFIMKLRITFHLQRAA
Ga0257181_103906113300026499SoilLRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA
Ga0209588_107398723300027671Vadose Zone SoilVWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA
Ga0209446_108481013300027698Bog Forest SoilVWVILRRQSPNALKLAAANADDRHADFIVKLRITLHLPAIQSDL
Ga0209139_1015648023300027795Bog Forest SoilVDVWVILRRFIPNALELAAANAHDRRPDFIMKLRINFHLQLAA
Ga0209283_1042604013300027875Vadose Zone SoilLRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA
Ga0209069_1058005513300027915WatershedsVILRWFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0137415_1022080943300028536Vadose Zone SoilEVDVWVILRRFIPNALELAAANAHDRDPDFIMKLRITFHLQRAG
Ga0302231_1031894313300028775PalsaWVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ
Ga0302225_1000714213300028780PalsaDVTGIAHVEVNVWVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ
Ga0302226_1043070423300028801PalsaVWVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ
Ga0307302_1042145813300028814SoilRFIPNTLELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0246001_103373923300029889PeatVLPSSDRKIGADDLTDVAHIEVDVRVILRRLSPNALELAAADADDRHPNFIVKLRITLHLQRAA
Ga0316363_1031650813300030659Peatlands SoilVRVILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA
Ga0308152_10272223300030831SoilDDLTGIAHIEVDVWMILRRFVPNALELAAANAHDRHPDSIMKLRITFHLQHAA
Ga0075386_1000596523300030916SoilMWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHL
Ga0308178_112825213300030990SoilIAHIEVDVWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHLQRPA
Ga0308151_102790213300031124SoilRRFISNALKLAAANAHDRHPDFIMKLRITFHLQHAA
Ga0307498_1022040113300031170SoilRRFIPNARELAAANAHDRHPDFIMKRWITFHLQRAA
Ga0170820_1447965623300031446Forest SoilWVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0306917_1048378713300031719SoilSEVDMRVILRRLFPNAFKLAAANAHDRHANFIMKLRITFHLRRAA
Ga0307469_1137239313300031720Hardwood Forest SoilRWFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0318493_1049023413300031723SoilDVDMWVILRRLSPNALKLAAANADDWHPNFIVKLRIVLHPLRAT
Ga0318501_1046582413300031736SoilVDVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0307477_1054626213300031753Hardwood Forest SoilRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAV
Ga0318508_117062613300031780SoilVRVILRRPVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDVPSPSL
Ga0307478_1043785723300031823Hardwood Forest SoilSKRNCVEQMGADDLTGIADLEEDVWVVLRWFIPNALELAAANAHDRHPDFIMKLRIIFHLQRAA
Ga0310884_1046938013300031944SoilVDVWVILRRLIPNALELAAANPHDRYPDFIMKLRIAFHLQRAA
Ga0306922_1115101613300032001SoilLTGIAHFKVDVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAAQAPDR
Ga0318559_1037358723300032039SoilDVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA
Ga0318549_1035314613300032041SoilVWVILRRFIPNALELAAANAHDRHPDFIMKRWITFHLQ
Ga0310914_1081860113300033289SoilVGIAHIEVDVWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHLQRPA
Ga0334790_182823_482_6103300033887SoilDVWVILQRLSPNALKLAAANADDRHPNFIVKLRINLHLQRAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.