| Basic Information | |
|---|---|
| Family ID | F078776 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRLSLWPQSLFGRLLAASVAAVLLAQAVALLLIAREREHFVLQG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.24 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.483 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.586 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 82.76 |
| PF06175 | MiaE | 12.93 |
| PF00069 | Pkinase | 1.72 |
| PF12850 | Metallophos_2 | 0.86 |
| PF13660 | DUF4147 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG4445 | tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE (synthesis of 2-methylthio-cis-ribozeatin) | Translation, ribosomal structure and biogenesis [J] | 25.86 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.48 % |
| Unclassified | root | N/A | 40.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0844768 | Not Available | 576 | Open in IMG/M |
| 3300001546|JGI12659J15293_10027068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1441 | Open in IMG/M |
| 3300002911|JGI25390J43892_10024232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1463 | Open in IMG/M |
| 3300004091|Ga0062387_100825011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300004633|Ga0066395_10679869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 609 | Open in IMG/M |
| 3300005176|Ga0066679_10844321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300005337|Ga0070682_100185035 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300005436|Ga0070713_100261140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1583 | Open in IMG/M |
| 3300005437|Ga0070710_10537872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300005447|Ga0066689_10216744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1167 | Open in IMG/M |
| 3300005538|Ga0070731_10899255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005538|Ga0070731_11022723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005541|Ga0070733_11224079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300005544|Ga0070686_100451534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 988 | Open in IMG/M |
| 3300005547|Ga0070693_101313307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 559 | Open in IMG/M |
| 3300005554|Ga0066661_10801057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300005712|Ga0070764_10422901 | Not Available | 790 | Open in IMG/M |
| 3300005712|Ga0070764_10739587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300006050|Ga0075028_100272982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300006059|Ga0075017_101320316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 566 | Open in IMG/M |
| 3300006358|Ga0068871_100607759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300006800|Ga0066660_10431194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300007258|Ga0099793_10237801 | Not Available | 878 | Open in IMG/M |
| 3300009545|Ga0105237_11818058 | Not Available | 617 | Open in IMG/M |
| 3300010048|Ga0126373_10665218 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300010048|Ga0126373_11134128 | Not Available | 848 | Open in IMG/M |
| 3300010048|Ga0126373_12350456 | Not Available | 593 | Open in IMG/M |
| 3300010049|Ga0123356_10140877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2378 | Open in IMG/M |
| 3300010358|Ga0126370_10273982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1323 | Open in IMG/M |
| 3300010359|Ga0126376_12683561 | Not Available | 547 | Open in IMG/M |
| 3300010361|Ga0126378_11345219 | Not Available | 808 | Open in IMG/M |
| 3300010376|Ga0126381_100031127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6362 | Open in IMG/M |
| 3300010376|Ga0126381_104690500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 526 | Open in IMG/M |
| 3300010401|Ga0134121_10030580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4363 | Open in IMG/M |
| 3300012359|Ga0137385_10239242 | Not Available | 1575 | Open in IMG/M |
| 3300012683|Ga0137398_10862159 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 632 | Open in IMG/M |
| 3300012922|Ga0137394_10400586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1170 | Open in IMG/M |
| 3300012923|Ga0137359_10486620 | Not Available | 1090 | Open in IMG/M |
| 3300012925|Ga0137419_11297603 | Not Available | 612 | Open in IMG/M |
| 3300012948|Ga0126375_11793404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 535 | Open in IMG/M |
| 3300012951|Ga0164300_11037962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 530 | Open in IMG/M |
| 3300012971|Ga0126369_12508326 | Not Available | 601 | Open in IMG/M |
| 3300012984|Ga0164309_10334729 | Not Available | 1105 | Open in IMG/M |
| 3300013306|Ga0163162_10443991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1429 | Open in IMG/M |
| 3300015356|Ga0134073_10069750 | Not Available | 983 | Open in IMG/M |
| 3300016319|Ga0182033_10582450 | Not Available | 970 | Open in IMG/M |
| 3300016357|Ga0182032_10109650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1968 | Open in IMG/M |
| 3300017936|Ga0187821_10410591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 556 | Open in IMG/M |
| 3300020579|Ga0210407_10687133 | Not Available | 794 | Open in IMG/M |
| 3300020582|Ga0210395_11130982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
| 3300020583|Ga0210401_10342946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1355 | Open in IMG/M |
| 3300021171|Ga0210405_10967873 | Not Available | 643 | Open in IMG/M |
| 3300021433|Ga0210391_10460007 | Not Available | 999 | Open in IMG/M |
| 3300021439|Ga0213879_10132452 | Not Available | 715 | Open in IMG/M |
| 3300021444|Ga0213878_10119137 | Not Available | 1081 | Open in IMG/M |
| 3300021478|Ga0210402_11743486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 549 | Open in IMG/M |
| 3300021560|Ga0126371_11503565 | Not Available | 802 | Open in IMG/M |
| 3300024290|Ga0247667_1106951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 515 | Open in IMG/M |
| 3300024323|Ga0247666_1108305 | Not Available | 552 | Open in IMG/M |
| 3300025900|Ga0207710_10156872 | Not Available | 1107 | Open in IMG/M |
| 3300025900|Ga0207710_10496143 | Not Available | 633 | Open in IMG/M |
| 3300025906|Ga0207699_10201309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1349 | Open in IMG/M |
| 3300025911|Ga0207654_10044006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2533 | Open in IMG/M |
| 3300025924|Ga0207694_11777424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 518 | Open in IMG/M |
| 3300025929|Ga0207664_11929345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 513 | Open in IMG/M |
| 3300025941|Ga0207711_10107451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2477 | Open in IMG/M |
| 3300025949|Ga0207667_11668062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 605 | Open in IMG/M |
| 3300026035|Ga0207703_10440653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1215 | Open in IMG/M |
| 3300026078|Ga0207702_12284315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 529 | Open in IMG/M |
| 3300026301|Ga0209238_1060275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1348 | Open in IMG/M |
| 3300026305|Ga0209688_1031019 | Not Available | 1028 | Open in IMG/M |
| 3300026310|Ga0209239_1146357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 945 | Open in IMG/M |
| 3300026328|Ga0209802_1194256 | Not Available | 790 | Open in IMG/M |
| 3300026329|Ga0209375_1016636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4331 | Open in IMG/M |
| 3300026909|Ga0207858_1022376 | Not Available | 604 | Open in IMG/M |
| 3300027565|Ga0209219_1018352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1697 | Open in IMG/M |
| 3300027674|Ga0209118_1222751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 503 | Open in IMG/M |
| 3300027681|Ga0208991_1058151 | Not Available | 1167 | Open in IMG/M |
| 3300027748|Ga0209689_1047503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2426 | Open in IMG/M |
| 3300028047|Ga0209526_10709124 | Not Available | 633 | Open in IMG/M |
| 3300029951|Ga0311371_10025281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10835 | Open in IMG/M |
| 3300031231|Ga0170824_115081975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 520 | Open in IMG/M |
| 3300031446|Ga0170820_10899747 | Not Available | 650 | Open in IMG/M |
| 3300031543|Ga0318516_10153340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1324 | Open in IMG/M |
| 3300031679|Ga0318561_10728327 | Not Available | 545 | Open in IMG/M |
| 3300031682|Ga0318560_10367549 | Not Available | 777 | Open in IMG/M |
| 3300031720|Ga0307469_10132924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1826 | Open in IMG/M |
| 3300031753|Ga0307477_10251900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1223 | Open in IMG/M |
| 3300031753|Ga0307477_11162641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 502 | Open in IMG/M |
| 3300031754|Ga0307475_10441780 | Not Available | 1045 | Open in IMG/M |
| 3300031765|Ga0318554_10251026 | Not Available | 1007 | Open in IMG/M |
| 3300031768|Ga0318509_10146374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1301 | Open in IMG/M |
| 3300031769|Ga0318526_10009913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3042 | Open in IMG/M |
| 3300031777|Ga0318543_10456800 | Not Available | 572 | Open in IMG/M |
| 3300031778|Ga0318498_10376088 | Not Available | 633 | Open in IMG/M |
| 3300031781|Ga0318547_10053602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2180 | Open in IMG/M |
| 3300031795|Ga0318557_10593571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 508 | Open in IMG/M |
| 3300031798|Ga0318523_10474304 | Not Available | 620 | Open in IMG/M |
| 3300031798|Ga0318523_10506520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 597 | Open in IMG/M |
| 3300031805|Ga0318497_10011428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4118 | Open in IMG/M |
| 3300031805|Ga0318497_10823215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 521 | Open in IMG/M |
| 3300031823|Ga0307478_11296770 | Not Available | 605 | Open in IMG/M |
| 3300031859|Ga0318527_10302335 | Not Available | 681 | Open in IMG/M |
| 3300031880|Ga0318544_10432615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 512 | Open in IMG/M |
| 3300031897|Ga0318520_10073699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1858 | Open in IMG/M |
| 3300031962|Ga0307479_10538781 | Not Available | 1150 | Open in IMG/M |
| 3300031962|Ga0307479_12101853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 512 | Open in IMG/M |
| 3300032039|Ga0318559_10003215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5213 | Open in IMG/M |
| 3300032043|Ga0318556_10244161 | Not Available | 937 | Open in IMG/M |
| 3300032060|Ga0318505_10385517 | Not Available | 662 | Open in IMG/M |
| 3300032066|Ga0318514_10022622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2875 | Open in IMG/M |
| 3300032066|Ga0318514_10367957 | Not Available | 762 | Open in IMG/M |
| 3300032174|Ga0307470_11267422 | Not Available | 602 | Open in IMG/M |
| 3300032205|Ga0307472_100673706 | Not Available | 926 | Open in IMG/M |
| 3300033289|Ga0310914_11450450 | Not Available | 589 | Open in IMG/M |
| 3300033290|Ga0318519_10619876 | Not Available | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08447681 | 2228664022 | Soil | MSFSPWPQSLFGRLLAASVAAVLIAQAVALLLIAQE |
| JGI12659J15293_100270683 | 3300001546 | Forest Soil | MRLSLWPQSLFGRLLAASVAAALIAQATALVLIAQERERFVLQGSVR |
| JGI25390J43892_100242323 | 3300002911 | Grasslands Soil | MRLSAWPQSLFGRLLAASVAAVLVAQAAGLLLIAQERERFVLQGS |
| Ga0062387_1008250112 | 3300004091 | Bog Forest Soil | MRLSLWPQSLFGRLIAASVIAVLVAQAVGLVLIAQEREGFVLQGSV |
| Ga0066395_106798692 | 3300004633 | Tropical Forest Soil | MSFSPWPQSLFGRLLAASVAAVLAAQVVALLLIAQEREHFMLQGSVREW |
| Ga0066679_108443211 | 3300005176 | Soil | MRLSAWPQSLFGRLLAASVVAVLLAQTAGLFLIAQEREHFVLQGSVREWARRI |
| Ga0070682_1001850351 | 3300005337 | Corn Rhizosphere | MSPRLWPQSLFGRLIAASIIALLLAQVVSLVMIARERERFILQGSVYEWSRR |
| Ga0070713_1002611401 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFSPWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREWT |
| Ga0070710_105378721 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLSLWPQSLFGRLLAASVAAVLFAQAVALLLIAQEREHFMLQGSV |
| Ga0066689_102167443 | 3300005447 | Soil | MRAMRVSLWPQSLFGRLIAASALAVLLAHVAGLFLIAQEREHFVLQGSV |
| Ga0070731_108992552 | 3300005538 | Surface Soil | MRWWPQSLFARLLAASVGAVLLAQAAALILIVQERERFVLQGSLSEW |
| Ga0070731_110227232 | 3300005538 | Surface Soil | MRLTLWPQSLFGRLLAASVGAVLLAQAAGLVLIAQ |
| Ga0070733_112240792 | 3300005541 | Surface Soil | MRRVALWPQSLFGQLLAASVIAVLLAQAVALFLIAQEREHFILQGSVREWTRR |
| Ga0070686_1004515342 | 3300005544 | Switchgrass Rhizosphere | MRVSLWPQSLFGRLFAASIVALLLAQLVSLVFVARERERFILQ |
| Ga0070693_1013133071 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRLWPQSLFGRLIAASIIALLLAQVVSLVMIARERERFILQGSV |
| Ga0066661_108010572 | 3300005554 | Soil | MQLSVWPQSLFGRLIAASALAVLLAHATGLLLIAQEREHFVLQGSVREWSR |
| Ga0070764_104229012 | 3300005712 | Soil | MAEKLRWQLRLWPQSLFGRLLMASVIAVLLAQAVALFLIAQER |
| Ga0070764_107395871 | 3300005712 | Soil | MRWSLWPQSLFGRLLAASVGAVLLAQAIAFVLIAQERERFVLEGSVR |
| Ga0075028_1002729821 | 3300006050 | Watersheds | MRISLWPQSLFGRLLAASVLAVLIAQAAALFLIAQDRERFALQASVHEWTHRIS |
| Ga0075017_1013203161 | 3300006059 | Watersheds | MRWSPWPQSLFGRLLAATVAAVLVAQAASVLLIAQEHERFMLQGSVHDWA |
| Ga0068871_1006077592 | 3300006358 | Miscanthus Rhizosphere | MSPRLWPQSLFGRLIAASIIALLLAQIVSLVMIARERERFILQG |
| Ga0066660_104311941 | 3300006800 | Soil | MQLSVWPQSLFGRLIAASALAVLLAHATGLLLIAQEREHFVLQGSVREWSRRIAE |
| Ga0099793_102378012 | 3300007258 | Vadose Zone Soil | MRLSPWPQSLFGRLLAASVAAVLLAQTAGLFLIAQEREHFVLQGSVRE |
| Ga0105237_118180582 | 3300009545 | Corn Rhizosphere | VSRFPLWPQSLFGRLVAASVLAVLLAQMVGLLLIAHERERF |
| Ga0126373_106652181 | 3300010048 | Tropical Forest Soil | MKSLTPWPQSLFGRLLAASVIAVLLAQAVALLLIAREREHFVLQGSVREWTRRIT |
| Ga0126373_111341281 | 3300010048 | Tropical Forest Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERFVMQ |
| Ga0126373_123504562 | 3300010048 | Tropical Forest Soil | MRLSLWPQSLFWRLLAASVGAVLLAHAVALLLIAQERERFVLQGSVREWTRHI |
| Ga0123356_101408771 | 3300010049 | Termite Gut | MRLSLWPQSLFGRLLAASVAAVLLAHATALLLIAQERER |
| Ga0126370_102739823 | 3300010358 | Tropical Forest Soil | MSFSPWPQSLFGRLLAASVAAVLVAQVVALLLIAQEREHFMLQGSVREWTRRI |
| Ga0126376_126835611 | 3300010359 | Tropical Forest Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERER |
| Ga0126378_113452192 | 3300010361 | Tropical Forest Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQER |
| Ga0126381_1000311278 | 3300010376 | Tropical Forest Soil | MRLSLWPQSLFGRLLAASIAAVLLAHLSSLLLIAQERERFVLQG |
| Ga0126381_1046905002 | 3300010376 | Tropical Forest Soil | MRLSLWPQSLFWRLLAASVGAVLLAHAVALLLIAQERERFVLQGSVREWTRHIA |
| Ga0134121_100305807 | 3300010401 | Terrestrial Soil | MRLSLWPQSLFGRLLAASVAAVLFAQAVALLLIAQEREHFMLQ |
| Ga0137385_102392423 | 3300012359 | Vadose Zone Soil | MRLSLWPQSLFGRLIAASIVALLLAQLASLVFIARERERFILQGSVREWS |
| Ga0137398_108621591 | 3300012683 | Vadose Zone Soil | MRLPLWPQSLFGRLLAATVCAVVLAEVAALFLIAQEH |
| Ga0137394_104005861 | 3300012922 | Vadose Zone Soil | MQLSAWPQSLFGRLIAASALAVLLAHAAGLFLIAEERERFVLQGS |
| Ga0137359_104866203 | 3300012923 | Vadose Zone Soil | MRLSLWPQSLFGRLFAASIVALLLAQLVSLVFVARERERFILQ |
| Ga0137419_112976032 | 3300012925 | Vadose Zone Soil | MRLSLWPQSLFGRLLAASVAAVLLAQTAGLFLIAQE |
| Ga0126375_117934042 | 3300012948 | Tropical Forest Soil | MRLPLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQG |
| Ga0164300_110379622 | 3300012951 | Soil | MSFSPWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFIRAEVRPGG* |
| Ga0126369_125083262 | 3300012971 | Tropical Forest Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERFVMQGS |
| Ga0164309_103347293 | 3300012984 | Soil | MSFSPWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSV |
| Ga0163162_104439911 | 3300013306 | Switchgrass Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQEREHFVLQG |
| Ga0134073_100697501 | 3300015356 | Grasslands Soil | MRLSPWPQSLFGRLLAASVAAVLLAQAAGLFLIAQERERFVLQGSVREWARR |
| Ga0182033_105824501 | 3300016319 | Soil | MSFSLRPQSLFGRLRAASVAAVLIAQAVALLLIAQEREHFML |
| Ga0182032_101096504 | 3300016357 | Soil | MRLTLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREWARR |
| Ga0187821_104105911 | 3300017936 | Freshwater Sediment | MRLSLWPQSLFGRLLAASVAAVLFAQAVALLLIAQEREHFMMQGSVREWS |
| Ga0210407_106871331 | 3300020579 | Soil | MRLSVWPRSLFGRLLAASVAAVLLAQAVGLFLIAQEREGFVLLGSVREWSRRI |
| Ga0210395_111309821 | 3300020582 | Soil | MTRLTLWPQSLFGRLLAASVGAVLLAQVAGLVLIAQERERFVMQGSV |
| Ga0210401_103429461 | 3300020583 | Soil | MLLSPWPQSLFGRLLAASVAAVLIAQAVALLLIAQERDR |
| Ga0210405_109678731 | 3300021171 | Soil | MRLSLWPQSLFGRLLAATVAAVLVAQATGLLLIAQERERFVLQGSVREWT |
| Ga0210391_104600072 | 3300021433 | Soil | MTRLTLWPQSLFGRLLAASVGAVLLAQVAGLVLIAQERERFVMQGSVR |
| Ga0213879_101324521 | 3300021439 | Bulk Soil | MRVPFWPQTLFWRLLAASVAAVLVAQAVALLLIAQ |
| Ga0213878_101191372 | 3300021444 | Bulk Soil | MRLRLWPQSLFWRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREWTR |
| Ga0210402_117434862 | 3300021478 | Soil | MRRLAPWPQSLFGQLLAASVIAVLLAQAVALFLIAQE |
| Ga0126371_115035652 | 3300021560 | Tropical Forest Soil | MRLPLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVRECTRRIAD |
| Ga0247667_11069511 | 3300024290 | Soil | MRATLWPQSLFGRLVAASVIAVFVAQAAALLLIAREREHFVLQS |
| Ga0247666_11083052 | 3300024323 | Soil | MSFSPWPQSLFGRLLAATVAAVLIAQAVALLLIAQEREHFMLQGSVREWT |
| Ga0207710_101568723 | 3300025900 | Switchgrass Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQER |
| Ga0207710_104961432 | 3300025900 | Switchgrass Rhizosphere | MSSRLWPQSLFGRLIAASIIALLLAQVVSLVMIARERERFILLGSVF |
| Ga0207699_102013091 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQEREHFVLQ |
| Ga0207654_100440064 | 3300025911 | Corn Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQEREHFV |
| Ga0207694_117774241 | 3300025924 | Corn Rhizosphere | MTFRLWPQSLFGRLMAASIVALLLAQVVSLVMIARERERYILQGSVREW |
| Ga0207664_119293452 | 3300025929 | Agricultural Soil | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQEREHFVL |
| Ga0207711_101074514 | 3300025941 | Switchgrass Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQAVGLFLIAQEREHFV |
| Ga0207667_116680623 | 3300025949 | Corn Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQEREHF |
| Ga0207703_104406531 | 3300026035 | Switchgrass Rhizosphere | MRLPLWPQSLFGRLLAASVIAVLLAQTVGLFLIAQERE |
| Ga0207702_122843152 | 3300026078 | Corn Rhizosphere | MRWSLWPQSLFGRLIAASVLALLLAQVVSLVLIARERERFMLQGSVWE |
| Ga0209238_10602751 | 3300026301 | Grasslands Soil | MRLSPWPQSLFGRLLAASVAAVLLAHTAGLFLIARER |
| Ga0209688_10310193 | 3300026305 | Soil | MRLSPWPQSLFGRLLAASVAAVLLAQAAGLFLIAQERE |
| Ga0209239_11463572 | 3300026310 | Grasslands Soil | MRLSPWPQSLFGRLLAASVAAVLLAHTAGLFLIAQERERFVLQGSVREWARRIAE |
| Ga0209802_11942562 | 3300026328 | Soil | MRLPLWPQSLFGRLLAATVCAVVLAEVAALFLIAQEHERF |
| Ga0209375_10166361 | 3300026329 | Soil | MRLSPWPQSLFGRLLAASVAAVLLAHTAGLFLIAQERERFVLQGSVREWAR |
| Ga0207858_10223761 | 3300026909 | Tropical Forest Soil | MRLSLWPQSLFGRLLAASVAAVLVAQAAALALIAQEREHFVLQVSVRE |
| Ga0209219_10183523 | 3300027565 | Forest Soil | MRASLWPQSLFGRLLAASVIAVLLAQAAALFLIAQERERFVLQGSVREWTRRIS |
| Ga0209118_12227511 | 3300027674 | Forest Soil | MMRVSLWPQSLFGRLLAASVAAVLLAQAAGLFLIAQEREGFVLQGS |
| Ga0208991_10581511 | 3300027681 | Forest Soil | MRLSLWPQSLFGRLIAASILALLLAQLVGMMFVARERERFI |
| Ga0209689_10475034 | 3300027748 | Soil | MRLSAWPQSLFGRLLAASVAAVLVAQAAGLLLIAQERERFV |
| Ga0209526_107091241 | 3300028047 | Forest Soil | MSRFFWPQSLFGRLIAASIIALLLAQVVSLVLIAR |
| Ga0311371_1002528112 | 3300029951 | Palsa | MAESLRSRLTLWPQSLFGRLLMASVIAVLLAQAVALFLIAQEREHFVLQGSV |
| Ga0170824_1150819752 | 3300031231 | Forest Soil | MRLPLWPQSLFGRLIAASVIAVLVAQAVALVLIAQERERFVLQGSVRVWTRRI |
| Ga0170820_108997472 | 3300031446 | Forest Soil | MSRYFWPQSLFGRLIAASIIALLLAQVVSLVLIARERERFILPENVRE |
| Ga0318516_101533401 | 3300031543 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREWTRR |
| Ga0318561_107283271 | 3300031679 | Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERF |
| Ga0318560_103675491 | 3300031682 | Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERFVMQG |
| Ga0307469_101329244 | 3300031720 | Hardwood Forest Soil | MRLSVWPQSLFGRLLAASVIAVLLAQGAGLLMIAQER |
| Ga0307477_102519001 | 3300031753 | Hardwood Forest Soil | MRLPLWPQSLFGRLLAATVCAVLLAEGAALFLIAQERERFMQQWSV |
| Ga0307477_111626411 | 3300031753 | Hardwood Forest Soil | MRLSLWPQSLFGRLVAASVAAVLLAQAVALLLIAQEREHFVRQGSVRDWTRRIAE |
| Ga0307475_104417801 | 3300031754 | Hardwood Forest Soil | MLLRFWPQSLFGRLLAASVAAVLLAQAVALLLIAQERERFVLQGSVREWTRRISE |
| Ga0318554_102510262 | 3300031765 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMV |
| Ga0318509_101463743 | 3300031768 | Soil | MRLSLWPQSLFGRLLAASVLAVVLAQAVALLLIAQEREHFVRQGSVRD |
| Ga0318526_100099131 | 3300031769 | Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERE |
| Ga0318543_104568001 | 3300031777 | Soil | MRLSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREWARRI |
| Ga0318498_103760882 | 3300031778 | Soil | MRLSLWPQSLFGRLLAASVAAVLLAQAVALLLIAREREHFVLQG |
| Ga0318547_100536021 | 3300031781 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQ |
| Ga0318557_105935711 | 3300031795 | Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERFVLQGSVREWTRRM |
| Ga0318523_104743042 | 3300031798 | Soil | MRLSLWPQSLFGRLLAASVLAVVLAQAVALLLIAQG |
| Ga0318523_105065201 | 3300031798 | Soil | MRLTLWPQSLFGRLLAASVAAVLLAQAVALLLIAQEREHFVLQGSVREWTR |
| Ga0318497_100114286 | 3300031805 | Soil | MRLPLWPQSLFGRLLAASVAAVLLAQAVALVMIAQERERFVLQGSVRE |
| Ga0318497_108232151 | 3300031805 | Soil | MHLRLWPQSLFWRLLAASVAAVLLAQAVALVMIAQERERFMVQ |
| Ga0307478_112967701 | 3300031823 | Hardwood Forest Soil | MRLSLWPQSLFGRLLAATVAAVLVAQATGLLLIAQERERF |
| Ga0318527_103023352 | 3300031859 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREH |
| Ga0318544_104326152 | 3300031880 | Soil | MRLSLWPQSLFGRLLAASIAAVVLAHLSSLLLIAQEREHFVL |
| Ga0318520_100736994 | 3300031897 | Soil | MRLSLWPQSLFGRLLAASVLAVVLAQAVALLLIAQEREHFVRQGSVQ |
| Ga0307479_105387813 | 3300031962 | Hardwood Forest Soil | MRPSLWPQSLFGRLLAASVGAVLLAQAAGLLLIAQERERFVLQGSVR |
| Ga0307479_121018531 | 3300031962 | Hardwood Forest Soil | MRLSPWPQSLFGRLLAASVAAVLLAQTAGLFLIAQE |
| Ga0318559_100032154 | 3300032039 | Soil | MRLSLWPQSLFGRLLAASVLAVVLAQAVALLLIAQEREHFVRQGSVRDWTRRIA |
| Ga0318556_102441611 | 3300032043 | Soil | MRFSLWPRSLFGRLLAASVVAVLVSQAVALLLIAQEREHFMLQGSVRECTRRIA |
| Ga0318505_103855172 | 3300032060 | Soil | MLLRLWPQSLFGRLLAASVAAVLLAQAVALVLIAQERERFVLQG |
| Ga0318514_100226221 | 3300032066 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQGSVREW |
| Ga0318514_103679572 | 3300032066 | Soil | MRLRLWPESLFGRLIAVSVIAVLAAQAIGLGLIARERERFVLQGSVREWSRAIR |
| Ga0307470_112674221 | 3300032174 | Hardwood Forest Soil | MSRFFWPQSLFGRLIAASIIALLLAQVVSLVVIARERERFKLQGS |
| Ga0307472_1006737062 | 3300032205 | Hardwood Forest Soil | MMRVSLWPQSLFGRLLAASVAAVLLAQAVGLFLIAQEREGFVLQGSVREWSRRI |
| Ga0310914_114504502 | 3300033289 | Soil | MRLPLWPQSLFGRLLAASVAAVLLAQAVALVMIAQERERF |
| Ga0318519_106198762 | 3300033290 | Soil | MSFSLWPQSLFGRLLAASVAAVLIAQAVALLLIAQEREHFMLQG |
| ⦗Top⦘ |