Basic Information | |
---|---|
Family ID | F078672 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 47 residues |
Representative Sequence | VSEQKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREIYFQFYKETYKP |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.14 % |
% of genes near scaffold ends (potentially truncated) | 99.14 % |
% of genes from short scaffolds (< 2000 bps) | 98.28 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.138 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (9.483 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.138 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (27.586 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.18% β-sheet: 0.00% Coil/Unstructured: 81.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF12695 | Abhydrolase_5 | 16.38 |
PF12146 | Hydrolase_4 | 16.38 |
PF12697 | Abhydrolase_6 | 6.90 |
PF08386 | Abhydrolase_4 | 6.03 |
PF02627 | CMD | 0.86 |
PF13291 | ACT_4 | 0.86 |
PF00196 | GerE | 0.86 |
PF03176 | MMPL | 0.86 |
PF01713 | Smr | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.86 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.86 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.86 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.14 % |
Unclassified | root | N/A | 0.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig26787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0559458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100204195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300001213|JGIcombinedJ13530_104624102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106236971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300004009|Ga0055437_10060642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
3300004022|Ga0055432_10218838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300004157|Ga0062590_100079771 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300004157|Ga0062590_100612951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
3300004157|Ga0062590_103047243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300004463|Ga0063356_104227030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300004463|Ga0063356_105262887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300004808|Ga0062381_10082595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
3300005093|Ga0062594_101013818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300005180|Ga0066685_11079042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300005181|Ga0066678_10184964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
3300005356|Ga0070674_101500128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300005441|Ga0070700_100605856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
3300005444|Ga0070694_100062105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2552 | Open in IMG/M |
3300005447|Ga0066689_10396414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300005459|Ga0068867_101747732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300005471|Ga0070698_101917091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300005518|Ga0070699_101017200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300005546|Ga0070696_101039882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
3300005552|Ga0066701_10223123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
3300005558|Ga0066698_10397455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300005598|Ga0066706_10330646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
3300005840|Ga0068870_11311159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300006604|Ga0074060_11280176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300006844|Ga0075428_101657571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300006845|Ga0075421_102620080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300006853|Ga0075420_100473530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
3300006854|Ga0075425_101367779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300006894|Ga0079215_11167508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300009031|Ga0103682_10683208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
3300009091|Ga0102851_12580821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300009094|Ga0111539_11576108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300009147|Ga0114129_11433461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
3300009168|Ga0105104_10741322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300010046|Ga0126384_11808831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300010360|Ga0126372_11296067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300010373|Ga0134128_12535256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300010397|Ga0134124_12965250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300010400|Ga0134122_12899679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300011120|Ga0150983_10103468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
3300011413|Ga0137333_1082492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300011429|Ga0137455_1136857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300011440|Ga0137433_1205625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300012043|Ga0136631_10394032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300012164|Ga0137352_1106647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300012360|Ga0137375_11158331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300012530|Ga0136635_10053968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
3300012913|Ga0157298_10193454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
3300012915|Ga0157302_10562841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300012931|Ga0153915_13283157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300012975|Ga0134110_10155358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 946 | Open in IMG/M |
3300014154|Ga0134075_10577823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300014260|Ga0075307_1133370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300014299|Ga0075303_1088952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300014885|Ga0180063_1030470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
3300017966|Ga0187776_11175070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300018061|Ga0184619_10036641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2091 | Open in IMG/M |
3300018074|Ga0184640_10455638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300018422|Ga0190265_12964878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300019361|Ga0173482_10746722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300019377|Ga0190264_11823949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300022413|Ga0224508_10869268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300022534|Ga0224452_1289561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300025165|Ga0209108_10383531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300025910|Ga0207684_10929773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
3300025965|Ga0210090_1052687 | Not Available | 555 | Open in IMG/M |
3300026075|Ga0207708_11527699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300026089|Ga0207648_11911056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300026537|Ga0209157_1371059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300027384|Ga0209854_1030704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 895 | Open in IMG/M |
3300027717|Ga0209998_10125246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 650 | Open in IMG/M |
3300027778|Ga0209464_10257787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300027841|Ga0209262_10359487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300027843|Ga0209798_10199784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300027869|Ga0209579_10430080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300027871|Ga0209397_10622042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300027909|Ga0209382_11070890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300028380|Ga0268265_10912309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300028381|Ga0268264_11983526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300028793|Ga0307299_10083934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
3300029923|Ga0311347_10698910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300029987|Ga0311334_11947766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300030336|Ga0247826_10102247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1786 | Open in IMG/M |
3300031277|Ga0307425_1104597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300031858|Ga0310892_10550075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300031997|Ga0315278_10878999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300032003|Ga0310897_10698630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300032012|Ga0310902_10975069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300032075|Ga0310890_10809788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300032180|Ga0307471_101669517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300032262|Ga0316194_10461474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300032273|Ga0316197_10100812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1785 | Open in IMG/M |
3300032342|Ga0315286_10229797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1978 | Open in IMG/M |
3300032342|Ga0315286_11199608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300032516|Ga0315273_10582903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
3300032770|Ga0335085_11040789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300032770|Ga0335085_12178710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300033004|Ga0335084_11813660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300033406|Ga0316604_10782275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300033418|Ga0316625_102629201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300033419|Ga0316601_100678407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
3300033433|Ga0326726_11174681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
3300033480|Ga0316620_11751275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300033482|Ga0316627_101065996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300033485|Ga0316626_10654475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300033513|Ga0316628_101223405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
3300033521|Ga0316616_103347154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300033550|Ga0247829_11534575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300033812|Ga0364926_053883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300034148|Ga0364927_0094158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300034257|Ga0370495_0263306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.17% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.31% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.59% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.59% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.59% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.72% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.72% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.86% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.86% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.86% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.86% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.86% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.86% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.86% | |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009031 | Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031277 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_02028430 | 2124908016 | VSDETAKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREVYFQFYKETYKPSVLDR | |
ICChiseqgaiiDRAFT_05594581 | 3300000033 | Soil | VIEEKKGHHVPFPEEDNGAPRAPEQSSSYTMVDPRFR |
JGIcombinedJ13530_1002041951 | 3300001213 | Wetland | VSDKKPHHQPFPEDDDGGARPQPTSYTMVEPRFRE |
JGIcombinedJ13530_1046241021 | 3300001213 | Wetland | VSEDKAAHHHQPFPEDDNGAAHPQPTSYTMVEPRFREIYFQF |
JGIcombinedJ13530_1062369711 | 3300001213 | Wetland | VSEEKPHHQPFPEDEEGAPRPQPTSYTMVEPRFREIYFQ |
Ga0055437_100606421 | 3300004009 | Natural And Restored Wetlands | MSDDAKKSHSPFPLEDNGTAKPPEQTNSYTMVDPRFREIYFQFYKETYKPSVLDR |
Ga0055432_102188382 | 3300004022 | Natural And Restored Wetlands | VSDEKKAHHVPFPEDENGASKPQPSSYTMVDPRFREIYFQFYKETYKPSV |
Ga0062590_1000797711 | 3300004157 | Soil | MSEEKKRAPQKKHPVPFPEDDNGGPKPPEQSGSYTMVDPRFREIYFQFYKE |
Ga0062590_1006129511 | 3300004157 | Soil | VSEEKKGHHIPFPEEDNGAPRAPEQSRSYTMVDPRFREIYFQFYKETYK |
Ga0062590_1030472431 | 3300004157 | Soil | VTEEKPRHVPFPEEDNGAPKPPEQSGSYTMVDPRFREIYFQ |
Ga0063356_1042270302 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LTDEKTRHVPFPEEDNGAPRAPEQTGSYTMVDPRFREIYFQFYKETYKPSVLD |
Ga0063356_1052628871 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFYKET |
Ga0062381_100825951 | 3300004808 | Wetland Sediment | VSDEKPHHRPFPEDEEGVPRPQPSSYTMVDPRFREIYFQFYKETYKPSVLDRK |
Ga0062594_1010138181 | 3300005093 | Soil | VSEQDHKKHHVPFPEEDNGEARTQPTSYTMVDPRFREIYFQFYKETYK |
Ga0066685_110790421 | 3300005180 | Soil | VSEQDHKKHHVPFPEEDNGEAKPQPTSYTMVEPRFREIYFQFYKETYKP |
Ga0066678_101849642 | 3300005181 | Soil | MSEEKKHPPEKKHPVPFPEDDNGGPKPPEQTGSYTMVEPRFREIYFQFYKETYKP |
Ga0070674_1015001281 | 3300005356 | Miscanthus Rhizosphere | VTDDKTRHVPFPEDDNGAPKPPEQSGSYTMVDPRFREIYFQFYKE |
Ga0070700_1006058561 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQKKHPVPFPEDDNGGTKPPEQTGSYTMVDPRFREIYFQFYKETYK |
Ga0070694_1000621053 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEQDHKKHHVPFPEEDNGEARTQPTSYTMVDPRFREIYFQFYKET |
Ga0066689_103964142 | 3300005447 | Soil | MSEEKKHPPEKKHPVPFPEDDNGGPKPPEQTGSYTMVEPRFREIYFQFYKET |
Ga0068867_1017477322 | 3300005459 | Miscanthus Rhizosphere | MSEQKKHPVPFPEEDNGGPKPPEQTGSYTMVDPRFREIYFQFYKETYKPSV |
Ga0070698_1019170911 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEEKKGHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREIYFQFYKETYK |
Ga0070699_1010172002 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEEKKGHHVPFPEEDNGAPRAPEQSSSYTMVDPRFREIYFQFYKETYK |
Ga0070696_1010398821 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEEKKPHHQPFPDDNGEAQQAATSYTMVDPRFRNIYFQFYKETYKPSV |
Ga0066701_102231232 | 3300005552 | Soil | VSEEKKPHHVPFPEEDNGAPRAPDQASSYTMVEPRFREI |
Ga0066698_103974552 | 3300005558 | Soil | VSEQKKPHHVPFPEEDNGAPRSPDQTGSYTMVEPRF |
Ga0066706_103306462 | 3300005598 | Soil | MSEEKKHPPEKKHPVPFPEDDNGGPKPPEQTGSYTMVEPRFREIYFQFYKETYKASTLD |
Ga0068870_113111592 | 3300005840 | Miscanthus Rhizosphere | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFYKETYKPSV |
Ga0074060_112801762 | 3300006604 | Soil | MSDHPKAHHAPFPEEDNGDRAQPSSYTMVDPRFREIYFQFYKETY |
Ga0075428_1016575712 | 3300006844 | Populus Rhizosphere | VSEQKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREIYFQFYKETYKP |
Ga0075421_1026200801 | 3300006845 | Populus Rhizosphere | VTEEKKHHHQPFPDDNGEAQPGSTSYTMVDPRFRNI |
Ga0075420_1004735302 | 3300006853 | Populus Rhizosphere | VSDSKDHRHQPFPEEDEGKASPQPTSYTMVDPRFREIYFQFYKETYKPS |
Ga0075425_1013677791 | 3300006854 | Populus Rhizosphere | VSEEKKPHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREI |
Ga0079215_111675082 | 3300006894 | Agricultural Soil | MSEPAFKKKLPEEAVVSEKKHHVPFPEEDDGSPKAPEQTGSYSMIPPRFREIYFQFYKES |
Ga0103682_106832082 | 3300009031 | Groundwater | MIRGAETRSPTVSDEKPHHQPFPEDEEGAPHPQPSSYTMVDPRFREIYLQFYKETYKPS |
Ga0102851_125808212 | 3300009091 | Freshwater Wetlands | VRDQKPHHQPFPEDDNGAARPQPTSYTMVEPRFRDVYFQFYKETY |
Ga0111539_115761081 | 3300009094 | Populus Rhizosphere | VSEEAAKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREVYFQFYKETYKPSV |
Ga0114129_114334612 | 3300009147 | Populus Rhizosphere | VSEDKKAHHVPFPEEDNGAARPPAQTGSYTMVEPRFREIYFQFYKETYKPSVLDRK |
Ga0105104_107413221 | 3300009168 | Freshwater Sediment | VTDEKPHHQPFPEDDNGAARPQPTSYTMVEPRFREIYFQ |
Ga0126384_118088311 | 3300010046 | Tropical Forest Soil | VKESTVTDEKKTHHVPFPEEDNGAPRPPEQTNSYTM |
Ga0126372_112960672 | 3300010360 | Tropical Forest Soil | VKESTVTDEKKTHHVPFPEEDNGAPRPPEQTNSYTMVDPRFREIYFQFYKETYKPSILDR |
Ga0134128_125352562 | 3300010373 | Terrestrial Soil | VSEEKKGHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREI* |
Ga0134124_129652501 | 3300010397 | Terrestrial Soil | VSEEKKGHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREIYFQFYKE |
Ga0134122_128996791 | 3300010400 | Terrestrial Soil | VSEQDHKKHHVPFPEEDNGAPKAPQESGSYTMVDPRFREIYFQFYKETYKPS |
Ga0150983_101034681 | 3300011120 | Forest Soil | VNKEKKTHHVPFPEDDNGSPKPQSTSYTMVDPRFREIYFQFYKE |
Ga0137333_10824921 | 3300011413 | Soil | MIRGAETRKPTVSDEKPHHQPFPEDEEGASGPQPSSYTMVDPRFREIYFQFYKETYRPSVLDRKTKE |
Ga0137455_11368571 | 3300011429 | Soil | LTDEKPRHVPFPEDDNGAPKPPDQSGSYTMVDPRFREIYFQFYKETYKPSV |
Ga0137433_12056252 | 3300011440 | Soil | LPVSDQDKPHHVPFPEDDNGDVQPQPTSYTMVDPRFRHHYFAFYKETYK |
Ga0136631_103940321 | 3300012043 | Polar Desert Sand | LSDEKTRHVPFPEEDNGAPKAPEQSGSYTMVDPRFREIYFQFYKETYRPS |
Ga0137352_11066471 | 3300012164 | Soil | VNDEKLHHHQPFPEDEEGEPRPQPTSYTMVEPRFRERYF |
Ga0137375_111583312 | 3300012360 | Vadose Zone Soil | VKKRVREKKRAEEKKHPVPFPEDDNGGARPPQQTGSYTMVDPRFREIYFQFYKETYKPSVLD |
Ga0136635_100539681 | 3300012530 | Polar Desert Sand | LSDEKTRHVPFPEEDNGAPKAPEQSGSYTMVDPRFREIYFQFYK |
Ga0157298_101934542 | 3300012913 | Soil | VSDEKAPHQPFPADDESGAPQPASSSYTMVDPRFRQAYFHFYKET |
Ga0157302_105628412 | 3300012915 | Soil | VTDEKTRHVPFPEDDNGAPKAPEQSGSYTMVDPRFREIYFQFYKETY |
Ga0153915_132831572 | 3300012931 | Freshwater Wetlands | VSDEKPRHQPFPEDEEGAPRPQPTSYTMVEPRFREIYFQFYKET |
Ga0134110_101553584 | 3300012975 | Grasslands Soil | VSEEKKPHHVPFPEEDNGAPRAPEQTSSYTMVDPRFREIYFQFYKETYK |
Ga0134075_105778232 | 3300014154 | Grasslands Soil | VSEEKKPHHVPFPEDDNGAPRTPDQTSSYTMVEPRFREIYFQFYKETYKPSVL |
Ga0075307_11333702 | 3300014260 | Natural And Restored Wetlands | VSDPKPLHHQPFPEDEEGEARPQPISYTMVEPRFRE |
Ga0075303_10889521 | 3300014299 | Natural And Restored Wetlands | MSDEKAPHQPFPQDDDEGAAQPASSSYTMVDPRFRQAYFHFYKETYKPSA |
Ga0180063_10304701 | 3300014885 | Soil | VSDEQPHHHQPFPDDEEGEPRPQPTSYTMVEPRFRERYFQ |
Ga0187776_111750702 | 3300017966 | Tropical Peatland | VIDEKAHPHHQPFPEDENGAPRPQPTSYTMVEPRFREIYFQFYKETYRPSSLDRK |
Ga0184619_100366411 | 3300018061 | Groundwater Sediment | VSEEKKPHHVPFPEEDTNGAPRAPEQSSSYTMVEPRFREI |
Ga0184640_104556382 | 3300018074 | Groundwater Sediment | VTDEKTRHVPFPEDDNGAPKPPDQSGSYTMVDPRFREIYFQFYK |
Ga0190265_129648781 | 3300018422 | Soil | VTDEKPRHVPFPEDDNGAPKPPEQSGSYTMVDPRFREIYFQFYKETYKPS |
Ga0173482_107467222 | 3300019361 | Soil | VNDDSKEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFY |
Ga0190264_118239492 | 3300019377 | Soil | VTDEKPRHVPFPEDDNGAPKPPEQSGSYTMVDPRFREIYFQFYKETY |
Ga0224508_108692681 | 3300022413 | Sediment | VSEEKPAHQPFPEDENGAARPQPSSYTMVEPRFREI |
Ga0224452_12895612 | 3300022534 | Groundwater Sediment | VSEEKKPHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREIYF |
Ga0209108_103835312 | 3300025165 | Soil | VSDEKPHHHQPFPEDEEGEPRPQPTSYTMVEPRFRERYFQFYKET |
Ga0207684_109297733 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEEKKGHHVPFPEEDNGAPRAPEQTGSYTMVEPRFREIYFQFYK |
Ga0210090_10526871 | 3300025965 | Natural And Restored Wetlands | MSDDAKKSHSPFPLEDNGTAKPPEQTNSYTMVDPRFREIYFQFYKETYKPSV |
Ga0207708_115276992 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEHKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREVYFQFYKETYKPSVLDRKT |
Ga0207648_119110561 | 3300026089 | Miscanthus Rhizosphere | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFYKETY |
Ga0209157_13710592 | 3300026537 | Soil | VSEQEHKKLHVPFPEEDNGEAKPQPTSYTMVEPRFREIYFQFYKETYKPSVL |
Ga0209854_10307041 | 3300027384 | Groundwater Sand | VDDHKKHHVPFPEEDNGPRAPEQTGAYTMVDPRFRDIYFQFYKETYKPSVLDRKT |
Ga0209998_101252461 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFTFYKETYKPSVL |
Ga0209464_102577872 | 3300027778 | Wetland Sediment | VSDEKPHHHQPFPEDEEGAPRPQPASYTMVDPRFREIYFQF |
Ga0209262_103594871 | 3300027841 | Freshwater | VSDEKPHHHQPFPEDEEGAPRPQPASYTMVDPRFRE |
Ga0209798_101997842 | 3300027843 | Wetland Sediment | VTEEKPHHHQPFPEEEDGAARPQPASYTMVEPRFREIYFQFYTET |
Ga0209579_104300801 | 3300027869 | Surface Soil | VSEQKKHHIPFPEEDNGGPKPPEQTQSYTMVDPRFREI |
Ga0209397_106220422 | 3300027871 | Wetland | VIEEKPHHQPFPEDEEGAPRPQPTSYTMVEPRFREIYFQFYKETY |
Ga0209382_110708902 | 3300027909 | Populus Rhizosphere | VSDSKDHRHQPFPEEDEGKASPQPTSYTMVDPRFREIYFQFYKETYKPSVLD |
Ga0268265_109123091 | 3300028380 | Switchgrass Rhizosphere | MSEQKKHPVPFPEEDNGGPKPPEQTGSYTMVDPRFREIYFQFYK |
Ga0268264_119835262 | 3300028381 | Switchgrass Rhizosphere | MSEQKKHPVPFPEDDNGGTKPPEQTGSYTMVDPRFREIYFQFYKET |
Ga0307299_100839342 | 3300028793 | Soil | VSEEKKPHHVPFPEEDTNGAPRTPDQSSSYTMVEPRFREIYFQ |
Ga0311347_106989102 | 3300029923 | Fen | MRARENVSDHVSDREKPQHQPFPEEDDGAARPQPASYTMVEPRFREIYFQFYKETYRPS |
Ga0311334_119477661 | 3300029987 | Fen | VSEQMKDRPTHQPFPAEDEGAPKPAEETSSYSMVPPRFREIYFQFYRETYRPSVIDRKNKELI |
Ga0247826_101022471 | 3300030336 | Soil | VSDSKVSDSKDHRHQPFPEEDEGKASPQPTSYTMVDPRFREIYFQFYKETYK |
Ga0307425_11045972 | 3300031277 | Salt Marsh | VSDQSKHHHVPFPEEDNGEPKPPERSSSYTMVAPRFREIYFQFYKETYKPSALD |
Ga0310892_105500751 | 3300031858 | Soil | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFYKETYKP |
Ga0315278_108789991 | 3300031997 | Sediment | VSDEKPHHHQPFPEDEEGAARPQPSSYTMVDPRFREIYLQFYKETYKPSVI |
Ga0310897_106986302 | 3300032003 | Soil | VTDEAAKKHHVPFPEEDNGAPKPPEQTGSYTMVDPRFREVYFQFYKETYKPSV |
Ga0310902_109750691 | 3300032012 | Soil | VNDDSNEHHHQPFPEDDEGRARPQPTSYTMVEPRFREIYFQFY |
Ga0310890_108097881 | 3300032075 | Soil | VSDSKVSDAKDHRHQPFPEEDEGKAGPQPTSYTMVEPRFREIYFQFYKETYKPSVL |
Ga0307471_1016695172 | 3300032180 | Hardwood Forest Soil | MSEQKKHPVPFPEEDNGGPKPPEQSGSYTMVDPRFREIYFQFYKET |
Ga0316194_104614742 | 3300032262 | Sediment | VSEDKPHHQPFPEDENGAGRPQPSSYTMVEPRFREIYFQFYKETYRPSVIDRK |
Ga0316197_101008123 | 3300032273 | Sediment | VSEEKPHHQPFPEDENGARRPQPTSYTMVEPRFREI |
Ga0315286_102297971 | 3300032342 | Sediment | VSDEKPHHHQPFPEDEEGAARPQPSSYTMVDPRFREIYLQ |
Ga0315286_111996082 | 3300032342 | Sediment | VSDETPHHQPFPEDEEGAARPQPSSYTMVDPRFREIYLQ |
Ga0315273_105829031 | 3300032516 | Sediment | VSDETPHHQPFPEDEEGAARPQPSSYTMVDPRFREIYLQFYKETYKP |
Ga0335085_110407892 | 3300032770 | Soil | MSDEVKTTHHHVPFPEDDNGAPKPQPTSYTMVEPRFREIYFQFYKETYKPS |
Ga0335085_121787102 | 3300032770 | Soil | VIDEKAPHQPFPEDEEGAPRPQPTSYTMVEPRFREIYFQFYKETYKP |
Ga0335084_118136602 | 3300033004 | Soil | VIEEKPHHQPFPEDEEGAVRPQPTSYTMVEPRFREIYF |
Ga0316604_107822751 | 3300033406 | Soil | VTDEKPHHQPFPEDEEGAARPQPTSYTMVDPRFREIYFQFYK |
Ga0316625_1026292011 | 3300033418 | Soil | VSEENKHHHQPFPEEDNGEPAAPAQSSSYTMVDPRFRAIYFQFYKETYRPSVIDRKT |
Ga0316601_1006784071 | 3300033419 | Soil | VIEEKPHHQPFPEDEEGAAHPQPTSYTMVEPRFREIYFQFYKETYRPS |
Ga0326726_111746811 | 3300033433 | Peat Soil | VSDEKPHHQPFPEDEEGAVRPQPTSYTMVEPRFRE |
Ga0316620_117512752 | 3300033480 | Soil | VSDERPHHQPFPEDDEGAARPQPTSYTMVEPRFREIYFQFYKETYK |
Ga0316627_1010659962 | 3300033482 | Soil | VSEENKHHHQPFPEEDNGEPAAPAQSSSYTMVDPRFRAIYFQFYKETYKTSAI |
Ga0316626_106544751 | 3300033485 | Soil | VIEEKPHHQPFPEDEEGAAHPQPSSYTMVEPRFREIYFQFYKETYRPSVL |
Ga0316628_1012234051 | 3300033513 | Soil | VTDEKAHHQPFPEDEEGAPRPQPTSYTMVEPRFREIYFQFYKETYK |
Ga0316616_1033471541 | 3300033521 | Soil | VTDEKPHHQPFPEDEEGAPRPQPTSYTMVEPRFREIY |
Ga0247829_115345751 | 3300033550 | Soil | VSDSKVSDSKDHRHQPFPEEDEGKASPQPTSYTMVDPRFREIYFQFYKETYKPSVLDRK |
Ga0364926_053883_2_130 | 3300033812 | Sediment | MSDEAKKPHHVPFPEDENGAAKPQPSSYTMVEPRFREIYFQFY |
Ga0364927_0094158_685_825 | 3300034148 | Sediment | MSDEKKHHVPFPEEENGDAKPQPTSYTMVDPRFREIYFQFYKETYRP |
Ga0370495_0263306_3_140 | 3300034257 | Untreated Peat Soil | LTDEKPRHVPFPEEDNGAPKAPEQSGSYTMVDPRFREIYFQFYKET |
⦗Top⦘ |