| Basic Information | |
|---|---|
| Family ID | F078743 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIDTVTKNYGINNEFCSYQVTYVNSNIVKSVPLDEANTDYQA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.25 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 94.83 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (41.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.069 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00386 | C1q | 0.86 |
| PF16778 | Phage_tail_APC | 0.86 |
| PF13392 | HNH_3 | 0.86 |
| PF02945 | Endonuclease_7 | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.28 % |
| Unclassified | root | N/A | 26.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10063443 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1533 | Open in IMG/M |
| 3300001460|JGI24003J15210_10045892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 1484 | Open in IMG/M |
| 3300002408|B570J29032_109762212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1239 | Open in IMG/M |
| 3300002483|JGI25132J35274_1011889 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2134 | Open in IMG/M |
| 3300002514|JGI25133J35611_10182493 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 559 | Open in IMG/M |
| 3300005912|Ga0075109_1064859 | Not Available | 1320 | Open in IMG/M |
| 3300006402|Ga0075511_1619506 | Not Available | 501 | Open in IMG/M |
| 3300006735|Ga0098038_1296273 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 503 | Open in IMG/M |
| 3300006749|Ga0098042_1136084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 607 | Open in IMG/M |
| 3300006749|Ga0098042_1136215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 607 | Open in IMG/M |
| 3300006754|Ga0098044_1393882 | Not Available | 521 | Open in IMG/M |
| 3300006802|Ga0070749_10440868 | Not Available | 714 | Open in IMG/M |
| 3300006802|Ga0070749_10495958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 665 | Open in IMG/M |
| 3300006802|Ga0070749_10538050 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 634 | Open in IMG/M |
| 3300006802|Ga0070749_10550874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 625 | Open in IMG/M |
| 3300006802|Ga0070749_10753722 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 518 | Open in IMG/M |
| 3300006810|Ga0070754_10319690 | Not Available | 692 | Open in IMG/M |
| 3300006874|Ga0075475_10328233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 626 | Open in IMG/M |
| 3300006874|Ga0075475_10429842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 528 | Open in IMG/M |
| 3300006916|Ga0070750_10293977 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 696 | Open in IMG/M |
| 3300006916|Ga0070750_10366957 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 605 | Open in IMG/M |
| 3300006916|Ga0070750_10491077 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 504 | Open in IMG/M |
| 3300006919|Ga0070746_10287800 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 758 | Open in IMG/M |
| 3300006919|Ga0070746_10432707 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 586 | Open in IMG/M |
| 3300006921|Ga0098060_1198139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 549 | Open in IMG/M |
| 3300006924|Ga0098051_1159392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 595 | Open in IMG/M |
| 3300006928|Ga0098041_1061765 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1210 | Open in IMG/M |
| 3300006990|Ga0098046_1068052 | Not Available | 813 | Open in IMG/M |
| 3300007344|Ga0070745_1315278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 554 | Open in IMG/M |
| 3300007345|Ga0070752_1252471 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 685 | Open in IMG/M |
| 3300007538|Ga0099851_1049545 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1651 | Open in IMG/M |
| 3300007538|Ga0099851_1075164 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300007539|Ga0099849_1123987 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1015 | Open in IMG/M |
| 3300007540|Ga0099847_1171074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 641 | Open in IMG/M |
| 3300007540|Ga0099847_1205446 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 573 | Open in IMG/M |
| 3300007542|Ga0099846_1072853 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300007640|Ga0070751_1264667 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 649 | Open in IMG/M |
| 3300007640|Ga0070751_1328084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 565 | Open in IMG/M |
| 3300009001|Ga0102963_1163714 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 893 | Open in IMG/M |
| 3300009001|Ga0102963_1202904 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 790 | Open in IMG/M |
| 3300009472|Ga0115554_1443133 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 506 | Open in IMG/M |
| 3300009481|Ga0114932_10860620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 524 | Open in IMG/M |
| 3300009507|Ga0115572_10290657 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 928 | Open in IMG/M |
| 3300009703|Ga0114933_10263616 | Not Available | 1150 | Open in IMG/M |
| 3300010148|Ga0098043_1163614 | Not Available | 625 | Open in IMG/M |
| 3300010149|Ga0098049_1242549 | Not Available | 548 | Open in IMG/M |
| 3300010153|Ga0098059_1295088 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 620 | Open in IMG/M |
| 3300010153|Ga0098059_1320784 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 590 | Open in IMG/M |
| 3300010297|Ga0129345_1058691 | Not Available | 1463 | Open in IMG/M |
| 3300012920|Ga0160423_10262647 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1193 | Open in IMG/M |
| 3300017697|Ga0180120_10256734 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 709 | Open in IMG/M |
| 3300017716|Ga0181350_1041684 | Not Available | 1240 | Open in IMG/M |
| 3300017723|Ga0181362_1034414 | Not Available | 1076 | Open in IMG/M |
| 3300017737|Ga0187218_1159042 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 532 | Open in IMG/M |
| 3300017741|Ga0181421_1006677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 3250 | Open in IMG/M |
| 3300017743|Ga0181402_1127760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 649 | Open in IMG/M |
| 3300017751|Ga0187219_1231462 | Not Available | 502 | Open in IMG/M |
| 3300017757|Ga0181420_1057277 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300017758|Ga0181409_1243342 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 511 | Open in IMG/M |
| 3300017759|Ga0181414_1156053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 597 | Open in IMG/M |
| 3300017762|Ga0181422_1221412 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 565 | Open in IMG/M |
| 3300017765|Ga0181413_1212959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 575 | Open in IMG/M |
| 3300017768|Ga0187220_1052910 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1223 | Open in IMG/M |
| 3300017781|Ga0181423_1342212 | Not Available | 545 | Open in IMG/M |
| 3300017785|Ga0181355_1142634 | Not Available | 971 | Open in IMG/M |
| 3300017971|Ga0180438_10824789 | Not Available | 676 | Open in IMG/M |
| 3300018416|Ga0181553_10472298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 673 | Open in IMG/M |
| 3300020194|Ga0181597_10047228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 2738 | Open in IMG/M |
| 3300020276|Ga0211509_1028742 | Not Available | 1328 | Open in IMG/M |
| 3300021425|Ga0213866_10533289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 555 | Open in IMG/M |
| 3300021959|Ga0222716_10464019 | Not Available | 720 | Open in IMG/M |
| 3300021964|Ga0222719_10668779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 592 | Open in IMG/M |
| 3300021964|Ga0222719_10697268 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 574 | Open in IMG/M |
| 3300022063|Ga0212029_1011518 | Not Available | 1097 | Open in IMG/M |
| 3300022065|Ga0212024_1066781 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 637 | Open in IMG/M |
| 3300022067|Ga0196895_1006074 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300022068|Ga0212021_1116037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 548 | Open in IMG/M |
| 3300022069|Ga0212026_1015139 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1047 | Open in IMG/M |
| 3300022072|Ga0196889_1041013 | Not Available | 916 | Open in IMG/M |
| 3300022074|Ga0224906_1087687 | Not Available | 934 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10204970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 633 | Open in IMG/M |
| 3300024344|Ga0209992_10431281 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 515 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10578594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 523 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10477163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 527 | Open in IMG/M |
| 3300025072|Ga0208920_1009566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 2196 | Open in IMG/M |
| 3300025072|Ga0208920_1108416 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 502 | Open in IMG/M |
| 3300025101|Ga0208159_1049433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 877 | Open in IMG/M |
| 3300025102|Ga0208666_1122095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 616 | Open in IMG/M |
| 3300025102|Ga0208666_1142872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 542 | Open in IMG/M |
| 3300025109|Ga0208553_1019695 | Not Available | 1794 | Open in IMG/M |
| 3300025128|Ga0208919_1206618 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 587 | Open in IMG/M |
| 3300025137|Ga0209336_10177035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 542 | Open in IMG/M |
| 3300025141|Ga0209756_1065193 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300025647|Ga0208160_1112035 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 696 | Open in IMG/M |
| 3300025674|Ga0208162_1037962 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300025674|Ga0208162_1187643 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 535 | Open in IMG/M |
| 3300025759|Ga0208899_1048750 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300025759|Ga0208899_1178634 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 695 | Open in IMG/M |
| 3300025759|Ga0208899_1255152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 518 | Open in IMG/M |
| 3300025769|Ga0208767_1079764 | Not Available | 1381 | Open in IMG/M |
| 3300025769|Ga0208767_1106484 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1109 | Open in IMG/M |
| 3300025769|Ga0208767_1151334 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 844 | Open in IMG/M |
| 3300025803|Ga0208425_1019884 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300025816|Ga0209193_1131519 | Not Available | 596 | Open in IMG/M |
| 3300026267|Ga0208278_1088850 | Not Available | 715 | Open in IMG/M |
| 3300027621|Ga0208951_1173339 | Not Available | 551 | Open in IMG/M |
| 3300027917|Ga0209536_101162540 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 947 | Open in IMG/M |
| 3300028448|Ga0256383_104013 | Not Available | 1104 | Open in IMG/M |
| 3300029318|Ga0185543_1026859 | Not Available | 1317 | Open in IMG/M |
| 3300029787|Ga0183757_1026683 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300031673|Ga0307377_10455029 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 941 | Open in IMG/M |
| 3300031772|Ga0315288_10523402 | Not Available | 1164 | Open in IMG/M |
| 3300034374|Ga0348335_144763 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 660 | Open in IMG/M |
| 3300034374|Ga0348335_172284 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 561 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.41% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.21% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.59% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.59% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.72% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.72% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.86% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.86% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.86% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.86% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100634432 | 3300000117 | Marine | MEIDTITKKYFEGEAVSYDITYVNSNFKKCVPLDEANT |
| JGI24003J15210_100458923 | 3300001460 | Marine | MIDTVKKDYNIITNEFCGYQVTYVNSNRVKSVPLAEDNTDYQEILTWIADGGT |
| B570J29032_1097622122 | 3300002408 | Freshwater | MINTITKNYFLGKFVSYQVTYVDSNIQSSVPLDEANTDY |
| JGI25132J35274_10118891 | 3300002483 | Marine | MKINTIKKNYFDGEFVSYQITYVDSNVEKSVPLDTENTDYQ |
| JGI25133J35611_101824932 | 3300002514 | Marine | MKIDKITKNYNELGEFCSYQVELENSNRQISVPLAEDNTDYQA |
| Ga0075109_10648591 | 3300005912 | Saline Lake | MINTVTKIYDNFTNEFSGYQVTYTNSNVLASVPLDEANTDYQA |
| Ga0075511_16195062 | 3300006402 | Aqueous | MIDTVTKNYTDGEFQSYKITYVNSNRIKSVPLDPANTDYQ |
| Ga0098038_12962732 | 3300006735 | Marine | MIDTVTKNYSPDTNEFSSYQVTYVNSNKQKSVPQDEANTDY |
| Ga0098042_11360841 | 3300006749 | Marine | MINTVTKNYGIDNEFCSYQVTYVNSNFQKSVPLDEANTDYQAI |
| Ga0098042_11362152 | 3300006749 | Marine | MINTVTKNYFNGQFVSYQVTYVNSDRVSSVPLNEDNTDYQEIQ |
| Ga0098044_13938822 | 3300006754 | Marine | MINTVTKNYSAETNEFCSYQVTHVNSNIVKSVPLDEANTDYQ |
| Ga0070749_104408682 | 3300006802 | Aqueous | MIETVTKNYGINNEFCSYQVTYVNSNRVKSVPLDEANTDYQAI |
| Ga0070749_104959582 | 3300006802 | Aqueous | MIDTVTKNYDAITNEFVSYQVTYVNSNRVKSVPLDEA |
| Ga0070749_105380501 | 3300006802 | Aqueous | MIETVTKNYFENEFVSYQVTYVNSNIIKSVPLDEANT |
| Ga0070749_105508741 | 3300006802 | Aqueous | MINTITKVYDGEKLQCYTITYVNSNRVKSVPLDEANTDYQAIQEWI |
| Ga0070749_107537221 | 3300006802 | Aqueous | MIDIVTKNYFRGEFVSYTITYVNSNVQLSVPLDPAN |
| Ga0070754_103196901 | 3300006810 | Aqueous | MIETVTKNYLDGNFVSYQVTYVNYNMQKSVPLDEANTDYQA |
| Ga0075475_103282331 | 3300006874 | Aqueous | MINTVTKNYLNGEFVGYQVTYVNSNRVKSVPLDPAN |
| Ga0075475_104298421 | 3300006874 | Aqueous | MINTVTKIYDELTNTFDSYKVTYINSNIVKSVSLDPTNSD |
| Ga0070750_102939772 | 3300006916 | Aqueous | MINTVTKNYYNGEFCSYQVTYENSNVQLSVPLDEAN |
| Ga0070750_103669572 | 3300006916 | Aqueous | MIINTITKIYDIDNEFCSYQVTYVNSNIVSSVPLDEANKDY |
| Ga0070750_104910772 | 3300006916 | Aqueous | MMIETVTKNYDGITNEFCSYQVTYVNSNRVKSVPLDEANTDYQ |
| Ga0070746_102878002 | 3300006919 | Aqueous | MINTVTKNYFLREFVSYQITYENSNVSVSVPLDEANTDYQAIL |
| Ga0070746_104327072 | 3300006919 | Aqueous | MINTITKNYLDGEFVSYQVTYVNSNIVKSVPLTEA |
| Ga0098060_11981392 | 3300006921 | Marine | MINTVTKIYDNFTNEFSGYQVTYTSSNVLASVPLDEANTDYQE |
| Ga0098051_11593921 | 3300006924 | Marine | MINKIIMINTVTKNYNENNEFCSYQVTHVNSKVVTS |
| Ga0098041_10617652 | 3300006928 | Marine | MIDTVTKNYLSENFVSYKVTYQNSDIVKSVPLDEAN |
| Ga0098046_10680522 | 3300006990 | Marine | MKIDKITKNYNELGEFCSYQVELENSNRQISVPLDEA |
| Ga0070745_13152782 | 3300007344 | Aqueous | MINTVTKNYLNGEFVGYQVTYVNSNRVKSVPLDPANTDYQAIQ |
| Ga0070752_12524712 | 3300007345 | Aqueous | MINTVTKNYFLREFVSYQITYENSNVSVSVPLDEANTDYQAILTWIS |
| Ga0099851_10495451 | 3300007538 | Aqueous | MINTITKNYLDGEFVSYQVTYINSNKVKSVPLNSD |
| Ga0099851_10751643 | 3300007538 | Aqueous | MIDTVTKNYGINNEFCSYQVTYVNSNRVKSVPLDE |
| Ga0099849_11239872 | 3300007539 | Aqueous | MIETVTKNYLDGEFVSYQVTYVNSNRVKSVPLNEA |
| Ga0099847_11710742 | 3300007540 | Aqueous | MINTITKNYLNGEFISYTITYQNSNRTTSVPLDEA |
| Ga0099847_12054462 | 3300007540 | Aqueous | MMIETVTKNYLDGEFISYLVTYVNSNRVKSVPLNSENKDY |
| Ga0099846_10728532 | 3300007542 | Aqueous | MIDIVTKNYFRGEFVSYTITYVNSNVQLSVPLDPANSDYQAIQ |
| Ga0070751_12646671 | 3300007640 | Aqueous | MINTVTKNYDKTTNQFCSYQVTYSNGTTWSVPLDEANTDYQAI |
| Ga0070751_13280841 | 3300007640 | Aqueous | MINTVTKNYYLGEFVSYQVTYENSNVQLSVPLDPANTDYQ |
| Ga0099850_10895442 | 3300007960 | Aqueous | MKIDTITKIYFEGEVVSYDITYVNSNFKKSVPINEDNTDYQAIQ |
| Ga0102963_11637142 | 3300009001 | Pond Water | MIETVTKNYGINNEFVSYQITYVNSNRVKSVPLDE |
| Ga0102963_12029042 | 3300009001 | Pond Water | MEIDTITKTYFEGEAVSYDITYVNSNFRKSVPLDEANTDYQA |
| Ga0115554_14431332 | 3300009472 | Pelagic Marine | MIDTVTKNYLSENFVSYQVTYVNSNRVKSVPLDEANTDYQAIQ |
| Ga0114932_108606202 | 3300009481 | Deep Subsurface | MINTVTKNYLDGEFVSYQVTYVNSNIVSSVPLDTANSDYQAIQ |
| Ga0115572_102906572 | 3300009507 | Pelagic Marine | MINTVIKNYYLGEFKSYQVTYVGSNFEKSVPLDEAN |
| Ga0114933_102636161 | 3300009703 | Deep Subsurface | MTIDTVTKNYNDRNQFCSYQVTYVATNKTKSVPLDEANTDYQTIQEWAAI |
| Ga0098043_11636142 | 3300010148 | Marine | MIETVTKNYNSLNNEFCSYQVTYVNSNIVKSVPLDEANTD |
| Ga0098049_12425491 | 3300010149 | Marine | MTINTIKKNYFDGEFVSYQITYVDSNVEKSVPLDEANTDYQLIKQ* |
| Ga0098059_12950882 | 3300010153 | Marine | MINTVTKNYDITTNEFCSYQITYDDGKVTSVPLDEANTDYQAILTWISEG |
| Ga0098059_13207841 | 3300010153 | Marine | MINTVTKNYNMNNVFCSYQVTYVNSDKVNSVPLDEANTD |
| Ga0129345_10586911 | 3300010297 | Freshwater To Marine Saline Gradient | MINTVTKNYDKTTNQFCSYQVTYSNGTTWSVPLDEANSD |
| Ga0160423_102626471 | 3300012920 | Surface Seawater | MKINTIKKNYYNGEFVSYQITYVDSHVEKSVPLAEDNTDYQAIQQ |
| Ga0180120_102567342 | 3300017697 | Freshwater To Marine Saline Gradient | MINTITKNYLNGEFISYTITYQNSNRTTSVPLDEANTDYQAIQ |
| Ga0181350_10416842 | 3300017716 | Freshwater Lake | MINTVTKNYLRGQFVSYTITYVDSNKQLSVPLKEDNSDYQEIQKWI |
| Ga0181362_10344142 | 3300017723 | Freshwater Lake | MINTVTKNYLRGKFVSYTITYVDSNIQLSVPLEPAN |
| Ga0187218_11590422 | 3300017737 | Seawater | MINTVTKIYDMDNEFCSYQVTYVNSNIQKSVPLAEDNTDYQ |
| Ga0181421_10066771 | 3300017741 | Seawater | MISTVTKNYFLGEFVSYQVTYENGKEWSVPLDEANTDYQA |
| Ga0181402_11277601 | 3300017743 | Seawater | MINTVTKNYDENNEFCSYQVTYTNSNMVSSVPLDEANKDFFS |
| Ga0187219_12314621 | 3300017751 | Seawater | MINTVTKIYDNFTNEFSGYQITYTNSNVLASVPLDEANIDYQ |
| Ga0181420_10572772 | 3300017757 | Seawater | MINTVTKNYSPDTNEFSSYQVTYVNSNKQKSVPLDEANTDYQA |
| Ga0181409_12433422 | 3300017758 | Seawater | MIDTVTKIYDKIENVFDGYQVTYVNSNKVKFIPLAE |
| Ga0181414_11560531 | 3300017759 | Seawater | MINTVTKIYDMDNEFSSYQVTYVNSNIEKSVPLDEANTDY |
| Ga0181422_12214122 | 3300017762 | Seawater | MIDTVTKNYSPDTNEYSSYQVTYVSSTQQESVPLYEV |
| Ga0181413_12129592 | 3300017765 | Seawater | MIETITKNYVDGVFVSYQVTYINSNRIKSVPLDEANTDYQAIQEW |
| Ga0187220_10529102 | 3300017768 | Seawater | MINTVTKNYNVDNVFCSYQVTYDNGKVLYVPLGGGNTDY |
| Ga0181423_13422122 | 3300017781 | Seawater | MIDTVTKIYCLIENVFDGYQVTYVNSNRVKSVPLDEANTD |
| Ga0181355_11426341 | 3300017785 | Freshwater Lake | MINTITKNYFNGKFVSYQITYVNSNIQLSVPLEPANTDYQVIQKW |
| Ga0180438_108247891 | 3300017971 | Hypersaline Lake Sediment | MIDTVTKIYDNFTNEFSGYQVTYTNSNVLASVPLDP |
| Ga0181553_104722981 | 3300018416 | Salt Marsh | MGINTVTKNYNEKNEFCSYQVTYTNSNIIKSVPNDS |
| Ga0181597_100472286 | 3300020194 | Salt Marsh | MIDTVTKNYFLGEFVGYQVTYVDSNKQKSVPLDPANT |
| Ga0211509_10287421 | 3300020276 | Marine | MINTVTKIYDIFSNTFTSYKVTYVNSNIIKSVPLDEANTDYQ |
| Ga0213866_105332891 | 3300021425 | Seawater | MIETVTKNYLDGEFVSYQVTYVNSNRVKSVPLYEENTDYIAIQEW |
| Ga0222716_104640192 | 3300021959 | Estuarine Water | MISTVTKNYFLGEFVSYQVTYENGKEWSVPLDEANTDYQ |
| Ga0222719_106687792 | 3300021964 | Estuarine Water | MINTVTKNYDTTTNQFCSYQVTYLDGRILSVPLDEANTDYQAIQ |
| Ga0222719_106972682 | 3300021964 | Estuarine Water | MIETITKNYLDGEFTGYQVTYVNSNRVKSVPLDEANTDYQLIQ |
| Ga0212029_10115181 | 3300022063 | Aqueous | MIETVTKNYLDGEFVSYQVTYVNSNKVKSVPLSEFSS |
| Ga0212024_10667811 | 3300022065 | Aqueous | MIDTVTKNYGINNEFCSYQVTYTNTNRVKSVPLDPA |
| Ga0196895_10060741 | 3300022067 | Aqueous | MINTVTKNYNLDNVFCSYQVTYVNSNRVKSVPLDEANT |
| Ga0212021_11160372 | 3300022068 | Aqueous | MIDTITKIYNQNNEFCSYQVTYVNSNMQKSVPLDEANTDYQAI |
| Ga0212026_10151391 | 3300022069 | Aqueous | MIDTITKNYDLITNEFCSYQVTYVNSNREKSVPLDEANTDYQA |
| Ga0196889_10410132 | 3300022072 | Aqueous | MIDTITKNYLDGEFVSYQVTYVNSNIVSSVPLDEANSDYQD |
| Ga0224906_10876871 | 3300022074 | Seawater | MINTVTKIYDMDNEFSSYQVTYVNSNKVSSVPVAEDNSDYQAIQE |
| (restricted) Ga0233410_102049701 | 3300023276 | Seawater | MINTITKNYLEGEFVSYQVTYVNSNREKSVPLDEANT |
| Ga0209992_104312811 | 3300024344 | Deep Subsurface | MINTVTKNYLDGEFVSYQVTYVNSNIVSSVPLDTANSDYQ |
| (restricted) Ga0255049_105785941 | 3300024517 | Seawater | MIDTVTKNYSPDTNEFSSYQVTYVNSNRQKSVPLDTANTDYQTIQT |
| (restricted) Ga0255044_104771632 | 3300024529 | Seawater | MINTVTKNYHPIFNEFCSYQVTYVNSNLVKSVPLDEANSD |
| Ga0208920_10095661 | 3300025072 | Marine | MINTVTKNYVDEEFVSYQVTYVGTNRVKSVPLAEDNT |
| Ga0208920_11084162 | 3300025072 | Marine | MIDTVTKNYDGITNEFCGYQVTYVGTNRVKSVPLNEA |
| Ga0208159_10494332 | 3300025101 | Marine | MIDTVTKNYGINNEFCSYQVTYVNSNIVKSVPLDEANTDYQA |
| Ga0208666_11220951 | 3300025102 | Marine | MIINTITKKYVDGNFTSYKVTYVNSNREKSVPLAEDNTDYQAIQE |
| Ga0208666_11428722 | 3300025102 | Marine | MINTVTKNYGINNKFVSYQVTYLNSNRVKSVPLDEANTDYQAIQ |
| Ga0208553_10196951 | 3300025109 | Marine | MINTVTKNYFLGEFVSYQITYENSNVSVSVPLAEANTDYQA |
| Ga0209535_10891042 | 3300025120 | Marine | MIDTIEKIYNSITNEFSSYKITYVNSNIVKSVPIAEDNTDYQAI |
| Ga0208919_12066182 | 3300025128 | Marine | MIDTVTKNYLSENFVSYKVTYQNSDIVKSVPLDEANTDYQAIQEWAAID |
| Ga0209336_101770352 | 3300025137 | Marine | MIDTVKKDYNIITNEFCGYQVTYVNSNRVKSVPLAEDNTDYQEILTWIA |
| Ga0209756_10651933 | 3300025141 | Marine | MIETITKNYYLGEFISYQVTYVGTNFVKSVPLDEANKDY |
| Ga0208160_11120351 | 3300025647 | Aqueous | MIDTVTKNYGINNEFCSYQVTYVNSNRVKSVPLDEAN |
| Ga0208162_10379621 | 3300025674 | Aqueous | MINTITKNYNLDNVFCSYQVTYVNSNRVKSVPLDPANTDYQL |
| Ga0208162_11876431 | 3300025674 | Aqueous | MIETVTKNYLDGEFVSYQVTYVNSNRVKSVPLYEEN |
| Ga0208899_10487504 | 3300025759 | Aqueous | MIDTVTKNYSPDTNEFSSYQVTYVNSNKQKSVPLD |
| Ga0208899_11786341 | 3300025759 | Aqueous | MINTITKNYLEGEFVSYQITYVNSNREKSVPLDEANTDYQAI |
| Ga0208899_12551521 | 3300025759 | Aqueous | MNINTVTKIYDAIDNEFKCYKVTYVNSNRVKSVPLDP |
| Ga0208767_10797643 | 3300025769 | Aqueous | MINTITKNYYNGEFSSYTITYQNSNRVKSVPLDTANS |
| Ga0208767_11064841 | 3300025769 | Aqueous | MIDTVTKNYDAITNEFVSYQVTYVNSNRVKSVPLDEANSDYQAI |
| Ga0208767_11513342 | 3300025769 | Aqueous | MINTITKNYLEGEFVSYQITYVNSNREKSVPLDEANTDYQAIQE |
| Ga0208425_10198843 | 3300025803 | Aqueous | MINTVTKNYNLDNVFCSYQVTYVNSNRVKSVPLDEANK |
| Ga0209193_11315191 | 3300025816 | Pelagic Marine | MIETVTKNYADGVFVSYQVTYVNSNRVKSVPLDEANTDYQAIQEW |
| Ga0208278_10888501 | 3300026267 | Marine | MINTVTKNYFLGEFVSYQITYENSNVSVSVPLAEANTDYQAIQEW |
| Ga0208951_11733392 | 3300027621 | Freshwater Lentic | MIETIKKNYFSGKFVSYQITYVNSNIQLSVPLEPANTDYQVIQKWI |
| Ga0209536_1011625402 | 3300027917 | Marine Sediment | MIETVTKNYLDGEFVSYQVTHINSNIVKSVPLDEAKTDYQEI |
| Ga0256383_1040131 | 3300028448 | Seawater | MINTVTKNYGIDNRFCSYQVTYVNSNRVKSVPLDEANTDYQAI |
| Ga0185543_10268593 | 3300029318 | Marine | MINTVTKNYNVDNVFCSYQVTYDNGKVSSVPLDEANTDYQAIQ |
| Ga0183757_10266831 | 3300029787 | Marine | MIDTVTKNYSPDTNEFSSYQVTYVNSNKQKSVPLDEANT |
| Ga0307377_104550292 | 3300031673 | Soil | MMIDTVTKNYGIDNEFVSYQVTYVNSNRVKSVPLDEANSDYQTIQE |
| Ga0315288_105234022 | 3300031772 | Sediment | MINTITKNYYHGRFVSYTITYVDSNIIKSVPLSEDNTDYQS |
| Ga0348335_144763_529_660 | 3300034374 | Aqueous | MINTVTKNYDPINNEFMSYQVTYVGTNRVRSVPLDEANTDYQAI |
| Ga0348335_172284_438_560 | 3300034374 | Aqueous | MIDTITKIYNQNNEFCSYQVTYVNSNIQKSVPLDEANTDYQ |
| ⦗Top⦘ |