Basic Information | |
---|---|
Family ID | F078796 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 44 residues |
Representative Sequence | VWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 12.93 % |
% of genes near scaffold ends (potentially truncated) | 96.55 % |
% of genes from short scaffolds (< 2000 bps) | 94.83 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.655 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.655 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.379 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.517 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF04545 | Sigma70_r4 | 52.59 |
PF01070 | FMN_dh | 6.90 |
PF08241 | Methyltransf_11 | 2.59 |
PF00486 | Trans_reg_C | 0.86 |
PF01695 | IstB_IS21 | 0.86 |
PF00011 | HSP20 | 0.86 |
PF04392 | ABC_sub_bind | 0.86 |
PF11953 | DUF3470 | 0.86 |
PF01370 | Epimerase | 0.86 |
PF13237 | Fer4_10 | 0.86 |
PF02653 | BPD_transp_2 | 0.86 |
PF07592 | DDE_Tnp_ISAZ013 | 0.86 |
PF16576 | HlyD_D23 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 6.90 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 6.90 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.86 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.66 % |
Unclassified | root | N/A | 35.34 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004152|Ga0062386_101164036 | Not Available | 641 | Open in IMG/M |
3300004635|Ga0062388_102633916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300005172|Ga0066683_10760605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
3300005176|Ga0066679_10298161 | Not Available | 1047 | Open in IMG/M |
3300005178|Ga0066688_10772511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300005179|Ga0066684_10834786 | Not Available | 606 | Open in IMG/M |
3300005437|Ga0070710_10807756 | Not Available | 670 | Open in IMG/M |
3300005437|Ga0070710_11431192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
3300005447|Ga0066689_10825366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300005553|Ga0066695_10368553 | Not Available | 897 | Open in IMG/M |
3300005553|Ga0066695_10595044 | Not Available | 664 | Open in IMG/M |
3300005574|Ga0066694_10338880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
3300005602|Ga0070762_11264892 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005921|Ga0070766_10901428 | Not Available | 605 | Open in IMG/M |
3300006028|Ga0070717_11196898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
3300006057|Ga0075026_100798723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300006059|Ga0075017_100683694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
3300006354|Ga0075021_10922417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 567 | Open in IMG/M |
3300006794|Ga0066658_10216828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1017 | Open in IMG/M |
3300006795|Ga0075520_1135196 | Not Available | 1088 | Open in IMG/M |
3300006969|Ga0075419_10571391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
3300007076|Ga0075435_100088589 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
3300007258|Ga0099793_10610928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 547 | Open in IMG/M |
3300007265|Ga0099794_10480431 | Not Available | 653 | Open in IMG/M |
3300007788|Ga0099795_10030352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1855 | Open in IMG/M |
3300009038|Ga0099829_11261902 | Not Available | 611 | Open in IMG/M |
3300009137|Ga0066709_102887258 | Not Available | 634 | Open in IMG/M |
3300009177|Ga0105248_11156497 | Not Available | 875 | Open in IMG/M |
3300009177|Ga0105248_11323124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
3300009523|Ga0116221_1329601 | Not Available | 662 | Open in IMG/M |
3300009632|Ga0116102_1157110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
3300009636|Ga0116112_1019590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2327 | Open in IMG/M |
3300009644|Ga0116121_1227333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300009672|Ga0116215_1548211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 500 | Open in IMG/M |
3300009683|Ga0116224_10615089 | Not Available | 519 | Open in IMG/M |
3300009762|Ga0116130_1192298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300009839|Ga0116223_10859329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
3300010142|Ga0127483_1278019 | Not Available | 611 | Open in IMG/M |
3300010325|Ga0134064_10064191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1149 | Open in IMG/M |
3300010335|Ga0134063_10247987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
3300010339|Ga0074046_10268087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1056 | Open in IMG/M |
3300010343|Ga0074044_10957748 | Not Available | 560 | Open in IMG/M |
3300010376|Ga0126381_105066965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300010398|Ga0126383_11070383 | Not Available | 896 | Open in IMG/M |
3300010999|Ga0138505_100000653 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
3300011000|Ga0138513_100063408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
3300012096|Ga0137389_10626470 | Not Available | 924 | Open in IMG/M |
3300012189|Ga0137388_11741120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
3300012357|Ga0137384_10696839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
3300012361|Ga0137360_11484368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300012363|Ga0137390_10993773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 791 | Open in IMG/M |
3300012532|Ga0137373_10636736 | Not Available | 801 | Open in IMG/M |
3300012922|Ga0137394_10538765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 990 | Open in IMG/M |
3300012923|Ga0137359_10097703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2592 | Open in IMG/M |
3300012924|Ga0137413_10962530 | Not Available | 667 | Open in IMG/M |
3300012929|Ga0137404_12162118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300012941|Ga0162652_100092367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
3300012951|Ga0164300_11172591 | Not Available | 507 | Open in IMG/M |
3300012955|Ga0164298_10924259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
3300012988|Ga0164306_10772460 | Not Available | 771 | Open in IMG/M |
3300013306|Ga0163162_11229200 | Not Available | 850 | Open in IMG/M |
3300013306|Ga0163162_11517856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
3300014158|Ga0181521_10034224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3792 | Open in IMG/M |
3300014159|Ga0181530_10542464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300014325|Ga0163163_12900335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 535 | Open in IMG/M |
3300017822|Ga0187802_10408556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 538 | Open in IMG/M |
3300017934|Ga0187803_10034949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1996 | Open in IMG/M |
3300017943|Ga0187819_10871160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
3300017999|Ga0187767_10026063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1307 | Open in IMG/M |
3300018006|Ga0187804_10122798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
3300018027|Ga0184605_10391914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300018028|Ga0184608_10240299 | Not Available | 796 | Open in IMG/M |
3300018057|Ga0187858_10768925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300018084|Ga0184629_10375953 | Not Available | 747 | Open in IMG/M |
3300018431|Ga0066655_10381883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
3300018476|Ga0190274_13849531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
3300021404|Ga0210389_11174433 | Not Available | 591 | Open in IMG/M |
3300021478|Ga0210402_11224586 | Not Available | 678 | Open in IMG/M |
3300025320|Ga0209171_10381087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
3300025898|Ga0207692_10937603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
3300026304|Ga0209240_1167843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
3300026326|Ga0209801_1198397 | Not Available | 806 | Open in IMG/M |
3300026329|Ga0209375_1301291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300026377|Ga0257171_1048070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
3300026499|Ga0257181_1039061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300027671|Ga0209588_1073987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1101 | Open in IMG/M |
3300027698|Ga0209446_1084810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
3300027795|Ga0209139_10156480 | Not Available | 806 | Open in IMG/M |
3300027875|Ga0209283_10426040 | Not Available | 862 | Open in IMG/M |
3300027915|Ga0209069_10580055 | Not Available | 643 | Open in IMG/M |
3300028536|Ga0137415_10220809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1709 | Open in IMG/M |
3300028775|Ga0302231_10318943 | Not Available | 652 | Open in IMG/M |
3300028780|Ga0302225_10007142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6063 | Open in IMG/M |
3300028801|Ga0302226_10430704 | Not Available | 551 | Open in IMG/M |
3300028814|Ga0307302_10421458 | Not Available | 660 | Open in IMG/M |
3300029889|Ga0246001_1033739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
3300030659|Ga0316363_10316508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300030831|Ga0308152_102722 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300030916|Ga0075386_10005965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
3300030990|Ga0308178_1128252 | Not Available | 565 | Open in IMG/M |
3300031124|Ga0308151_1027902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300031170|Ga0307498_10220401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300031446|Ga0170820_14479656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
3300031719|Ga0306917_10483787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
3300031720|Ga0307469_11372393 | Not Available | 673 | Open in IMG/M |
3300031723|Ga0318493_10490234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300031736|Ga0318501_10465824 | Not Available | 687 | Open in IMG/M |
3300031753|Ga0307477_10546262 | Not Available | 784 | Open in IMG/M |
3300031780|Ga0318508_1170626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
3300031823|Ga0307478_10437857 | Not Available | 1086 | Open in IMG/M |
3300031944|Ga0310884_10469380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
3300032001|Ga0306922_11151016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
3300032039|Ga0318559_10373587 | Not Available | 664 | Open in IMG/M |
3300032041|Ga0318549_10353146 | Not Available | 662 | Open in IMG/M |
3300033289|Ga0310914_10818601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300033887|Ga0334790_182823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.31% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.45% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.59% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 2.59% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062386_1011640362 | 3300004152 | Bog Forest Soil | VISIGIAHIEVNVGMILRRFISNALELAAASAHDRQPDFIMKLRIPFHLYRA |
Ga0062388_1026339161 | 3300004635 | Bog Forest Soil | DDLIGIAHIEVDVWVILRRQSANALQLAAANADDRHADFIVKLRITLPVQFNLTH* |
Ga0066683_107606052 | 3300005172 | Soil | DVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA* |
Ga0066679_102981612 | 3300005176 | Soil | VWVILRWFIPNALELAAANAHDRYPDFIMKLRITFHLQRVA* |
Ga0066688_107725112 | 3300005178 | Soil | VWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRVA* |
Ga0066684_108347861 | 3300005179 | Soil | DVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA* |
Ga0070710_108077562 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0070710_114311921 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EVDVWVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQYAA* |
Ga0066689_108253661 | 3300005447 | Soil | RAIGADDLTGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA* |
Ga0066695_103685531 | 3300005553 | Soil | EIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA* |
Ga0066695_105950442 | 3300005553 | Soil | LEVDVWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0066694_103388801 | 3300005574 | Soil | TGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA* |
Ga0070762_112648922 | 3300005602 | Soil | SPNALKLAAANADDRHSDFIVKLRITLHLRQFNLTQ* |
Ga0070766_109014282 | 3300005921 | Soil | DVWVILRRFIPNALELAAANAHDRHPDFIMKFRITFHLQRAA* |
Ga0070717_111968981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HIEIDVRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDV* |
Ga0075026_1007987231 | 3300006057 | Watersheds | LASPVEVDVWVIFRRHSPNALKLAAANADDRHPDFIVKLRITLHLQ |
Ga0075017_1006836942 | 3300006059 | Watersheds | VWVIFRRHSPNALKLAAANADDRHPDFIVKLRITLHLQRAV* |
Ga0075021_109224171 | 3300006354 | Watersheds | VLRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0066658_102168283 | 3300006794 | Soil | RFIPNALELAAANAHDRHPDFIMKLRITFHLLRAA* |
Ga0075520_11351962 | 3300006795 | Arctic Peat Soil | DDLTGIAYLEVDVWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0075419_105713912 | 3300006969 | Populus Rhizosphere | MWVILRRLSPNALELTAATAHDRHPDFIMKLRITFHLQR |
Ga0075435_1000885891 | 3300007076 | Populus Rhizosphere | MWVILRRLVPNALELTAANAHDRHPDFIMKLRITFHL |
Ga0099793_106109282 | 3300007258 | Vadose Zone Soil | RWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0099794_104804312 | 3300007265 | Vadose Zone Soil | AYLEVDVWVILRRFIPNALELAAANAHDRHPDFIMKLRIPFHLQRAA* |
Ga0099795_100303523 | 3300007788 | Vadose Zone Soil | MGAEDLTGIAHIEIDVRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRAA* |
Ga0099829_112619022 | 3300009038 | Vadose Zone Soil | WVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA* |
Ga0066709_1028872582 | 3300009137 | Grasslands Soil | DVWVILRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRVA* |
Ga0105248_111564971 | 3300009177 | Switchgrass Rhizosphere | IAHIEVDVWVILRWLIPNALELTAANSHDRHPDFIMKLRITFHLQPPA* |
Ga0105248_113231242 | 3300009177 | Switchgrass Rhizosphere | GADNLTGIAYLEVDVWVILRRFIPNALELAAANAHDRHPDFIKKRRITFHLQRAA* |
Ga0116221_13296011 | 3300009523 | Peatlands Soil | LRRLSPNAFKLAAADADDRHPNFIVKLRIILHLQRAG* |
Ga0116102_11571102 | 3300009632 | Peatland | VWVILRRLSPNALKLAAANADDRHPNFIVKLRITLHHNGARH |
Ga0116112_10195904 | 3300009636 | Peatland | VWVIFRRPSPNAFKLAAANADDRHPNFIVKLRITLHHNGARHSLAK |
Ga0116121_12273332 | 3300009644 | Peatland | RRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA* |
Ga0116215_15482111 | 3300009672 | Peatlands Soil | IGANDLTRIAHMEVNVWVILRRFIANALELATANAHDRRPNFIMKLRIIFHLQLVA* |
Ga0116224_106150892 | 3300009683 | Peatlands Soil | RRYSPNALELAAANADDRHSDFIVKLRITLHLQQFNLTH* |
Ga0116130_11922982 | 3300009762 | Peatland | VAHIEVDVWVILRRLSPNALKFAAANADDRHPDFIVKLWITLHQQRAA* |
Ga0116223_108593292 | 3300009839 | Peatlands Soil | DVRVILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA* |
Ga0127483_12780192 | 3300010142 | Grasslands Soil | GIAYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA* |
Ga0134064_100641913 | 3300010325 | Grasslands Soil | FIPNALELAAANAHDRHPDFIMKLRITFHLLRAA* |
Ga0134063_102479871 | 3300010335 | Grasslands Soil | GIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA* |
Ga0074046_102680871 | 3300010339 | Bog Forest Soil | HIEVDVWVILRRFVPNALELAAADAHDRHPDLIMKLRITFHLQLAAWPPDR* |
Ga0074044_109577482 | 3300010343 | Bog Forest Soil | GIAHIEVDVWVILRRHSPNALEITAANADDRHPNFIVKLRINLHLQQFNQ* |
Ga0126381_1050669651 | 3300010376 | Tropical Forest Soil | VGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA* |
Ga0126383_110703831 | 3300010398 | Tropical Forest Soil | GIAHIEVDVWVILRWSIPNALELAAANAHDRHPDFIMKLRTTFHLQRAA* |
Ga0138505_1000006531 | 3300010999 | Soil | VDVWVILRRFIPNALELAAANAHDRDPDFIMKLRVTFHLQRAAYAPER* |
Ga0138513_1000634081 | 3300011000 | Soil | VWVILRRLIPNALELAAANPHDRYPDFIMKLRIAFHLQRAA* |
Ga0137389_106264701 | 3300012096 | Vadose Zone Soil | VWVILRRFIPNALELAAANAHDRHPDFIMKLQSAA* |
Ga0137388_117411202 | 3300012189 | Vadose Zone Soil | VWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA* |
Ga0137384_106968392 | 3300012357 | Vadose Zone Soil | VWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA* |
Ga0137360_114843682 | 3300012361 | Vadose Zone Soil | VRVILRRLVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDV* |
Ga0137390_109937731 | 3300012363 | Vadose Zone Soil | LTGSADLEVDVWVILRRFIPNALELAAANAHDRHPGFIMKRWITFHLQRAA* |
Ga0137373_106367362 | 3300012532 | Vadose Zone Soil | ALELAAANAHDRHPDFIVKRWITFHLQRAAWAPDQ* |
Ga0137394_105387651 | 3300012922 | Vadose Zone Soil | QGSPAYLEVDVWVILRWFIPNALELAAANAHERHPDFIMKLRITFHLQRAA* |
Ga0137359_100977031 | 3300012923 | Vadose Zone Soil | AVSNALELAAAYAHDRHPDFIMKLRITFHLQRVLRRPIVDV* |
Ga0137413_109625301 | 3300012924 | Vadose Zone Soil | DLTGIAYLEVDVWVILRRFIPNALELVAANAHHRHPDFIMKLWITFHLQRAA* |
Ga0137404_121621182 | 3300012929 | Vadose Zone Soil | GIADLEVDVWVILRWFIPNALELAAANANDRHPDFIMELRITFHLQRAA* |
Ga0162652_1000923671 | 3300012941 | Soil | VGHLAAVSPNTLELAAANAHDRHPDFIMKRRITFHL |
Ga0164300_111725911 | 3300012951 | Soil | YSPNALKLAAANADDRHSDFIVKLRITLHLQQFNLTH* |
Ga0164298_109242591 | 3300012955 | Soil | IGAADLTSIAHIEVDVWVILRRFIPNALELAAANAHDRDPDFIMKLRVTFHLQRAAYAPER* |
Ga0164306_107724602 | 3300012988 | Soil | DMWVILRRLIPNALELTAANAHDRHPDFIMKLRISFHLQRAAQAR* |
Ga0163162_112292001 | 3300013306 | Switchgrass Rhizosphere | FIPNALELAAANAHDRHPDFIMKRRITFHLQRAA* |
Ga0163162_115178562 | 3300013306 | Switchgrass Rhizosphere | GIAHLEVDVWVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA* |
Ga0181521_100342247 | 3300014158 | Bog | VILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA* |
Ga0181530_105424641 | 3300014159 | Bog | RLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA* |
Ga0163163_129003351 | 3300014325 | Switchgrass Rhizosphere | VWVILRRFIPNALELAAANAHDRQPDFIMKRRISFHLQRAA* |
Ga0187802_104085561 | 3300017822 | Freshwater Sediment | DLTGVPHIEVDVWVILRRLSPNALELAAATADDRRPNFIVKLRPQDE |
Ga0187803_100349491 | 3300017934 | Freshwater Sediment | GVAHLEVDVWVLLRRLSPNALELAAATADDRHPNFIVKLRPQDE |
Ga0187819_108711602 | 3300017943 | Freshwater Sediment | VWVILRRLSPNALKLAAANADDRHPNFIVKLRITLHL |
Ga0187767_100260631 | 3300017999 | Tropical Peatland | HCSEIEVDVWVILRRLSPNALKLAAANADDRYPNFIVKLR |
Ga0187804_101227981 | 3300018006 | Freshwater Sediment | MEVDVWVILRRFIANALELATANAHDRRPDFIMKLRIL |
Ga0184605_103919141 | 3300018027 | Groundwater Sediment | VWVILRRLIPNALELAAANAHDRHPNFIMKLRIAFHLQRAA |
Ga0184608_102402992 | 3300018028 | Groundwater Sediment | ILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0187858_107689251 | 3300018057 | Peatland | RLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA |
Ga0184629_103759532 | 3300018084 | Groundwater Sediment | ADDLTGIAYLEIDVWVILRRFIPNALELAAANAHDWHPDFIMKRRITFHLQRAA |
Ga0066655_103818833 | 3300018431 | Grasslands Soil | RRAIGADDLTGIAHIEVDVWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA |
Ga0190274_138495311 | 3300018476 | Soil | AYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA |
Ga0210389_111744331 | 3300021404 | Soil | RWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA |
Ga0210402_112245861 | 3300021478 | Soil | YSPNALKLAAANADDRHSDFIVKLRITLHLQQFNLTH |
Ga0209171_103810871 | 3300025320 | Iron-Sulfur Acid Spring | ADDSTRIAHIEVDVWVILRRHSPNALKLAAANADDRHSDFIVKLRITLHLQQFDLTH |
Ga0207692_109376032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHLEVDVWVILRRFIPDALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0209240_11678431 | 3300026304 | Grasslands Soil | VGDLAVFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0209801_11983971 | 3300026326 | Soil | DLTGIAYLEIDVWVILRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRTA |
Ga0209375_13012911 | 3300026329 | Soil | VWVILRRLIPNALELAAANAHDRHPDFIMKLRVTFHLQRAA |
Ga0257171_10480702 | 3300026377 | Soil | VWVILRWFIPNALELATANAHDRHPDFIMKLRITFHLQRAA |
Ga0257181_10390611 | 3300026499 | Soil | LRWFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA |
Ga0209588_10739872 | 3300027671 | Vadose Zone Soil | VWVILRRFIPNALELAAANAHDRHPDFIMKLRITFHLQRAA |
Ga0209446_10848101 | 3300027698 | Bog Forest Soil | VWVILRRQSPNALKLAAANADDRHADFIVKLRITLHLPAIQSDL |
Ga0209139_101564802 | 3300027795 | Bog Forest Soil | VDVWVILRRFIPNALELAAANAHDRRPDFIMKLRINFHLQLAA |
Ga0209283_104260401 | 3300027875 | Vadose Zone Soil | LRRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAA |
Ga0209069_105800551 | 3300027915 | Watersheds | VILRWFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0137415_102208094 | 3300028536 | Vadose Zone Soil | EVDVWVILRRFIPNALELAAANAHDRDPDFIMKLRITFHLQRAG |
Ga0302231_103189431 | 3300028775 | Palsa | WVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ |
Ga0302225_100071421 | 3300028780 | Palsa | DVTGIAHVEVNVWVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ |
Ga0302226_104307042 | 3300028801 | Palsa | VWVILRRHSPNALELAAANADDRHPNFIVKLRITLHLQQFNQ |
Ga0307302_104214581 | 3300028814 | Soil | RFIPNTLELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0246001_10337392 | 3300029889 | Peat | VLPSSDRKIGADDLTDVAHIEVDVRVILRRLSPNALELAAADADDRHPNFIVKLRITLHLQRAA |
Ga0316363_103165081 | 3300030659 | Peatlands Soil | VRVILRRLSPNALKLAAANADDRHPNFIVKLRITLHLQRAA |
Ga0308152_1027222 | 3300030831 | Soil | DDLTGIAHIEVDVWMILRRFVPNALELAAANAHDRHPDSIMKLRITFHLQHAA |
Ga0075386_100059652 | 3300030916 | Soil | MWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHL |
Ga0308178_11282521 | 3300030990 | Soil | IAHIEVDVWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHLQRPA |
Ga0308151_10279021 | 3300031124 | Soil | RRFISNALKLAAANAHDRHPDFIMKLRITFHLQHAA |
Ga0307498_102204011 | 3300031170 | Soil | RRFIPNARELAAANAHDRHPDFIMKRWITFHLQRAA |
Ga0170820_144796562 | 3300031446 | Forest Soil | WVILRRFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0306917_104837871 | 3300031719 | Soil | SEVDMRVILRRLFPNAFKLAAANAHDRHANFIMKLRITFHLRRAA |
Ga0307469_113723931 | 3300031720 | Hardwood Forest Soil | RWFIPNALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0318493_104902341 | 3300031723 | Soil | DVDMWVILRRLSPNALKLAAANADDWHPNFIVKLRIVLHPLRAT |
Ga0318501_104658241 | 3300031736 | Soil | VDVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0307477_105462621 | 3300031753 | Hardwood Forest Soil | RRFIPNALELAAANAHDRHPDFIMKLWITFHLQRAV |
Ga0318508_11706261 | 3300031780 | Soil | VRVILRRPVSNALELAAAYAHDRHPDFIMKLRITFHLQRALRRPIVDVPSPSL |
Ga0307478_104378572 | 3300031823 | Hardwood Forest Soil | SKRNCVEQMGADDLTGIADLEEDVWVVLRWFIPNALELAAANAHDRHPDFIMKLRIIFHLQRAA |
Ga0310884_104693801 | 3300031944 | Soil | VDVWVILRRLIPNALELAAANPHDRYPDFIMKLRIAFHLQRAA |
Ga0306922_111510161 | 3300032001 | Soil | LTGIAHFKVDVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAAQAPDR |
Ga0318559_103735872 | 3300032039 | Soil | DVGVILWRLIPDALELAAANAHDRHPDFIMKRRITFHLQRAA |
Ga0318549_103531461 | 3300032041 | Soil | VWVILRRFIPNALELAAANAHDRHPDFIMKRWITFHLQ |
Ga0310914_108186011 | 3300033289 | Soil | VGIAHIEVDVWVILRRLIPNALELTAANSHDRHPDFIMKLRITFHLQRPA |
Ga0334790_182823_482_610 | 3300033887 | Soil | DVWVILQRLSPNALKLAAANADDRHPNFIVKLRINLHLQRAA |
⦗Top⦘ |