 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F078768 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 36 residues |
| Representative Sequence | ELRWAAAVNRLRLNVSRIIPGDWGKVESGWLAQPL |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.414 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.40% β-sheet: 0.00% Coil/Unstructured: 74.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.41 % |
| All Organisms | root | All Organisms | 2.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 25.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 14.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.76% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 6.03% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 4.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.31% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.59% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.59% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001448 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome | Environmental | Open in IMG/M |
| 3300001801 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004560 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006364 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006938 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007526 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
| 3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
| 3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
| 3300009281 | Microbial communities of wastewater sludge from Singapore - Sludge_b1_October | Environmental | Open in IMG/M |
| 3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011018 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 5 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011032 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 27 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20219J14954_10094651 | 3300001448 | Wetland | LRWVAGINRFPLNVSRIIPGDWGKAGPGWLAQPL* |
| JGI20219J14954_10096412 | 3300001448 | Wetland | LRWVAGINRFPLNVSRIIPGDWGKVGPGWLARPL* |
| JGI20219J14954_10097941 | 3300001448 | Wetland | LRWAAAVNRLRLNVSRMIPGDWGKVGSGWLAQPL* |
| JGI20217J20340_103751 | 3300001801 | Wetland | ARRVVAVNRLTLRVSRIIPGDWGKVGPGWLAQPL* |
| Ga0068940_10121701 | 3300004560 | Peatlands Soil | LRWAAAVNRLRLNVSRIIPGDWGKAGPGWLAQPLLSRIER* |
| Ga0068961_10253532 | 3300004612 | Peatlands Soil | RWAAAVNRLRLNVSRIIPGDWGKAGPGWLAQPLLSRIER* |
| Ga0072320_10144852 | 3300004970 | Peatlands Soil | LRWAEAFNRLKLNVSEIIPGDWGKVGPGWLARPLLSRIA* |
| Ga0075482_10082302 | 3300006364 | Aqueous | LRWLAVINRLSLVVSRIIPGDWGKVESGWLAWPL* |
| Ga0075490_10061871 | 3300006375 | Aqueous | ELRWLAVINRLSLVVSRIIPGDWGKVESGWLAWPL* |
| Ga0081245_10014022 | 3300006938 | Tropical Rainforest Soil | RDSLAAVNRLRLKVSRIIPGDWGKVGPGWLAPPL* |
| Ga0081245_10014812 | 3300006938 | Tropical Rainforest Soil | LRWAAVINRELLNVSRIIPGDWGKVKSGWLTWLL* |
| Ga0075022_10335661 | 3300007526 | Watersheds | RKQAVAVNRLRRQVSRIIPGDWGKVGPGWLAQSL* |
| Ga0103638_10005511 | 3300008785 | Wetland Soil | ARRTVAVNRLLPEVSWIIPGDWGKVEPGWLAEPL* |
| Ga0103746_100185071 | 3300008884 | Wastewater Sludge | KELRWVAGINRFPLNVSRIIPGDWGKAGPGWLARPL* |
| Ga0103748_100334291 | 3300009199 | Wastewater Sludge | VRWVAAVNRLTLRVSRIIPGDWGKVGPGWLVRLL* |
| Ga0103748_100355471 | 3300009199 | Wastewater Sludge | LRWVAGINRFPLNVSRIIPGDWGKAGPGWLARPL* |
| Ga0103744_100691841 | 3300009281 | Wastewater Sludge | ELRWVAGINRFPLNVSRIIPGDWGKAGPGWLARPL* |
| Ga0115599_10533981 | 3300009579 | Wetland | KELRWVTEIERQQLNVSRIIPGDWGKVGPGWLAQPL* |
| Ga0115599_11239631 | 3300009579 | Wetland | VRWVAAVNRLTLRVSRIIPGDWGKVEPGWLVQPL* |
| Ga0115596_10341081 | 3300009580 | Wetland | LRWAAAVNRLRLNVSRIIPGDWGKVGSGWLTQPLLSQIAR* |
| Ga0115596_10376731 | 3300009580 | Wetland | LRRSAAINRLRSNVSRIIPGDWGKVEPGWLALPL* |
| Ga0115596_10706911 | 3300009580 | Wetland | LRWVAGTNRLPLNVSRIIPGDWGKAEPGWLAQPL* |
| Ga0115596_10882221 | 3300009580 | Wetland | LIWQAAINRLRLNVSRIIPGDWGKVGSGWLAQPL* |
| Ga0115596_11553371 | 3300009580 | Wetland | LRWAAAVNRLRLNVSRIIPGDWGKVGSGWLTQPLLS* |
| Ga0115600_10296041 | 3300009581 | Wetland | LRRAAAINRLRLNVSRIIPGDWGKVEPGWLVQLL* |
| Ga0115600_10327231 | 3300009581 | Wetland | LRCEAEVNRLLSNVSRIIPGDWGKVLPGWLAGPL* |
| Ga0115600_10334911 | 3300009581 | Wetland | WLAAIARWALNVSRIIPGDWGKVEPGWLAQPLCAEP* |
| Ga0115600_11546601 | 3300009581 | Wetland | RRSAAVAERLQLAVSRIIPGDWGKVGPGWLAQPL* |
| Ga0115600_11816181 | 3300009581 | Wetland | LRWVAGINRFSLNVSRIIPGDWGKAGPGWLAQPL* |
| Ga0115601_10070451 | 3300009582 | Wetland | LRWAATVNRLELNVSKIIPGDWGKAGPGWLAQPL* |
| Ga0115601_11471601 | 3300009582 | Wetland | LRWSAAVNKLRLNVSRIILGDWGKVEPGWLARPL* |
| Ga0115598_10164531 | 3300009583 | Wetland | RRWLAAIARWALNVSRIIPGDWGKVEPGWLAQPLCAEP* |
| Ga0115598_10296421 | 3300009583 | Wetland | LRWQAAINRLRLNVSRIIPGDWGKVGSGWLAQPL* |
| Ga0115597_10062411 | 3300009584 | Wetland | LKELRWVTEIERQQLNVSRIIPGDWGKVGPGWLAQPL* |
| Ga0115591_10382221 | 3300009586 | Wetland | ARWVAAVNRLTLHVSRIIPGDWGKVGPGWLAQPL* |
| Ga0115602_10267501 | 3300009587 | Wetland | ERRWLAAIARWALNVSRIIPGDWGKVEPGWLAQPLCAEP* |
| Ga0115602_10857761 | 3300009587 | Wetland | ELRRAAAVNRLRLNVAEIIPGDWGKAGSGWLAEPL* |
| Ga0115592_10720581 | 3300009755 | Wetland | LRWSAAVNKLRLNVSRIIPGDWGKVEPGWLARPL* |
| Ga0115592_11585731 | 3300009755 | Wetland | KELRRSAAINRLRSNVSRIIPGDWGKVEPGWLALPL* |
| Ga0127457_10256311 | 3300010081 | Grasslands Soil | LRWAAAVNRLKWNVSRIIPGDWGKVESGWLAQLL* |
| Ga0127492_10159681 | 3300010087 | Grasslands Soil | LRWTAEVERWKLKVSRIIPGDWGKVESGWLAQPL* |
| Ga0127453_10399721 | 3300010102 | Grasslands Soil | KELRWAAAVNRLLLRVSRIIPGDWGKVESGWLAQPL* |
| Ga0127460_10108131 | 3300010114 | Grasslands Soil | LRWLVAVNRLPLNVSRIIPGDWGKVETGWLAQPL* |
| Ga0127460_10425551 | 3300010114 | Grasslands Soil | LRRVAVINREPSNVSRIIPGDWGMAVSGWLARPL* |
| Ga0127489_11091091 | 3300010127 | Grasslands Soil | KELRWAAAVNRLQSNVSRIIPGDWGKVESGWLAQPL* |
| Ga0127486_10138341 | 3300010128 | Grasslands Soil | QRWAAAVNRLKLNVSRIIPGDWGKAESGWLAQLL* |
| Ga0127493_11326851 | 3300010130 | Grasslands Soil | LRWAAAVNRLKLNVSRIIPGDWGKVETGWLAQPL* |
| Ga0115594_11897041 | 3300010131 | Wetland | EVRWVAAVNRLTLRVSRIIPGDWGKVEPGWLVQPL* |
| Ga0127447_11505331 | 3300010136 | Grasslands Soil | ELRWAAAVNRLTLNLSRIIPGDWGKVESGWLAHPL* |
| Ga0115595_10300681 | 3300010138 | Wetland | ELRCEAEVNRLLSNVSRIIPGDWGKVLPGWLAGPL* |
| Ga0115595_10808261 | 3300010138 | Wetland | WAAAVNRLRLNVSRIIPGDWGKVGSGWLTQPLLSQIAR* |
| Ga0115595_11165351 | 3300010138 | Wetland | VRWVAAVNRLTLRVSRIIPGDWGKVGPGWLAQPL* |
| Ga0115595_11710781 | 3300010138 | Wetland | RWLAAIARWSLNVSRIIPGDWGKVEPGWLAQPLCAEP* |
| Ga0115595_11973121 | 3300010138 | Wetland | LRWAAAVNRLRLNVSRIIPGDWGKVESGWLTQPLLS* |
| Ga0126322_12968741 | 3300010143 | Soil | ELRRKAAVNRLPQNVSRISPGDWGKVMPGWLAWPL* |
| Ga0126321_12194141 | 3300010145 | Soil | LSWTAAVNRLTLDFSRIIPGDWGKVEPGWLAQLL* |
| Ga0126319_14150631 | 3300010147 | Soil | LRWVAAVNRWLSNVSRIIPGDWGKAGSGWLVSPL* |
| Ga0127503_101918081 | 3300010154 | Soil | LRWTAAVNRLTLNVSRIIPGDWGKVEPGWLAQLLLS* |
| Ga0127503_107673561 | 3300010154 | Soil | LRWAAAFNRVQLNVSRIIPGDWGKVGSGWLAQPL* |
| Ga0138527_1058481 | 3300011018 | Peatlands Soil | PKWVAAVNRLRLNVSRIIPGDWGKVESGWLAQPL* |
| Ga0138546_1110651 | 3300011032 | Peatlands Soil | LRWAAAVNRLKPSVSRIIPGDWGKAESGWLAQLL* |
| Ga0138593_1125061 | 3300011039 | Peatlands Soil | EPKWVAAVNRLRLNVSRIIPGDWGKVESGWLAQPL* |
| Ga0138537_10009471 | 3300011063 | Peatlands Soil | ELRWAEAFNRLKLNVSETIPGDWGKVGPGWLARPLLSRIA* |
| Ga0138537_10518521 | 3300011063 | Peatlands Soil | ELRWAAAVNRLKPSVSRIIPGDWGKAESGWLAQLL* |
| Ga0138595_11087841 | 3300011071 | Peatlands Soil | ELRWAAAVDRLRLSVSRIIPGDWGKAESGWLAQLL* |
| Ga0151652_114670431 | 3300011340 | Wetland | ELRWAAAVNRLRLNVSRIIPGDWGKVESGWLAQPL* |
| Ga0151652_122024281 | 3300011340 | Wetland | ELSGAAADARKRLQDSEMIPGDWGKVGPGWLAQPL* |
| Ga0151652_135585001 | 3300011340 | Wetland | LRWVAGVNRFPLNVSRIIPGDWGKAGPGWLARPL* |
| Ga0137365_107220072 | 3300012201 | Vadose Zone Soil | LKELRWAAAVNRLKSNVSRIIPGDWAKVESGWLAQPLLS |
| Ga0134039_10328461 | 3300012374 | Grasslands Soil | EQRRAAAVNRLKLNVSRIIPGDWGKAEPGWLAQLL* |
| Ga0134058_10316701 | 3300012379 | Grasslands Soil | ELRWEAAVNRLLPNVSRIIPGDWGKVESGWLAQPL* |
| Ga0134035_12853351 | 3300012391 | Grasslands Soil | QRRAAAVNRLKLNVSRIIPGDWGKAEPGWLAQLL* |
| Ga0134055_11917411 | 3300012401 | Grasslands Soil | ELRWLVAVNRLPLNVSRIIPGDWGKVETGWLAQPL* |
| Ga0134055_12764041 | 3300012401 | Grasslands Soil | LRWVAAVNRVPLTVSRMIPGDWVKVESGWLAQPF* |
| Ga0134059_12457781 | 3300012402 | Grasslands Soil | ELRRVAVINREPSNVSRIIPGDWGMAVSGWLARPL* |
| Ga0134049_12276191 | 3300012403 | Grasslands Soil | LRCAAAVNRLTLRVSRMNPGDWVKVESGWLAQPF* |
| Ga0154010_1431251 | 3300013062 | Corn, Switchgrass And Miscanthus Rhizosphere | LRWAAVVNRMQLNISRILPGDWGKVESGWLAQLL* |
| Ga0153914_10369631 | 3300013078 | Freshwater Wetlands | RRQVAATNRLPVQVFRIIPGDWGKVGPGWLAQPL* |
| Ga0153913_10712591 | 3300013080 | Freshwater Wetlands | VRWVAAVNRLALRVSRIIPGDRGKVGSGWLAQLL* |
| Ga0187789_10343841 | 3300019199 | Peatland | ELRWVAGINRFPLNVSRIIPGDWGKAGPGWLARPL |
| Ga0187789_11177821 | 3300019199 | Peatland | LRWAAAVNRLTPNVSRIIPGDWGKVESGWLAQPLISLIAR |
| Ga0187799_12130831 | 3300019211 | Peatland | AVNRLKPDVSRIIPGNWGKAEPGWLAWPLLHRTAR |
| Ga0172288_11272271 | 3300019234 | Wetland | KELRWQAAINRLRLNVSRIIPGDWGKVGSGWLAQPL |
| Ga0187791_10451391 | 3300019245 | Peatland | ELRWAAAVNRLKLNVSRIIPGDWGKVGSGWLAQPLLS |
| Ga0187791_12158441 | 3300019245 | Peatland | ELRRKAAVNRLPQNVSRIIPGDWGKVIPGWLAWPL |
| Ga0187791_12279201 | 3300019245 | Peatland | ELRRKAAVNRLPPNVSRIIPGDWGKVMPGWLAWPL |
| Ga0180117_11141641 | 3300019248 | Groundwater Sediment | ELRWTGTNERMKLVVSRIIPGDWGKVRAGWLPLLL |
| Ga0180117_12905711 | 3300019248 | Groundwater Sediment | ELRWSAAVNKLLSNVSRIIPGDWGKVGPGWLARPL |
| Ga0180117_13653711 | 3300019248 | Groundwater Sediment | ELRRSAAINRLRSNVSRIIPGDWGKVEPGWLALPL |
| Ga0187790_13573501 | 3300019250 | Peatland | RWVTAVNRLRLNVSKIIPGDWGKVESGWLAQLLSSWM |
| Ga0187790_13580711 | 3300019250 | Peatland | ELRWTAAVNRLLRDVSRIIPGDWGKAGSGWLAQLL |
| Ga0187796_13240801 | 3300019264 | Peatland | KELRWAAAINRLRLNVSRIIPGDWGKVESGWLAQPL |
| Ga0187796_15913571 | 3300019264 | Peatland | ELRWAAAVNRLRLNVSRIIPGNWGKVESGWLAQPLLS |
| Ga0187792_11529371 | 3300019265 | Peatland | LRWAAAVNRLQLNVSRIIPGDWGKVESGWLAQPLLS |
| Ga0187792_12100171 | 3300019265 | Peatland | ELRWAAAVNRLRLTVSRIIPGDWGKVGSGWLAKPL |
| Ga0187792_12481401 | 3300019265 | Peatland | ELRWAAAVNRLRLNVSRIIPGDWGKVESGWLAQPL |
| Ga0187792_14288591 | 3300019265 | Peatland | ERKQAVAVNRVRRHVSRIIPGDWGKVGPGWLAQPL |
| Ga0187794_13605401 | 3300019273 | Peatland | ELRWAATVNRLMLNVSRIIPGDWGKVGSGWLAQPLLR |
| Ga0187800_10065001 | 3300019278 | Peatland | LRWAAAVNRLKLNVSEIIPGDWGKVGPGWLARPLLS |
| Ga0187800_12294971 | 3300019278 | Peatland | ALRRKAAVNRLTPDGSRIIPGDWGKVESGWLAWPL |
| Ga0179584_12031351 | 3300021151 | Vadose Zone Soil | ELRWAAAVNRLTLNVSRIIPGDWGKVESGWLAQLL |
| Ga0179585_10064221 | 3300021307 | Vadose Zone Soil | ELRWKAAVNRLTQNVSRIIPGDWGKVESGWLAWPL |
| Ga0179585_11571371 | 3300021307 | Vadose Zone Soil | ERRWAAAVNRLKLNVSRIIPGDWGKAEPGWLAQLL |
| Ga0179958_10360271 | 3300021315 | Vadose Zone Soil | KERRWAAAVNRLKLNVSRIIPGDWGKAEPGWLAQLL |
| Ga0213853_110406041 | 3300021861 | Watersheds | KELRWVAVINREPSNVSRIIPGDWGKAGSGWLARPL |
| Ga0213847_11345331 | 3300021938 | Watersheds | ELRWAAAFNRVQLNVSRIIPGDWGKVESGWLAQPL |
| Ga0213934_10291531 | 3300022156 | Freshwater | GLKRKAAVNRLPQNVSRIIPGDWGKVMPGWLAWPL |
| Ga0213932_10289021 | 3300022166 | Freshwater | LRWVAGVNRFPLNVSRIIPGDWGKAGPGWLAQPLLSRLKHAGS |
| Ga0228704_1081821 | 3300023691 | Freshwater | LRWAAAVIRLKSNVSRIIPGDWGKVESGWLVQLLS |
| Ga0308206_10529541 | 3300030903 | Soil | ELRWAAAVNRLRLNVSRIIPGDWGKVESGWLTQLL |
| Ga0138296_17173321 | 3300030923 | Soil | AAAVNRLTLNVSRIIPGDWGKVESGWLAQLLFRADRKV |
| Ga0308187_103413701 | 3300031114 | Soil | LRWAAAVNRLKLNVSRIIPGDWGKVEPGWLAQLLLS |
| Ga0307410_116949302 | 3300031852 | Rhizosphere | KELRWMAKDERNSQNVSRIIPGDRGKVESGWLARPL |
| Ga0316592_10509581 | 3300033524 | Rhizosphere | ELRWSAVVNKLLSNVSRIIPGDWGKVEPGWLARPL |
| Ga0316586_10374171 | 3300033527 | Rhizosphere | KELRWSAVVNKLLSNVSRIIPGDWGKVEPGWLARPL |
| Ga0314780_057798_688_795 | 3300034659 | Soil | ELRRKAAVNRLPQNVSRIIPGDWGKVMPGWLAWPL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |