Basic Information | |
---|---|
Family ID | F078683 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 45 residues |
Representative Sequence | DAGTPLVESDPDSEAGRAITALAEAISATRREQGVGIVKSLPVLS |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.87 % |
% of genes near scaffold ends (potentially truncated) | 98.28 % |
% of genes from short scaffolds (< 2000 bps) | 92.24 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.379 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.276 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.448 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.207 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF02615 | Ldh_2 | 40.52 |
PF12710 | HAD | 4.31 |
PF08823 | PG_binding_2 | 2.59 |
PF07883 | Cupin_2 | 0.86 |
PF00420 | Oxidored_q2 | 0.86 |
PF00296 | Bac_luciferase | 0.86 |
PF02371 | Transposase_20 | 0.86 |
PF12706 | Lactamase_B_2 | 0.86 |
PF01839 | FG-GAP | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 40.52 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 2.59 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.38 % |
Unclassified | root | N/A | 8.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105821445 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300000881|JGI10215J12807_1144614 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300000956|JGI10216J12902_124609039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
3300001205|C688J13580_1008837 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300004114|Ga0062593_101837991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 667 | Open in IMG/M |
3300004114|Ga0062593_101997750 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300004643|Ga0062591_102343138 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300004643|Ga0062591_102576354 | Not Available | 536 | Open in IMG/M |
3300005093|Ga0062594_100704509 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300005166|Ga0066674_10377558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
3300005331|Ga0070670_101925607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300005336|Ga0070680_100862253 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300005338|Ga0068868_100237039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1532 | Open in IMG/M |
3300005341|Ga0070691_10233069 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300005366|Ga0070659_100822813 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005366|Ga0070659_101732326 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300005437|Ga0070710_11083170 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005456|Ga0070678_100834616 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300005457|Ga0070662_100076817 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
3300005466|Ga0070685_11303310 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005549|Ga0070704_100973977 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300005564|Ga0070664_101186706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
3300005587|Ga0066654_10867018 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005874|Ga0075288_1045021 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300006577|Ga0074050_12098303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300006606|Ga0074062_12808438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1443 | Open in IMG/M |
3300006755|Ga0079222_10005214 | All Organisms → cellular organisms → Bacteria | 4289 | Open in IMG/M |
3300006804|Ga0079221_10253433 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300006806|Ga0079220_10185425 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300006844|Ga0075428_100631886 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300009012|Ga0066710_100035576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5904 | Open in IMG/M |
3300009012|Ga0066710_101688457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 964 | Open in IMG/M |
3300009098|Ga0105245_10044259 | All Organisms → cellular organisms → Bacteria | 3973 | Open in IMG/M |
3300009156|Ga0111538_11588715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
3300009176|Ga0105242_10288329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1494 | Open in IMG/M |
3300009177|Ga0105248_10498621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1373 | Open in IMG/M |
3300009792|Ga0126374_11860924 | Not Available | 505 | Open in IMG/M |
3300010037|Ga0126304_10528654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300010038|Ga0126315_10085941 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300010041|Ga0126312_10777123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
3300010043|Ga0126380_11187092 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300010359|Ga0126376_10491549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
3300010366|Ga0126379_13753788 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010371|Ga0134125_10329663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
3300010399|Ga0134127_13494033 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010400|Ga0134122_12097892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
3300011994|Ga0120157_1100957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300012010|Ga0120118_1145576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300012198|Ga0137364_10461387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 953 | Open in IMG/M |
3300012198|Ga0137364_10791231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300012208|Ga0137376_10456046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1110 | Open in IMG/M |
3300012350|Ga0137372_10179403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1709 | Open in IMG/M |
3300012354|Ga0137366_10490574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 888 | Open in IMG/M |
3300012360|Ga0137375_10271421 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300012478|Ga0157328_1007345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
3300012681|Ga0136613_10037503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2785 | Open in IMG/M |
3300012897|Ga0157285_10011862 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300012911|Ga0157301_10329590 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300012912|Ga0157306_10020193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1421 | Open in IMG/M |
3300012948|Ga0126375_10540310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
3300012951|Ga0164300_10604924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300012955|Ga0164298_10112880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1461 | Open in IMG/M |
3300012958|Ga0164299_10790466 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012984|Ga0164309_11128319 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012987|Ga0164307_11337340 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012988|Ga0164306_10238306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1298 | Open in IMG/M |
3300013501|Ga0120154_1053797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 956 | Open in IMG/M |
3300013764|Ga0120111_1070298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
3300013772|Ga0120158_10098728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1763 | Open in IMG/M |
3300014166|Ga0134079_10432448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300017792|Ga0163161_11777886 | Not Available | 548 | Open in IMG/M |
3300018071|Ga0184618_10035606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1736 | Open in IMG/M |
3300018431|Ga0066655_10265825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
3300018431|Ga0066655_11161594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300018433|Ga0066667_11542933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
3300018482|Ga0066669_12108908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300020006|Ga0193735_1158690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300021082|Ga0210380_10016706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3095 | Open in IMG/M |
3300022883|Ga0247786_1010025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1743 | Open in IMG/M |
3300023102|Ga0247754_1186451 | Not Available | 522 | Open in IMG/M |
3300025898|Ga0207692_10441075 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300025905|Ga0207685_10580025 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025935|Ga0207709_10617105 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300025940|Ga0207691_11690608 | Not Available | 512 | Open in IMG/M |
3300025941|Ga0207711_11372663 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300025942|Ga0207689_11077037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300025949|Ga0207667_12035599 | Not Available | 534 | Open in IMG/M |
3300026078|Ga0207702_11988991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300026295|Ga0209234_1087593 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300026295|Ga0209234_1176901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 745 | Open in IMG/M |
3300026827|Ga0207591_100788 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300027484|Ga0207458_1009381 | Not Available | 536 | Open in IMG/M |
3300028710|Ga0307322_10128454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300028711|Ga0307293_10247576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300028713|Ga0307303_10033605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1038 | Open in IMG/M |
3300028771|Ga0307320_10058681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1428 | Open in IMG/M |
3300028787|Ga0307323_10172836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300028790|Ga0307283_10010036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1791 | Open in IMG/M |
3300028793|Ga0307299_10102402 | Not Available | 1070 | Open in IMG/M |
3300028799|Ga0307284_10027028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1893 | Open in IMG/M |
3300028811|Ga0307292_10196651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
3300028814|Ga0307302_10241142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300028819|Ga0307296_10008784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5291 | Open in IMG/M |
3300028828|Ga0307312_11144928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300028876|Ga0307286_10069170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1215 | Open in IMG/M |
3300028878|Ga0307278_10001466 | All Organisms → cellular organisms → Bacteria | 11736 | Open in IMG/M |
3300028885|Ga0307304_10265233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300031548|Ga0307408_102214425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300031820|Ga0307473_10768653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300031938|Ga0308175_101044094 | Not Available | 904 | Open in IMG/M |
3300031965|Ga0326597_10315941 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300032000|Ga0310903_10741300 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300032126|Ga0307415_100625841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 961 | Open in IMG/M |
3300032892|Ga0335081_12168757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300033475|Ga0310811_11322097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.03% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.31% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.86% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
3300027484 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1058214452 | 3300000364 | Soil | DAGTPLVESDPDSEAGRAITALAEAISATRREQGVGIVKSLPVLS* |
JGI10215J12807_11446143 | 3300000881 | Soil | EAGDEGAPLVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG* |
JGI10216J12902_1246090391 | 3300000956 | Soil | VESDPGSEAARAIAELAGAIAATRREQGVGIVKSLPVLS* |
C688J13580_10088371 | 3300001205 | Soil | GDAGVPLVESDPSSEAGLAITALADAISATKREQGVGIVKSLPVLS* |
Ga0062593_1018379911 | 3300004114 | Soil | GSPIVVGDPESPSAEAIVALAEAIEGTRREQGVGIVKALPVVS* |
Ga0062593_1019977502 | 3300004114 | Soil | VESDPDAEPARAITALADAIVATKREQGVGIVKSLPVLS* |
Ga0062591_1023431381 | 3300004643 | Soil | DVGTPLVESAPDSDAGRAITALAEAIVGTKREQGIGIVKSLPVLS* |
Ga0062591_1025763541 | 3300004643 | Soil | LVESDPDSNAGRAITALAEAIAATKREQGVGIVKPLPVLG* |
Ga0062594_1007045091 | 3300005093 | Soil | GDEGVPIVERDPESEPARAIAALADAIVATKREQGVGIVKSLPVLS* |
Ga0066674_103775582 | 3300005166 | Soil | DAGEPLVESDPDSEPAQAIVSIAEAIAATRREQGVGIVKSLPVLS* |
Ga0070670_1019256072 | 3300005331 | Switchgrass Rhizosphere | TPLVSADPASPTARAIVALAEAIDDTRREEGVGIVKALPVLS* |
Ga0070680_1008622531 | 3300005336 | Corn Rhizosphere | RVRESGDAGTPLVESDPGSEAALAINALAEAISATRREQGVGIVKSLPVLS* |
Ga0068868_1002370394 | 3300005338 | Miscanthus Rhizosphere | RVRESGDAGTPLVESDPGSEAALAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0070691_102330693 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VRESGDAGTPLVESDPGSEAALAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0070659_1008228131 | 3300005366 | Corn Rhizosphere | LRESGDAGTPLVESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0070659_1017323261 | 3300005366 | Corn Rhizosphere | GDAGTPLVDSDPDSEAGRAITAIAEAISATRREEGVGIVKSLPVLS* |
Ga0070710_110831702 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DEGVPIVERDPESEPARAIAALADAIVATKREQGVGIVKSLPVLS* |
Ga0070678_1008346163 | 3300005456 | Miscanthus Rhizosphere | RVRESGDAGTPLVESDPGSEAGLAITALAEAISVTRREQGVGIVKSLPVLS* |
Ga0070662_1000768175 | 3300005457 | Corn Rhizosphere | TPLVESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0070685_113033101 | 3300005466 | Switchgrass Rhizosphere | PLVESAPDSEAGRAITALANAIAATKREQGVGIVKSLPVLS* |
Ga0070704_1009739771 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GVPLVESDPDSEPARAITEVADAIAASRREQGVGIVKALPVLS* |
Ga0070664_1011867062 | 3300005564 | Corn Rhizosphere | ESEPARAIAALADAIVATKREQGVGIVKSLPVLS* |
Ga0066654_108670181 | 3300005587 | Soil | RESGDAGVPLVESDPGSDAGRAILALAEAIVATKREQGVGIVKSLPVLS* |
Ga0075288_10450211 | 3300005874 | Rice Paddy Soil | RLRESGDAGTPLVESDPDSEAGRALTVIAEAISATRREQGVGIVKSLPVLS* |
Ga0074050_120983032 | 3300006577 | Soil | GDLGTPLVSADPSSPTARAIVELAEAIDGTHREEGVGIVKALPVLS* |
Ga0074062_128084381 | 3300006606 | Soil | VRESGDAGTPIVESDPGSEAAVAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0079222_100052148 | 3300006755 | Agricultural Soil | GDMGVPLVESAPDSEAGRAITALANAIAATKREQGVGIVKSLPVLS* |
Ga0079221_102534331 | 3300006804 | Agricultural Soil | GDAGTPLVESAPDSEAGRAITALAEAIVGTKREQGIGIVKSLPVLS* |
Ga0079220_101854253 | 3300006806 | Agricultural Soil | PLLRESGDMGVPLVESAPDSEAGRAITALANAIAATKREQGVGIVKSLPVLS* |
Ga0075428_1006318861 | 3300006844 | Populus Rhizosphere | LREAGDEGAPLVETDPEAEPAREIIAAAEAISGAKREQGVGIVKSLPVVG* |
Ga0066710_1000355769 | 3300009012 | Grasslands Soil | VERDPDSEPAQALASLAEAITATKREEGVGIVKALPVLG |
Ga0066710_1016884572 | 3300009012 | Grasslands Soil | ARLREAGDAGEPLVESDPDAEPARLITEIAEAIAATRREQGVGIVKALPVLQ |
Ga0105245_100442591 | 3300009098 | Miscanthus Rhizosphere | ESAPDSEAGRAISALADAIAATKREQGVGIVKSLPVLS* |
Ga0066709_1037645611 | 3300009137 | Grasslands Soil | DPRLREQGDAGEPLAAADPPAPSARAILELAERISATRRERGVGIVKQLPVVA* |
Ga0111538_115887152 | 3300009156 | Populus Rhizosphere | RSEPARAIVEAAEAITASRREQGVGIVKALPVLS* |
Ga0105242_102883294 | 3300009176 | Miscanthus Rhizosphere | DAGTPLVESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0105248_104986211 | 3300009177 | Switchgrass Rhizosphere | PLVESDPGSEAALAITALAEAISVTRREQGVGIVKSLPVLS* |
Ga0126374_118609241 | 3300009792 | Tropical Forest Soil | DRRLRESGDAGDPLVDSDPGAEPAQAITSLAEAIAATKREEGVGIVKALPVLS* |
Ga0126304_105286542 | 3300010037 | Serpentine Soil | EQGDLGSPLVVADRGSPTARAIVALAEAIDGTRREEGVGIVKALPVLS* |
Ga0126315_100859413 | 3300010038 | Serpentine Soil | LREAGDDGAPLVETDPDSEPAQAIFAAAEAIVATKREQGVGIVKSLPVVG* |
Ga0126312_107771232 | 3300010041 | Serpentine Soil | PLVVAEPDAPTSRAIVDVADAIERSRRDEGVGIVKALPVLS* |
Ga0126380_111870922 | 3300010043 | Tropical Forest Soil | PVVERDPDSEPARAMIALAEAIVATKREQGIGIVKSLPVLS* |
Ga0126376_104915491 | 3300010359 | Tropical Forest Soil | RDPDSEPARAMIALAEAIVATKREQGVGIVKPLPVLS* |
Ga0126379_137537882 | 3300010366 | Tropical Forest Soil | VERDPDSEPARAMIALAEAIVATKREQGVGIVKPLPVLS* |
Ga0134125_103296634 | 3300010371 | Terrestrial Soil | ESGDAGTPLVESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0134127_134940332 | 3300010399 | Terrestrial Soil | GVPLVESAPDSEAGRAITALADAIAATKREQGVGIVKSLPVLS* |
Ga0134122_120978921 | 3300010400 | Terrestrial Soil | VPLVESDPDSEPARAIVEVADAIAASRREQGVGIVKALPVLS* |
Ga0120157_11009572 | 3300011994 | Permafrost | CLRESGDAAVPLVESDPDSEPAQAIFEVAEAITASKREQGVGIVKALPVLS* |
Ga0120118_11455762 | 3300012010 | Permafrost | AGVPLVESDPDCEPAQAIFEVAEAITASKREQGVGIVKALPVLS* |
Ga0137364_104613871 | 3300012198 | Vadose Zone Soil | REAGDAGEPLVESDPESEPARAITAIAESIAAAKREEGVGIVKPLPLVS* |
Ga0137364_107912312 | 3300012198 | Vadose Zone Soil | LVESDPKSEPARAITAIAETIAAAKREQGVGIVKSLPLVS* |
Ga0137376_104560463 | 3300012208 | Vadose Zone Soil | LREAGDAGEPLVESHPDAEPARAIMEIADAIAATRREQGVGIVKSLPVLS* |
Ga0137372_101794033 | 3300012350 | Vadose Zone Soil | AGEPLVESDPESEPAQAIASIAEAIAATRREQGVGIVKSLPLVS* |
Ga0137366_104905741 | 3300012354 | Vadose Zone Soil | DLGEPLVERDPESEPAQAIVEIAEAIAATKREQGVGIVKSLPVLS* |
Ga0137375_102714211 | 3300012360 | Vadose Zone Soil | RLREAGDLGEPLVERDPESEPAQAIVEIAEAIAATKREQGVGIVKSLPVLS* |
Ga0157328_10073451 | 3300012478 | Arabidopsis Rhizosphere | ATPTLESEPARAIAEVAEAITASRREQGVGIVKALPVLS* |
Ga0136613_100375031 | 3300012681 | Polar Desert Sand | GDLGMPLVTADPGSPTSRAIVELAEAIDATRREEGVGIVKALPVLS* |
Ga0157285_100118623 | 3300012897 | Soil | LVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG* |
Ga0157301_103295902 | 3300012911 | Soil | AGDEGVPLVESDPDSEPARAIAAVAEAIVASRREQGVGIVKSLPLVG* |
Ga0157306_100201933 | 3300012912 | Soil | EGAPLVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG* |
Ga0126375_105403102 | 3300012948 | Tropical Forest Soil | LVEGDPDAEPARAISAVAEAIVGTKREQGVGIVKSLPLVG* |
Ga0164300_106049242 | 3300012951 | Soil | ARLRESGDQGEPIVESDPDAEPAQAITAIADAIAATKREQGVGIVKALPVLQ* |
Ga0164298_101128801 | 3300012955 | Soil | LVESDPDSDAGRAITALAEAIVASKREQGVGIVKSLPVLS* |
Ga0164299_107904661 | 3300012958 | Soil | ESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS* |
Ga0164309_111283191 | 3300012984 | Soil | AGDEGVPIVERDPESEPARAIAALAEAIVATKREQGVGIVKSLPVLS* |
Ga0164307_113373402 | 3300012987 | Soil | VPIVERDPESEPARAIAALAEAIVATKREQGVGIVKSLPVLS* |
Ga0164306_102383063 | 3300012988 | Soil | VERDPESEPARAIAALADAIVATKREQGVGIVKSLPVLS* |
Ga0120154_10537971 | 3300013501 | Permafrost | GDAGVPLVESDPDCEPAQAIFEVAEAITASRREQGVGIVKALPVLS* |
Ga0120111_10702981 | 3300013764 | Permafrost | CLRESGDAGVPLVESDPDSVPARAITEIAETITASKREQGVGIVKALPVLS* |
Ga0120158_100987281 | 3300013772 | Permafrost | VESDPDCEPAQAIFEVAEAITASKREQGVGIVKALPVLS* |
Ga0134079_104324482 | 3300014166 | Grasslands Soil | DAGEPLVESDPDAEPARLITEIAEAIAATRREQGVGIVKALPVLQ* |
Ga0163161_117778861 | 3300017792 | Switchgrass Rhizosphere | LDPRVRESGDAGTPLVESDPGSEAGLAITALAEAISATRREQGVGIVKSLPVLS |
Ga0184618_100356061 | 3300018071 | Groundwater Sediment | REAGDVGVPLVESDPASEPARAITALAEAIDATKREQGVGIVKSLPVLS |
Ga0066655_102658253 | 3300018431 | Grasslands Soil | DAGQPLVESDPESETARAITSLAEAIAATKREEGVGIVKALPVLS |
Ga0066655_111615942 | 3300018431 | Grasslands Soil | DPGAEPARAIMEIAEAIAASRREEGVGFVKSLPVLS |
Ga0066667_115429332 | 3300018433 | Grasslands Soil | ESDPGAEPARAIMEIAEAIAASRREEGVGFVKSLPVLS |
Ga0066669_121089081 | 3300018482 | Grasslands Soil | ESGDAAEPLVESDPDSEPAQAIASLAEAIAATKREEGVGIVKALPVLG |
Ga0193735_11586901 | 3300020006 | Soil | AGDAGVPLVESDPDSEPARAIIEVADAIAASRREQGVGIVKALPVLS |
Ga0210380_100167061 | 3300021082 | Groundwater Sediment | RLREQGDLGTPLVSADPSSPTARAIVELAEAIDATRREEGVGIVKALPVLS |
Ga0247786_10100251 | 3300022883 | Soil | EAGDEGAPLVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG |
Ga0247754_11864511 | 3300023102 | Soil | GDEGAPLVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG |
Ga0207692_104410752 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RDPDSEPARAISALADAIVATRREQGVGIVKSLPVLS |
Ga0207685_105800251 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ESGDEGVPIVERDPDSEPARAISALADAIVATRREQGVGIVKSLPVLS |
Ga0207709_106171051 | 3300025935 | Miscanthus Rhizosphere | PLVDSDPDSEAGRAITGIAEAISATRREEGVGIVKSLPVLS |
Ga0207691_116906083 | 3300025940 | Miscanthus Rhizosphere | SGDAGTPLVESDPGSEAALAITALAEAISATRREQGVGIVKSLPVLS |
Ga0207711_113726631 | 3300025941 | Switchgrass Rhizosphere | DAGVPLVESDPDSDAGRAIIALAEAIVATKREQGIGIMKSLPVLS |
Ga0207689_110770371 | 3300025942 | Miscanthus Rhizosphere | SDPDCEPARAIIEVADAIAASRREQGVGIVKALPVLS |
Ga0207667_120355992 | 3300025949 | Corn Rhizosphere | ETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG |
Ga0207702_119889912 | 3300026078 | Corn Rhizosphere | LREAGDQGEPLVESDPDAEPAQAITAIADAIAATKREQGVGIVKALPVLQ |
Ga0209234_10875931 | 3300026295 | Grasslands Soil | GDAGEPLVESDPESEPARAITAIAETIVAAKREQGVGIVKPLPLVS |
Ga0209234_11769012 | 3300026295 | Grasslands Soil | GDAGEPLVESDPESEPARAITAIAETIVAAKREQGVGIVKSLPLVS |
Ga0207591_1007882 | 3300026827 | Soil | VLAGKDGREAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG |
Ga0207458_10093812 | 3300027484 | Soil | LREAGDEGAPLVETDPEAEPAREIIAAAEAIAGAKREQGVGIVKSLPVVG |
Ga0307322_101284541 | 3300028710 | Soil | SDPDCEPARAIFEVAEAITASKREQGVGIVKALPVLS |
Ga0307293_102475761 | 3300028711 | Soil | SDPDSEPARAIIEVADVIAASRREQGVGIVKALPVLS |
Ga0307303_100336052 | 3300028713 | Soil | PLVESDPDCEPARAIFEVAEAITASKREQGVGIVKALPVLS |
Ga0307320_100586811 | 3300028771 | Soil | EAGDAGVPLVESDPDSEPARAIIEVADVIAASRREQGVGIVKALPVLS |
Ga0307323_101728361 | 3300028787 | Soil | DPGSETARAITCLAETIAATQREEGVGIVKALPVLS |
Ga0307283_100100361 | 3300028790 | Soil | ESGDAGTPLVESDPDSDAGRAIMAVAEAIVASKREQGVGIVKSLPVLS |
Ga0307299_101024022 | 3300028793 | Soil | ARLREAGDVGVPLVESDPDSEPARAITALAEAIDATKREQGVGIVKSLPVLS |
Ga0307284_100270284 | 3300028799 | Soil | RRSGDLGEPLVESDPESEPAQAIFALAEAIAATKREEGVGIVKALPVLS |
Ga0307292_101966511 | 3300028811 | Soil | DPGSETARAITCLAEAFAATQREEGVGIVKALPVLS |
Ga0307302_102411421 | 3300028814 | Soil | REQGDLGTPLVSADPSSPTARAIVELAEAIDGTRREEGVGIVKALPVLS |
Ga0307296_100087849 | 3300028819 | Soil | ESDPDSEAGRALTAIAEAISATRREQGVGIVKSLPVLS |
Ga0307312_111449282 | 3300028828 | Soil | DARLRRSGDLGEPLVESDPESEPAQAIFALAEAIAATKREEGVGIVKALPVLS |
Ga0307286_100691703 | 3300028876 | Soil | PISPTARAIVELAEAIDGTRREEGVGIVKALPVLS |
Ga0307278_1000146615 | 3300028878 | Soil | DAGTPLVESDPDCEPARAIFEVAEAITASKREQGVGIVKALPVLS |
Ga0307304_102652332 | 3300028885 | Soil | DAGTPLVESDPDCEPARAIFEVAEVITASKLEQGVGIVKALPVLS |
Ga0307408_1022144251 | 3300031548 | Rhizosphere | EGAPLVETDPDAESTQAILAAAEAIVATKREQGVGIVKSLPVVG |
Ga0307473_107686532 | 3300031820 | Hardwood Forest Soil | RESGDAGEPIVESDPDAEPARAIVEIAEAIAATRREQGVGIVKSLPVLS |
Ga0308175_1010440942 | 3300031938 | Soil | LIERDPGSEPARAIAAIAEAIVATRREQGIGIVKSLPLVG |
Ga0326597_103159413 | 3300031965 | Soil | SRLRECGDAGEPLVWAEPESETARAIWAIAEAIAATEREKGVGIVKPLPVLS |
Ga0310903_107413001 | 3300032000 | Soil | LREAGDEGAPLVETDPDCEPAREILAAAEAIVGAKREQGVGIVKSLPVLS |
Ga0307415_1006258412 | 3300032126 | Rhizosphere | ARLREAGDDGAPLVETDPDSEPAQAIFAAAEAIVATKREQGVGIVKSLPVVG |
Ga0335081_121687571 | 3300032892 | Soil | DAGEPLVESDPGAEPARAIMEIAEAIAATRREQGVGIVKPLPVVS |
Ga0310811_113220971 | 3300033475 | Soil | SGDQGEPLVESDPDAEPAQAITAIADAIAATKREQGVGIVKALPVLQ |
⦗Top⦘ |