| Basic Information | |
|---|---|
| Family ID | F078781 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 48 residues |
| Representative Sequence | HVDMFLPVWEEFGKGENEKMILQAARESEELYRVYQAGIADAMERLS |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.45 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 83.62 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.517 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.241 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.33% β-sheet: 0.00% Coil/Unstructured: 46.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 42.24 |
| PF13379 | NMT1_2 | 8.62 |
| PF14518 | Haem_oxygenas_2 | 8.62 |
| PF03070 | TENA_THI-4 | 4.31 |
| PF02371 | Transposase_20 | 2.59 |
| PF01977 | UbiD | 1.72 |
| PF13343 | SBP_bac_6 | 1.72 |
| PF13807 | GNVR | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF13683 | rve_3 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 42.24 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 42.24 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.59 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.52 % |
| Unclassified | root | N/A | 9.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0912149 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1087741 | Not Available | 546 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10011228 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300000890|JGI11643J12802_11916724 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300000955|JGI1027J12803_100364416 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300003998|Ga0055472_10193467 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300004156|Ga0062589_102134745 | Not Available | 572 | Open in IMG/M |
| 3300004463|Ga0063356_102313930 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300004463|Ga0063356_104317232 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004463|Ga0063356_104734591 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005180|Ga0066685_10170219 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300005290|Ga0065712_10466361 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005295|Ga0065707_10601059 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005354|Ga0070675_101998495 | Not Available | 535 | Open in IMG/M |
| 3300005446|Ga0066686_10944048 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005447|Ga0066689_11036265 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005457|Ga0070662_100973935 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005536|Ga0070697_101695565 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005545|Ga0070695_100460682 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005561|Ga0066699_10176271 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005563|Ga0068855_101306959 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006049|Ga0075417_10259704 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006358|Ga0068871_100116696 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
| 3300006755|Ga0079222_10060226 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300006844|Ga0075428_100977670 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006845|Ga0075421_100697399 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300006845|Ga0075421_101140122 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006845|Ga0075421_101871017 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006852|Ga0075433_10050895 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
| 3300006852|Ga0075433_11586958 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006954|Ga0079219_10006276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3670 | Open in IMG/M |
| 3300007255|Ga0099791_10453265 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009094|Ga0111539_11949668 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009100|Ga0075418_11182402 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009100|Ga0075418_11591262 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009100|Ga0075418_11951358 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300009137|Ga0066709_102459910 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009147|Ga0114129_10875700 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300009147|Ga0114129_12339885 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009156|Ga0111538_12229092 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009162|Ga0075423_10748322 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300009162|Ga0075423_11356452 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300009816|Ga0105076_1005052 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300009816|Ga0105076_1057849 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010043|Ga0126380_12257407 | Not Available | 504 | Open in IMG/M |
| 3300010046|Ga0126384_10079043 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300010046|Ga0126384_12237788 | Not Available | 527 | Open in IMG/M |
| 3300010333|Ga0134080_10388027 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010335|Ga0134063_10083050 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300010360|Ga0126372_10976678 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010360|Ga0126372_11989981 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010362|Ga0126377_13248829 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010366|Ga0126379_11955138 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010373|Ga0134128_10087548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3549 | Open in IMG/M |
| 3300010373|Ga0134128_12567630 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010399|Ga0134127_12169492 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010400|Ga0134122_11865552 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010400|Ga0134122_12983301 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010403|Ga0134123_11004440 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300011432|Ga0137428_1042673 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300011435|Ga0137426_1029171 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300011437|Ga0137429_1030030 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300011439|Ga0137432_1154325 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012174|Ga0137338_1137408 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012201|Ga0137365_10459293 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012212|Ga0150985_117283363 | Not Available | 520 | Open in IMG/M |
| 3300012285|Ga0137370_10010449 | All Organisms → cellular organisms → Bacteria | 4412 | Open in IMG/M |
| 3300012351|Ga0137386_10086011 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300012353|Ga0137367_10126260 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300012354|Ga0137366_10313466 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300012355|Ga0137369_10556340 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012480|Ga0157346_1021518 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012582|Ga0137358_10043639 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300012944|Ga0137410_10153355 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300012958|Ga0164299_10020903 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
| 3300012972|Ga0134077_10034799 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300013104|Ga0157370_11024223 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300014271|Ga0075326_1019624 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300014873|Ga0180066_1101911 | Not Available | 591 | Open in IMG/M |
| 3300015262|Ga0182007_10310277 | Not Available | 582 | Open in IMG/M |
| 3300015372|Ga0132256_100540079 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300015374|Ga0132255_100844428 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300015374|Ga0132255_102077216 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300017927|Ga0187824_10375704 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017966|Ga0187776_10367699 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300018029|Ga0187787_10024224 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300018054|Ga0184621_10197677 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018056|Ga0184623_10385218 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018067|Ga0184611_1007776 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300018075|Ga0184632_10232980 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018081|Ga0184625_10034966 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
| 3300018081|Ga0184625_10539968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300018089|Ga0187774_10081754 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300018422|Ga0190265_11127276 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300018431|Ga0066655_11098403 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018476|Ga0190274_10516097 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300019880|Ga0193712_1094732 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300019886|Ga0193727_1039903 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300020197|Ga0194128_10239592 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300021081|Ga0210379_10032422 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300025899|Ga0207642_10498320 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300025919|Ga0207657_10773723 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026332|Ga0209803_1009731 | All Organisms → cellular organisms → Bacteria | 5162 | Open in IMG/M |
| 3300026537|Ga0209157_1036359 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300027637|Ga0209818_1221988 | Not Available | 560 | Open in IMG/M |
| 3300027646|Ga0209466_1021654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300027787|Ga0209074_10545528 | Not Available | 510 | Open in IMG/M |
| 3300027907|Ga0207428_10976939 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027952|Ga0209889_1011050 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300028381|Ga0268264_10912524 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031720|Ga0307469_10905885 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031820|Ga0307473_11415336 | Not Available | 524 | Open in IMG/M |
| 3300031852|Ga0307410_10107662 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300031942|Ga0310916_10122056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2120 | Open in IMG/M |
| 3300032144|Ga0315910_10511340 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300034148|Ga0364927_0020916 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09121492 | 2228664021 | Soil | KGHVDMFLPVWEEFGKDENEKMILQAAKESEELYRVYQMGLADAMQGVGVKVSFANEMM |
| AF_2010_repII_A100DRAFT_10877412 | 3300000655 | Forest Soil | NEFGHGENEEVILQAARESEDLYKVYQSGIADAMLALS* |
| AF_2010_repII_A001DRAFT_100112281 | 3300000793 | Forest Soil | HVDMFLPVWDEFGHGENEEVILQAARESEDLYKVYQSGIADAMLALS* |
| JGI11643J12802_119167241 | 3300000890 | Soil | PNWKAHREADKGHVDMFLPVWEEYGKGENQRLILHAAKESEELYRVYQAGIADAMERMS* |
| JGI1027J12803_1003644161 | 3300000955 | Soil | VDMFLPVWNEFGHGENEEIILQAARESEDLYRVYQTGVADAMLALS* |
| Ga0055472_101934671 | 3300003998 | Natural And Restored Wetlands | LPVWEEFGDGESEKVILQAARESEELYRVYQAGLADAMEGLS* |
| Ga0062589_1021347451 | 3300004156 | Soil | VDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEAVV* |
| Ga0063356_1023139301 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WKAHREADKGHVDMFLPVWEEFGSGENRQMILQAAKESEELYRVYQKGLADAMQVLPD* |
| Ga0063356_1043172322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0063356_1047345911 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WKAHREADKGHVDMFLPVWDEFGSGENRKMILQAAKESEELYRLYQKGLADAMEAL* |
| Ga0066685_101702193 | 3300005180 | Soil | WKAHRAADKEHVDMFLSIWEEFGMGENEETILQAARESEELYRVYQTGIADAMEALS* |
| Ga0065712_104663612 | 3300005290 | Miscanthus Rhizosphere | GHVDMFLPVWEEFGKGDNEEMILEAAKESEELYRVYQAGLADAMERVS* |
| Ga0065707_106010591 | 3300005295 | Switchgrass Rhizosphere | EADKGHVDMFLPVWEEFGKGENEKLILQAAKESEELYRVYQAGLADAMEAVE* |
| Ga0070675_1019984952 | 3300005354 | Miscanthus Rhizosphere | ADRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0066686_109440481 | 3300005446 | Soil | DMFLPVWEEFGRGENERMILQAARESEELYRVYQAGIADAMEKVG* |
| Ga0066689_110362651 | 3300005447 | Soil | WEEFGMDENEEIILQAARESEELYRVYQTGIADAMEALS* |
| Ga0070662_1009739351 | 3300005457 | Corn Rhizosphere | PNWKAHREADRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0070697_1016955651 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVWDEFGRGENEEIILQAARESEELYRVYQTGIADAMEALS* |
| Ga0070695_1004606822 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VWEEYGKDEKEKMILQAAQESEELYRVYQAGLADAMEQLP* |
| Ga0066699_101762711 | 3300005561 | Soil | KAHRAADREHVDMFLSIWEEFGMGENEEIILQAARESEELYRVYQTGIADAVAALS* |
| Ga0068855_1013069592 | 3300005563 | Corn Rhizosphere | HREADRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0075417_102597042 | 3300006049 | Populus Rhizosphere | EFGHAENEKIILDAAKESEELYRVYQAGIADAMEQIS* |
| Ga0068871_1001166964 | 3300006358 | Miscanthus Rhizosphere | KAHREADRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEAVV* |
| Ga0079222_100602261 | 3300006755 | Agricultural Soil | READKGHVDMFLPVWEEFGKGDNEEMILEAAKESEELYRVYQAGLADAMERMA* |
| Ga0075428_1009776702 | 3300006844 | Populus Rhizosphere | HVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGVADAMEALT* |
| Ga0075421_1006973992 | 3300006845 | Populus Rhizosphere | DKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGVADAMEALT* |
| Ga0075421_1011401222 | 3300006845 | Populus Rhizosphere | DKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGIADAMEQIS* |
| Ga0075421_1018710172 | 3300006845 | Populus Rhizosphere | FLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0075433_100508951 | 3300006852 | Populus Rhizosphere | HVDMFLPVWEEFGKGENEKMILQAARESEELYRVYQAGIADAMERLS* |
| Ga0075433_115869581 | 3300006852 | Populus Rhizosphere | KEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGVADAMEALT* |
| Ga0079219_100062761 | 3300006954 | Agricultural Soil | KGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0099791_104532652 | 3300007255 | Vadose Zone Soil | HREADKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0111539_119496681 | 3300009094 | Populus Rhizosphere | HREADKGHVDMFLPVWEEFGSGENREMILQAAKESEELYRLYQKGLADAMQALPD* |
| Ga0075418_111824022 | 3300009100 | Populus Rhizosphere | ADKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGIADAMEQIS* |
| Ga0075418_115912622 | 3300009100 | Populus Rhizosphere | ADKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGVADAMEALT* |
| Ga0075418_119513582 | 3300009100 | Populus Rhizosphere | PVWEEFGKGENEKMILHAAKESEELYRVYQAGLADAMERMT* |
| Ga0066709_1024599102 | 3300009137 | Grasslands Soil | NWKAHRAADKEHVDMFLPVWNEFGHGENEEVILQAARESEDLYKVYQTGIAEAMLALS* |
| Ga0114129_108757001 | 3300009147 | Populus Rhizosphere | DMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0114129_123398852 | 3300009147 | Populus Rhizosphere | RAHREADKGHVDMFLPVWEEFGKGENERMILQAARESEELYRVYQTGIADAMEKAG* |
| Ga0111538_122290922 | 3300009156 | Populus Rhizosphere | DMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGIADAMEAIS* |
| Ga0075423_107483222 | 3300009162 | Populus Rhizosphere | RAADKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGIADAMEAIS* |
| Ga0075423_113564522 | 3300009162 | Populus Rhizosphere | RAADKEHVDMFLPIWEEFGHAENEKIILDAAKESEELYRVYQAGVADAMEALT* |
| Ga0105076_10050521 | 3300009816 | Groundwater Sand | IWEEFGHGENEKIILQAARESEELYRVYQTGIADAMEALT* |
| Ga0105076_10578492 | 3300009816 | Groundwater Sand | ADKEHVDMFLPIWTEFGQGENEEIILQAARESEELYRVYQTGIADAMEALS* |
| Ga0126380_122574071 | 3300010043 | Tropical Forest Soil | WEEFGHGENEEIILQAAKESEELYRVYQTGIADAMEALS* |
| Ga0126384_100790434 | 3300010046 | Tropical Forest Soil | AADKEHVDMFLSIWEEFGQGENEEIILQAAKESEELYRVYQTGIADAMEALS* |
| Ga0126384_122377882 | 3300010046 | Tropical Forest Soil | FLSIWEEFGQGENEEIILQAAKESEELYRVYQTGIADAMEALS* |
| Ga0134080_103880272 | 3300010333 | Grasslands Soil | FLSIWEEFGMGENEEIILQAARESEELYRVYQTGIADGMEALS* |
| Ga0134063_100830501 | 3300010335 | Grasslands Soil | IWEEFGMGENEEIILQAARESEELYRVYQTGIADGMEALS* |
| Ga0126372_109766781 | 3300010360 | Tropical Forest Soil | VWNEFGHGESEEMILQAAKESEDLYKVYQTGIADAMLALS* |
| Ga0126372_119899812 | 3300010360 | Tropical Forest Soil | VDMFLSVWEEFGHGENEEIILQAAKESEELYRVYQTGIADAMETLS* |
| Ga0126377_132488292 | 3300010362 | Tropical Forest Soil | HGENEKIILNAAKESEDLYRVYQTGIADAMETLS* |
| Ga0126379_119551382 | 3300010366 | Tropical Forest Soil | LEEFGHGGNEEIILQAAKESEELYRVYQTGIADAMETLS* |
| Ga0134128_100875485 | 3300010373 | Terrestrial Soil | MFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM* |
| Ga0134128_125676302 | 3300010373 | Terrestrial Soil | READKGHVDMFLPVWEEFSKGDNEEMILEAAKESEELYRVYQAGLADAMERVS* |
| Ga0134127_121694921 | 3300010399 | Terrestrial Soil | HVDMFLPVWEEYGKGEKEKMILQAARESEELYRVYQAGLAEAMERLG* |
| Ga0134122_118655522 | 3300010400 | Terrestrial Soil | VDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQVGLADAMERLV* |
| Ga0134122_129833012 | 3300010400 | Terrestrial Soil | RAHREADKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLFDLLA |
| Ga0134123_110044401 | 3300010403 | Terrestrial Soil | EADKGHVDMFLPVWEEFGKGENEEMILQAAKESEELYRVYQAGLADAMERVS* |
| Ga0137428_10426732 | 3300011432 | Soil | EYGKEDNQALILQAAKESEELYRMYQAGLADAMEKLP* |
| Ga0137426_10291711 | 3300011435 | Soil | VDMFLPVWEEYGKGENEQMILQAAKESEELYRVYQAGLADAMEQLR* |
| Ga0137429_10300301 | 3300011437 | Soil | VDMFLPVWEEYGKGENEKMILQAANESEELYRVYQAGLADAMAAVD* |
| Ga0137432_11543251 | 3300011439 | Soil | NWKAHRAADKEHVDMFLPIWEQFGNGENEAVILQAAKESEELYRVYQTGIAKAMEALR* |
| Ga0137338_11374081 | 3300012174 | Soil | KGHVDMFLPVWEEYGEEENLALILQAAKESEELYRMYQAGLADAMEQVP* |
| Ga0137365_104592932 | 3300012201 | Vadose Zone Soil | DKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0150985_1172833631 | 3300012212 | Avena Fatua Rhizosphere | MFLPVWNEFGHGENEKVILQAAKESEELYRVYQSGIADAMLKLN* |
| Ga0137370_100104495 | 3300012285 | Vadose Zone Soil | MFLSIWEEFGMGENEEIILQAARESEELYRVYQTGIADAMEALS* |
| Ga0137386_100860113 | 3300012351 | Vadose Zone Soil | EHVDMFLSIWEEFGMGENEEIILQAARESEELYRVYQTGIADAVAALS* |
| Ga0137367_101262603 | 3300012353 | Vadose Zone Soil | VDMFLSIWKEFGMGENEEIILQAARESEELYRVYQTGIADAMEALS* |
| Ga0137366_103134662 | 3300012354 | Vadose Zone Soil | FLSIWEEFGMDENEEIILQAARESEELYRVYQTGIADGMEALS* |
| Ga0137369_105563402 | 3300012355 | Vadose Zone Soil | KAHRAADKEHVDMFLPIWEEFGHGENEAIILQAARESEELYRIYQSGIADAMEVLS* |
| Ga0157346_10215181 | 3300012480 | Arabidopsis Rhizosphere | HREADKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEGLV* |
| Ga0137358_100436391 | 3300012582 | Vadose Zone Soil | MFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0137410_101533551 | 3300012944 | Vadose Zone Soil | KGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0164299_100209031 | 3300012958 | Soil | LPVWEEFGKGENEEMILQAAKESEELYRVYQAGLADAMERVS* |
| Ga0134077_100347992 | 3300012972 | Grasslands Soil | SIWEEFGMDENEEIILQAARESEELYRVYQTGIADAVAALS* |
| Ga0157370_110242231 | 3300013104 | Corn Rhizosphere | GHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEAVV* |
| Ga0075326_10196241 | 3300014271 | Natural And Restored Wetlands | HVDMFLSIWEEFGVGDAEEIILQAAKESEDLYRLYQTGIAEAMEVLS* |
| Ga0180066_11019111 | 3300014873 | Soil | MFLPVWAEYGKGENEKMILQAAKESEELYRVYQAGIADAMDAMR* |
| Ga0182007_103102772 | 3300015262 | Rhizosphere | VWEEFGKGEDEKMILRAAKESDELYRVYQAGVADAMERMT* |
| Ga0132256_1005400793 | 3300015372 | Arabidopsis Rhizosphere | WKAHREADKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEGLV* |
| Ga0132255_1008444283 | 3300015374 | Arabidopsis Rhizosphere | KAHREADKGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLV* |
| Ga0132255_1020772162 | 3300015374 | Arabidopsis Rhizosphere | DKGHVDMFLPVWEEFGKGENEEMILQAAKESEELYRVYQAGLADAMERM* |
| Ga0187824_103757041 | 3300017927 | Freshwater Sediment | KGHVDMFLPVWEEFGKGENEKMILQAAKESEGLYRVYQAGLADAMERLS |
| Ga0187776_103676991 | 3300017966 | Tropical Peatland | FGHGENEKIILAAAGESEELYRVYQTGIADAMEAIL |
| Ga0187787_100242243 | 3300018029 | Tropical Peatland | WEEFGKGDNEKMILQAAKESEELYRVYQAGLADAMERLG |
| Ga0184621_101976771 | 3300018054 | Groundwater Sediment | HREADKGHVDMFLPVWEEFGQGENEKLILPAAKESEELYRVYQAGLADAMERLS |
| Ga0184623_103852181 | 3300018056 | Groundwater Sediment | GHVDMFLPVWEEYGKGENERLILQAAKESEELYRVYQAGLADAMERIS |
| Ga0184611_10077761 | 3300018067 | Groundwater Sediment | EEFGKGENEKMILQAAKESEELYRVYQAGLADAMEELV |
| Ga0184632_102329802 | 3300018075 | Groundwater Sediment | GKGENENLILQAAKESEELYRVYQAGLADAMERIS |
| Ga0184625_100349661 | 3300018081 | Groundwater Sediment | EFGHGENEKIILDSAKESEELYRVYQTGIADAMEMLT |
| Ga0184625_105399682 | 3300018081 | Groundwater Sediment | AHRAADKEHVDMFLPIWEEFGHGENEKIILQAAKESEELYRVYQTGIADAMEALS |
| Ga0187774_100817543 | 3300018089 | Tropical Peatland | EADKGHVDMFLPVWEEFGQGEKEKMILQAAQESEELYRVYQAGLADAMERIS |
| Ga0190265_111272761 | 3300018422 | Soil | READKCHVDMFLPVWEEFGSGENREMILQAAKESEELYRLYQKGLAGAMQALPD |
| Ga0066655_110984031 | 3300018431 | Grasslands Soil | HRAADKEHVDMFLSIWEEFGMGENEEIILQAARESEELYRVYQTGIADGMVALS |
| Ga0190274_105160971 | 3300018476 | Soil | DKGHVDMFLPVWEEYGKGENEKLILQAAQESEELYRVYQAGLADAMARLV |
| Ga0193712_10947321 | 3300019880 | Soil | PVWEEFGTGENEQMILQAAKESEELYRVYQAGLADAMERLS |
| Ga0193727_10399031 | 3300019886 | Soil | PVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEGLV |
| Ga0194128_102395921 | 3300020197 | Freshwater Lake | GHVDMFLPVWEEHGKSENEQLILQAAKESEELYRVYQAGLADAMLAVE |
| Ga0210379_100324223 | 3300021081 | Groundwater Sediment | ADKGHVDMFLPVWEEYGEEENQALILQAAKESEELYRMYQAGLADAMEQVP |
| Ga0207642_104983202 | 3300025899 | Miscanthus Rhizosphere | READRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEAVV |
| Ga0207657_107737231 | 3300025919 | Corn Rhizosphere | PNWKAHREADRGHVDMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERIM |
| Ga0209803_10097316 | 3300026332 | Soil | HVDMFLSIWEEFGMDENEEIILQAARESEELYRVYQTGIADAMVALS |
| Ga0209157_10363593 | 3300026537 | Soil | MFLSIWEEFGMDENEEIILQAARESEELYRVYQTGIADAVAALS |
| Ga0209818_12219881 | 3300027637 | Agricultural Soil | KAHREADKGHVDMFLPVWEEYGKGENERLILQAAKESEELYRVYQAGLADAMEAVT |
| Ga0209466_10216542 | 3300027646 | Tropical Forest Soil | PVWNEFGHGENEEVILQAARESEDLYKVYQSGIADAMLALS |
| Ga0209074_105455282 | 3300027787 | Agricultural Soil | READKGHVDMFLPVWEEFGKGDNEEMILEAAKESEELYRVYQAGLAEAMERMA |
| Ga0207428_109769391 | 3300027907 | Populus Rhizosphere | EEFGSGENREMILQAAKESEELYRLYQKGLADAMQALPD |
| Ga0209889_10110501 | 3300027952 | Groundwater Sand | IWEEFGHGENEKIILQAARESEELYRVYQTGIADAMEALT |
| Ga0268264_109125242 | 3300028381 | Switchgrass Rhizosphere | DMFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMEAVV |
| Ga0307469_109058851 | 3300031720 | Hardwood Forest Soil | MFLPVWEEFGKGENEKMILQAAKESEELYRVYQAGLADAMERLG |
| Ga0307473_114153362 | 3300031820 | Hardwood Forest Soil | WKAHRAADKEHVDMFLPVWNEFGHGENEEIILQAAKESEDLYRVYQTGVADAMLALS |
| Ga0307410_101076621 | 3300031852 | Rhizosphere | READKGHVDMFLPVWEEFGSGENREMILQAAKESEELYRLYQKGLADAMQALPD |
| Ga0310916_101220563 | 3300031942 | Soil | HRAADKEHVDMFLPIWEEFGHGENGKMILDAAKESEELYRVYQTGVADAMEALT |
| Ga0315910_105113402 | 3300032144 | Soil | READKGHVDMFLPVWEEFGNGENEKMILQAAKESEELYRVYQAGIADAMEQMS |
| Ga0364927_0020916_1425_1547 | 3300034148 | Sediment | IWEQFGQGENEAVILQAAKESEELYRVYQTGIAKAMEALG |
| ⦗Top⦘ |