| Basic Information | |
|---|---|
| Family ID | F078625 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MFGKQGKAAKANVSTAIMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKLK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.93 % |
| % of genes near scaffold ends (potentially truncated) | 19.83 % |
| % of genes from short scaffolds (< 2000 bps) | 66.38 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.793 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01476 | LysM | 15.65 |
| PF12705 | PDDEXK_1 | 1.74 |
| PF07659 | DUF1599 | 0.87 |
| PF01807 | zf-CHC2 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.79 % |
| All Organisms | root | All Organisms | 36.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10433844 | Not Available | 703 | Open in IMG/M |
| 3300002298|B570J29599_1001640 | Not Available | 1658 | Open in IMG/M |
| 3300002835|B570J40625_100638298 | Not Available | 966 | Open in IMG/M |
| 3300003277|JGI25908J49247_10062444 | Not Available | 947 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 22003 | Open in IMG/M |
| 3300003490|JGI25926J51410_1009202 | Not Available | 2055 | Open in IMG/M |
| 3300003491|JGI25924J51412_1001748 | Not Available | 4094 | Open in IMG/M |
| 3300004240|Ga0007787_10482482 | Not Available | 620 | Open in IMG/M |
| 3300004460|Ga0066222_1337766 | Not Available | 542 | Open in IMG/M |
| 3300004790|Ga0007758_10732656 | Not Available | 553 | Open in IMG/M |
| 3300004795|Ga0007756_11436105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 806 | Open in IMG/M |
| 3300005527|Ga0068876_10117268 | Not Available | 1580 | Open in IMG/M |
| 3300005527|Ga0068876_10243242 | Not Available | 1034 | Open in IMG/M |
| 3300005662|Ga0078894_10001997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 15330 | Open in IMG/M |
| 3300005662|Ga0078894_10591922 | Not Available | 988 | Open in IMG/M |
| 3300006641|Ga0075471_10063377 | All Organisms → Viruses → Predicted Viral | 2033 | Open in IMG/M |
| 3300006641|Ga0075471_10384788 | Not Available | 705 | Open in IMG/M |
| 3300007590|Ga0102917_1248487 | Not Available | 617 | Open in IMG/M |
| 3300007603|Ga0102921_1377710 | Not Available | 504 | Open in IMG/M |
| 3300007639|Ga0102865_1083515 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300007973|Ga0105746_1244808 | Not Available | 617 | Open in IMG/M |
| 3300007973|Ga0105746_1331113 | Not Available | 530 | Open in IMG/M |
| 3300007992|Ga0105748_10160463 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300007992|Ga0105748_10563190 | Not Available | 501 | Open in IMG/M |
| 3300008055|Ga0108970_10112858 | Not Available | 948 | Open in IMG/M |
| 3300008107|Ga0114340_1001998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 13332 | Open in IMG/M |
| 3300008107|Ga0114340_1010676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 7087 | Open in IMG/M |
| 3300008107|Ga0114340_1019199 | All Organisms → Viruses → Predicted Viral | 3239 | Open in IMG/M |
| 3300008107|Ga0114340_1020146 | All Organisms → Viruses → Predicted Viral | 3150 | Open in IMG/M |
| 3300008107|Ga0114340_1022040 | Not Available | 2993 | Open in IMG/M |
| 3300008107|Ga0114340_1144813 | Not Available | 884 | Open in IMG/M |
| 3300008110|Ga0114343_1107142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 957 | Open in IMG/M |
| 3300008110|Ga0114343_1131951 | Not Available | 822 | Open in IMG/M |
| 3300008113|Ga0114346_1092639 | Not Available | 3009 | Open in IMG/M |
| 3300008113|Ga0114346_1143458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1030 | Open in IMG/M |
| 3300008113|Ga0114346_1228043 | Not Available | 716 | Open in IMG/M |
| 3300008116|Ga0114350_1041675 | Not Available | 1734 | Open in IMG/M |
| 3300008116|Ga0114350_1074426 | Not Available | 1147 | Open in IMG/M |
| 3300008119|Ga0114354_1000787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 14765 | Open in IMG/M |
| 3300008120|Ga0114355_1111734 | Not Available | 1049 | Open in IMG/M |
| 3300008266|Ga0114363_1050840 | Not Available | 1650 | Open in IMG/M |
| 3300008266|Ga0114363_1178194 | Not Available | 677 | Open in IMG/M |
| 3300008962|Ga0104242_1022460 | Not Available | 1089 | Open in IMG/M |
| 3300008962|Ga0104242_1061191 | Not Available | 631 | Open in IMG/M |
| 3300009068|Ga0114973_10112573 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300009155|Ga0114968_10101146 | Not Available | 1762 | Open in IMG/M |
| 3300009155|Ga0114968_10182422 | Not Available | 1226 | Open in IMG/M |
| 3300009158|Ga0114977_10000502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 26165 | Open in IMG/M |
| 3300009159|Ga0114978_10736796 | Not Available | 559 | Open in IMG/M |
| 3300009163|Ga0114970_10169907 | Not Available | 1300 | Open in IMG/M |
| 3300009181|Ga0114969_10000323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 40594 | Open in IMG/M |
| 3300009183|Ga0114974_10123366 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300009183|Ga0114974_10808426 | Not Available | 502 | Open in IMG/M |
| 3300009187|Ga0114972_10455641 | Not Available | 730 | Open in IMG/M |
| 3300009419|Ga0114982_1247276 | Not Available | 555 | Open in IMG/M |
| 3300010160|Ga0114967_10157034 | Not Available | 1258 | Open in IMG/M |
| 3300010885|Ga0133913_11113438 | Not Available | 2032 | Open in IMG/M |
| 3300010885|Ga0133913_11505580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1704 | Open in IMG/M |
| 3300011116|Ga0151516_10128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 40843 | Open in IMG/M |
| 3300012017|Ga0153801_1072327 | Not Available | 605 | Open in IMG/M |
| 3300012706|Ga0157627_1063396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 868 | Open in IMG/M |
| 3300012777|Ga0138292_1315952 | Not Available | 503 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10004693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 19079 | Open in IMG/M |
| 3300017701|Ga0181364_1062672 | Not Available | 574 | Open in IMG/M |
| 3300017766|Ga0181343_1020219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2062 | Open in IMG/M |
| 3300017780|Ga0181346_1180790 | Not Available | 772 | Open in IMG/M |
| 3300019784|Ga0181359_1000011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 40899 | Open in IMG/M |
| 3300019784|Ga0181359_1032296 | Not Available | 2024 | Open in IMG/M |
| 3300020141|Ga0211732_1000941 | Not Available | 723 | Open in IMG/M |
| 3300020161|Ga0211726_10718395 | Not Available | 2322 | Open in IMG/M |
| 3300020162|Ga0211735_10435556 | Not Available | 1096 | Open in IMG/M |
| 3300020172|Ga0211729_10063447 | Not Available | 1242 | Open in IMG/M |
| 3300020498|Ga0208050_1020618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 685 | Open in IMG/M |
| 3300020530|Ga0208235_1036440 | Not Available | 583 | Open in IMG/M |
| 3300020536|Ga0207939_1002073 | Not Available | 4460 | Open in IMG/M |
| 3300021963|Ga0222712_10024502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 4915 | Open in IMG/M |
| 3300021963|Ga0222712_10060409 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300022179|Ga0181353_1007971 | Not Available | 2595 | Open in IMG/M |
| 3300022190|Ga0181354_1157779 | Not Available | 705 | Open in IMG/M |
| 3300022746|Ga0228701_1000832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 23116 | Open in IMG/M |
| 3300022752|Ga0214917_10000743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 42668 | Open in IMG/M |
| 3300022752|Ga0214917_10069082 | Not Available | 2235 | Open in IMG/M |
| 3300023174|Ga0214921_10226898 | Not Available | 1128 | Open in IMG/M |
| 3300024348|Ga0244776_10134106 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| 3300027586|Ga0208966_1042882 | Not Available | 1304 | Open in IMG/M |
| 3300027688|Ga0209553_1052697 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300027733|Ga0209297_1000579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 22969 | Open in IMG/M |
| 3300027754|Ga0209596_1000084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 82688 | Open in IMG/M |
| 3300027754|Ga0209596_1000084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 82688 | Open in IMG/M |
| 3300027772|Ga0209768_10306169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 666 | Open in IMG/M |
| 3300031673|Ga0307377_10530467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 853 | Open in IMG/M |
| 3300031758|Ga0315907_10008815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 10306 | Open in IMG/M |
| 3300031758|Ga0315907_10259548 | Not Available | 1438 | Open in IMG/M |
| 3300031758|Ga0315907_10417020 | Not Available | 1079 | Open in IMG/M |
| 3300031758|Ga0315907_10635191 | Not Available | 822 | Open in IMG/M |
| 3300031758|Ga0315907_10647618 | Not Available | 812 | Open in IMG/M |
| 3300031786|Ga0315908_10002249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 14193 | Open in IMG/M |
| 3300031787|Ga0315900_10122637 | Not Available | 2471 | Open in IMG/M |
| 3300031787|Ga0315900_11116834 | Not Available | 506 | Open in IMG/M |
| 3300031857|Ga0315909_10068552 | Not Available | 3184 | Open in IMG/M |
| 3300031857|Ga0315909_10650580 | Not Available | 694 | Open in IMG/M |
| 3300031951|Ga0315904_10619448 | Not Available | 927 | Open in IMG/M |
| 3300031951|Ga0315904_10862861 | Not Available | 736 | Open in IMG/M |
| 3300031963|Ga0315901_10509229 | Not Available | 936 | Open in IMG/M |
| 3300031999|Ga0315274_10875517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 939 | Open in IMG/M |
| 3300032093|Ga0315902_10342440 | Not Available | 1387 | Open in IMG/M |
| 3300033993|Ga0334994_0165313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1229 | Open in IMG/M |
| 3300033994|Ga0334996_0006518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 7903 | Open in IMG/M |
| 3300033994|Ga0334996_0386790 | Not Available | 662 | Open in IMG/M |
| 3300034012|Ga0334986_0302855 | Not Available | 847 | Open in IMG/M |
| 3300034101|Ga0335027_0003061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 14712 | Open in IMG/M |
| 3300034103|Ga0335030_0051782 | Not Available | 3078 | Open in IMG/M |
| 3300034104|Ga0335031_0002916 | All Organisms → cellular organisms → Bacteria | 12860 | Open in IMG/M |
| 3300034104|Ga0335031_0642482 | Not Available | 619 | Open in IMG/M |
| 3300034121|Ga0335058_0675127 | Not Available | 572 | Open in IMG/M |
| 3300034283|Ga0335007_0279251 | Not Available | 1107 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.24% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 14.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.45% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.45% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.45% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.86% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.86% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_104338442 | 3300000882 | Freshwater And Marine | MIGKQGGHVKAPTSTAIMGKKPSGAVKGGGMVKQGVTPKPIAGNKNKLK* |
| B570J29599_10016402 | 3300002298 | Freshwater | MFGKQGKSAKAPVHPGHAGKKNSGSVKGGGLVKQGVTPKGIKGNNNKVK* |
| B570J40625_1006382982 | 3300002835 | Freshwater | MFGKQGKSAKAPTATAMMGKKPAGKIVGGGMVKQGVTPKGIKGNNNKVK* |
| JGI25908J49247_100624442 | 3300003277 | Freshwater Lake | MFGKQGKSAKAPTATAMIGKKNSGGVKGGGMIKQGVTPKGIKGNNNKVR* |
| JGI25922J50271_100001203 | 3300003413 | Freshwater Lake | MFGKQGKPAKAPVGSAIHGKKNGGAVKGGGMVKQGVTPKGIKGNNNKLK* |
| JGI25926J51410_10092021 | 3300003490 | Freshwater Lake | MFGKQGKSAKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGIKGNNN |
| JGI25924J51412_10017481 | 3300003491 | Freshwater Lake | MFGKQGKSAKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGIKGNNNKVK* |
| Ga0007787_104824821 | 3300004240 | Freshwater Lake | MFGKQGKPAKAPTHSGHEGKKNGGKVVGGGMVKQGMTPKGIKGNKNKL |
| Ga0066222_13377662 | 3300004460 | Marine | MAMGKQGGIAKANVKPAMPGSKPGGKVVGGGMVKKGMTPKGIPGNKKSGK* |
| Ga0007758_107326561 | 3300004790 | Freshwater Lake | MFGKQGKSAKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGIKG |
| Ga0007756_114361052 | 3300004795 | Freshwater Lake | MFGKQGKPAKAPTHSGHAGKKNGGKVVGGGQVKQGVTPKGIKGNNNKLK* |
| Ga0068876_101172682 | 3300005527 | Freshwater Lake | MFGKQGKAAKAPTSSAIMGKKNSGSVKGGGNVKQGVTPKGIKGNKNKLK* |
| Ga0068876_102432421 | 3300005527 | Freshwater Lake | MFGKQGKAAKAPVHPGHAGKKNGGKSVGAGMVKQGVTPKGTKGNNNKLK* |
| Ga0078894_100019973 | 3300005662 | Freshwater Lake | MFGKQGKAAKAPTSMAMQGKKPAGKGVGLGAVQQGTTPKGIKGNKNKLK* |
| Ga0078894_105919222 | 3300005662 | Freshwater Lake | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNNNKLK* |
| Ga0075471_100633772 | 3300006641 | Aqueous | MFGKQGKMAKAPTGSAIMGKKPAGKGVGLGQVQQPKAPKTIKGSKNKLK* |
| Ga0075471_103847882 | 3300006641 | Aqueous | MFGKQGKPAKAMVGKNIMGKKPGGSAKGAGMVKKGVTPKGIKGNNNKLK* |
| Ga0102917_12484872 | 3300007590 | Estuarine | MFGKQGKAAKANVSTAIMGKKNAGKVVGAGGVKQGTLSKGTKGNTNKLK* |
| Ga0102921_13777102 | 3300007603 | Estuarine | MFGKQGKPAKAPTSTAMSAKKNGGKSVGAGMVKQGVTPKGIKGNNNKLK* |
| Ga0102865_10835152 | 3300007639 | Estuarine | MFGKQGKAAKAPTSTAMSAKKNSGKTVGAGGVKQGVTPKGIKGNNNKLK* |
| Ga0105746_12448081 | 3300007973 | Estuary Water | MFGKQGKAAKANVSTAHMGKKNAGKVVGAGGVKQSTLSKGTKGNTNKLK |
| Ga0105746_13311132 | 3300007973 | Estuary Water | GKQGKAGKAPTSTAIMGKKPAGKVIGGGMVKQGVLSKGTKGNTNKLK* |
| Ga0105748_101604632 | 3300007992 | Estuary Water | MFGKQGKAGKAPVGTAIMGKKPAGKVVGGGMVKQGVTTKGTKGNNTKAK* |
| Ga0105748_105631901 | 3300007992 | Estuary Water | MFGKQGKAAKANVLTAIMGKKPAGKVVGGGMVKQGVTPKGIKG |
| Ga0108970_101128582 | 3300008055 | Estuary | MFGKQGKAGKAPTSTAIMGKKNKGGVIGAGGVKQGTLSKGTKGNTNKLK* |
| Ga0114340_10019983 | 3300008107 | Freshwater, Plankton | MIGKQGKPAKAPTASAMMGKKNGGAVKGGGNVKQGITPKGIKGNTNKLK* |
| Ga0114340_10106765 | 3300008107 | Freshwater, Plankton | MFGKQGKPGKAPTSSAMVGKKNGGAVKGGGMVKQGVTPKGIKGNKNKLK* |
| Ga0114340_10191992 | 3300008107 | Freshwater, Plankton | MFGKQGKPAKAPTSMAIQGKKPAGKGVGMGQVQQGTTPKGIKGNKNKLK* |
| Ga0114340_10201462 | 3300008107 | Freshwater, Plankton | MFGKQGKAAKAPTSVAMQGKKPAGKGVGLGAVQQGTTPKGIKGNKNKLK* |
| Ga0114340_10220403 | 3300008107 | Freshwater, Plankton | MFGKQGKPAKAPTSKEMVGKKNSGAVKGGGMVKQGVTPKGIKGNNNKLK* |
| Ga0114340_11448132 | 3300008107 | Freshwater, Plankton | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGAVKQGVTPKGIKGNNNKLK* |
| Ga0114343_11071422 | 3300008110 | Freshwater, Plankton | MFGKQGKPAKAPTSSAMPGKKNGGKVVGGGMVKQGTTPKGIKGNNNKLK* |
| Ga0114343_11319512 | 3300008110 | Freshwater, Plankton | MFGKQGKAAKAPTSTAKSAKKNSGKTVGAGGVKQGVTPKGIKGNNNKLK* |
| Ga0114346_10926392 | 3300008113 | Freshwater, Plankton | MFGKQGKPAKAPTSTAMSAKKNSGKTVGAGMVKQGVTPKGIKGNNNKLK* |
| Ga0114346_11434582 | 3300008113 | Freshwater, Plankton | MFGKQGKAAKAPTSGAIMGKKPAGKGVGLGAVKQGVTPKGIKGNKNKLK* |
| Ga0114346_12280431 | 3300008113 | Freshwater, Plankton | MFGKQGKPAKAPVHPGHAGKKNSGTAKGGGMVKQGVTPKGIKGNNNKLK* |
| Ga0114350_10416752 | 3300008116 | Freshwater, Plankton | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNKNKLK* |
| Ga0114350_10744261 | 3300008116 | Freshwater, Plankton | SSAMVGKKNGGAVKGGGMVKQGVTPKGIKGNKNKLK* |
| Ga0114354_10007875 | 3300008119 | Freshwater, Plankton | MFGKQGKPAKAPVGSPIMGKKPAGKGVGMGQVQQGTTPKGIKGNKNKLK* |
| Ga0114355_11117342 | 3300008120 | Freshwater, Plankton | MFGKQGKAAKAPTSMAMQGKKPAGKGVGLGQVQQGTTPKGIKGNKNKLK* |
| Ga0114363_10508402 | 3300008266 | Freshwater, Plankton | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVEQGVTPKGIKGNN |
| Ga0114363_11781942 | 3300008266 | Freshwater, Plankton | MIGKQGKSAKANVGKAIMGKKPGGAVKGGGNVKQGITPKGIKGNKNKLK* |
| Ga0104242_10224602 | 3300008962 | Freshwater | MFGKQGKSAKANVGKAIMGKKPGGAVKGGGNVKQGVTPKGIKGNKNKLK* |
| Ga0104242_10611912 | 3300008962 | Freshwater | MFGKQGKPAKANVGSPIMGKKSGGSAKGLGMVKKGVTPKGIKGNNNKLK* |
| Ga0114973_101125732 | 3300009068 | Freshwater Lake | MFGKQGKAGKAPTSTAIMGKKNAGKVVGAGGVKQGTLSKGTKGNTNKLK* |
| Ga0114968_101011462 | 3300009155 | Freshwater Lake | MFGKQGKAGKAPVGTAIMGKKPAGKIVGGGMVKQGVTSKGTKGNNTKAK* |
| Ga0114968_101824222 | 3300009155 | Freshwater Lake | MFGKQGKSAKAPTSTAIMGKKNGGKVVGGGMVKQGTLSKGTKGNNNKLK* |
| Ga0114977_1000050231 | 3300009158 | Freshwater Lake | MFGKQGKAAKANVSTAIMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKLK* |
| Ga0114978_107367962 | 3300009159 | Freshwater Lake | MFGKQGKPAKAPVGVKIDGKKPGGKVVGGGMVKQGVTPKGIKGNTNKLK* |
| Ga0114970_101699072 | 3300009163 | Freshwater Lake | MFGKQGKSAKAPTSTAIMGKKNGGKVVGGGMVKQGTLSKGTKGNTNKLK* |
| Ga0114969_1000032324 | 3300009181 | Freshwater Lake | MFGKQGKMTKAPTSSAIMGKKPAGKGIGLGQVDVAKAPKTIKGSKNKLK* |
| Ga0114974_101233662 | 3300009183 | Freshwater Lake | MFGKQGKAGKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGTKGNSNKAK* |
| Ga0114974_108084262 | 3300009183 | Freshwater Lake | MFGKQGKVAKANVKQAIMGKKNKGGVIGAGGVKQGTLSKGTKGNTNKLK* |
| Ga0114972_104556412 | 3300009187 | Freshwater Lake | MFGKQGKVAKANVKQAIMGKKPAGKVIGGGMVKQGVLSKGTKGNTNKLK* |
| Ga0114982_12472762 | 3300009419 | Deep Subsurface | AMSAKKNSGKSVGGGMVKQGVTPKGIKGNNNKLK* |
| Ga0114967_101570342 | 3300010160 | Freshwater Lake | MFGKQGKAGKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGTKGNNTKAK* |
| Ga0133913_111134381 | 3300010885 | Freshwater Lake | QGKSAKAPTSTAIMGKKNGGKVVGGGMVKQGTLSKGTKGNNNKLK* |
| Ga0133913_115055802 | 3300010885 | Freshwater Lake | MFGKQGKPAKAPVGVKIEGKKPGGKVVGGGMVKQGITPKGIKGNTNKLK* |
| Ga0151516_1012861 | 3300011116 | Freshwater | MIGKQGKSAKANVGKPIMGKKPAGAAKGGGMVKFGITPKGVKGNKAKIK* |
| Ga0153801_10723272 | 3300012017 | Freshwater | MFGKQGKSAKAPVGTAIMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKVK* |
| Ga0157627_10633961 | 3300012706 | Freshwater | MFGKQGKAAKAPTSGAIMGKKPAGKGVGLGMVKQGLTPKGIKGNKNKLK* |
| Ga0138292_13159522 | 3300012777 | Freshwater Lake | STAIMGKKNAGKVVGAGGVKQGTLSKGTKGNTNKLK* |
| (restricted) Ga0172373_100046934 | 3300013131 | Freshwater | MIGKQGKSAKAPTSSAIMGKKNSGAVKGGGLVKFGITPKGIKGNNNKIK* |
| Ga0181364_10626722 | 3300017701 | Freshwater Lake | MFGKQGKVAKANVKQAIMGKKPAGKVIGGGMVKQGVLSKGTKGNT |
| Ga0181343_10202192 | 3300017766 | Freshwater Lake | MFGKQGKAAKAPTSMAMQGKKPAGKGVGLGAVQQGTTPKGIKGNKNKLK |
| Ga0181346_11807903 | 3300017780 | Freshwater Lake | MFGKQGKVAKANVKQAIMGKKNKGGVIGAGGVKQGTLSKGTK |
| Ga0181359_10000112 | 3300019784 | Freshwater Lake | MFGKQGKSAKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGIKGNNNKVK |
| Ga0181359_10322962 | 3300019784 | Freshwater Lake | MFGKQGKAGKAPTSTAIMGKKNKGGVIGGGMVKQGVLSKGTKGNTNKLK |
| Ga0211732_10009411 | 3300020141 | Freshwater | SITKEKQMFGKQGKVAKAPTSTAMSGKKNGGKVVGGGMVKQGVTPKGIKGNNNKLK |
| Ga0211726_107183952 | 3300020161 | Freshwater | MFGKQGKSAKAPVGTVIMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKVK |
| Ga0211735_104355562 | 3300020162 | Freshwater | MFGKQGKAGKAPTSTAIMGKKNAGKVVGAGGVKQGTLSKGTKGNTNKLK |
| Ga0211729_100634472 | 3300020172 | Freshwater | MFGKQGKAAKAPTSTAMSAKKNSGKTVGAGGVKQGVTPKGIKGNNNKLK |
| Ga0208050_10206182 | 3300020498 | Freshwater | MFGKQGKAAKANTSTPIMGKKPAGKVVGGGMVKQGTLSKGTKGNSNKLK |
| Ga0208235_10364402 | 3300020530 | Freshwater | MFGKQGKPAKAPTSTAMSAKKNSGKTVGAGMVKQGVTPKGIKGNNNKLK |
| Ga0207939_10020733 | 3300020536 | Freshwater | MFGKQGKSAKAPVHPGHAGKKNSGSVKGGGLVKQGVTPKGIKGNNNKVK |
| Ga0222712_100245025 | 3300021963 | Estuarine Water | MFGKQGKMAKAPTSGAIMGKKPAGKGVGLGQIDVPKAPKTIKGNNQKLK |
| Ga0222712_100604092 | 3300021963 | Estuarine Water | MFGKQGKAAKANVSTAHMGKKNAGKVVGAGGVKQGTLSKGTKGNTNKLK |
| Ga0181353_10079712 | 3300022179 | Freshwater Lake | MFGKQGKPAKAPVGSAIHGKKNGGAVKGGGMVKQGVTPKGIKGNNNKLK |
| Ga0181354_11577792 | 3300022190 | Freshwater Lake | MFGKQGKVAKANVKQAIMGKKPAGKVIGGGMVKQGVLSKGTKGNTNKLK |
| Ga0228701_10008324 | 3300022746 | Freshwater | MFGKQGKPAKAIMGATTVVPKGKPGGKAMGAGNVKQGLTPKGIKGNKNKLK |
| Ga0214917_1000074345 | 3300022752 | Freshwater | MFGKQGKPAKANVGSPIMGKKNGGAVKGGGNVKQGIITKGTKGNKNKLK |
| Ga0214917_100690822 | 3300022752 | Freshwater | MFGKQGKSAKANVGKAIMGKKPGGAVKGGGNVKQGVTPKGIKGNKNKLK |
| Ga0214921_102268982 | 3300023174 | Freshwater | MFGKQGKPAKASVGSPIMGKKNGGSVKGGGNVKQGITPKGIKGNSNKLK |
| Ga0244776_101341063 | 3300024348 | Estuarine | HVKAPTSTAIMGKKPSGAVKGGGMVKQGVTPKPIAGNKNKLK |
| Ga0208966_10428822 | 3300027586 | Freshwater Lentic | MFGKQGKSAKAPTATAMVGKKNSGGVKGGGMIKQGVTPKGIKGNNNKVR |
| Ga0209553_10526972 | 3300027688 | Freshwater Lake | MFGKQGKSAKAPTATAMIGKKNSGGVKGGGMIKQGVTPKGIKGNNNKVR |
| Ga0209297_10005793 | 3300027733 | Freshwater Lake | MFGKQGKAAKANVSTAIMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKLK |
| Ga0209596_100008424 | 3300027754 | Freshwater Lake | MFGKQGKMTKAPTSSAIMGKKPAGKGIGLGQVDVAKAPKTIKGSKNKLK |
| Ga0209596_100008492 | 3300027754 | Freshwater Lake | MFGKQGKSAKAPTSTAIMGKKNGGKVVGGGMVKQGTLSKGTKGNNNKLK |
| Ga0209768_103061692 | 3300027772 | Freshwater Lake | MFGKQGKSAKAPVGTAIMGKKPAGKIVGGGMVKQGVTPKGTKGNNNKVR |
| Ga0307377_105304672 | 3300031673 | Soil | MFGKQGKPAKAPTSMAMQGKKPAGKGVGLGMVKQGATPKGIKGNKNKLK |
| Ga0315907_100088158 | 3300031758 | Freshwater | MIGKQGKSAKAPTSSAMMGKKPAGAVKGGGMVKFGITPKGIKGNNNKIK |
| Ga0315907_102595481 | 3300031758 | Freshwater | MFGKQGKPGKAPTSSAMVGKKNGGAVKGGGMVKQGVTPKGIKGNKNKLK |
| Ga0315907_104170202 | 3300031758 | Freshwater | MFGKQGKAAKAPTSSAIMGKKNSGSVKGGGNVKQGVTPKGIKGNKNKLK |
| Ga0315907_106351912 | 3300031758 | Freshwater | KAPTSSAMVGKKNGGAVKGGGMVKQGVTPKGIKGNKNKLK |
| Ga0315907_106476182 | 3300031758 | Freshwater | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNKNKLK |
| Ga0315908_100022495 | 3300031786 | Freshwater | MFGKQGKPAKAPVGSPIMGKKPAGKGVGMGQVQQGTTPKGIKGNKNKLK |
| Ga0315900_101226371 | 3300031787 | Freshwater | MFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNKNKL |
| Ga0315900_111168341 | 3300031787 | Freshwater | EKQMFGKQGKPAKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNNNKLK |
| Ga0315909_100685522 | 3300031857 | Freshwater | MIGKQGKSAKANVGKAIMGKKPGGAVKGGGNVKQGITPKGIKGNKNKLK |
| Ga0315909_106505802 | 3300031857 | Freshwater | MFGKQGKAAKAPTSMAMQGKKPAGKGVGLGQVQQGTTPKGIKGNKNKLK |
| Ga0315904_106194482 | 3300031951 | Freshwater | MIGRQGKAAKAMVGTPIMGKKPAGKVVGAGGVKIAATPKGIKGNNKKIK |
| Ga0315904_108628612 | 3300031951 | Freshwater | AKAPTSTAMSAKKNSGKTVGGGMVKQGVTPKGIKGNNNKLK |
| Ga0315901_105092292 | 3300031963 | Freshwater | EKHMFGKQGKAAKAPTSMAMQGKKPAGKGVGLGQVQQGTTPKGIKGNKNKLK |
| Ga0315274_108755172 | 3300031999 | Sediment | MFGKQGKAGKAPTSTAIMGKKNKGGVIGAGGVKQGTLSKGTKGNTNKLK |
| Ga0315902_103424402 | 3300032093 | Freshwater | MFGKQGKPAKAPTSTAMSAKKNGGKSVGAGMVKQGVTPKGIKGN |
| Ga0334994_0165313_497_646 | 3300033993 | Freshwater | MFGKQGKAAKAPVHPGHAGKKNGGKVVGGGAVKQGVTPKGTKGNSNKLK |
| Ga0334996_0006518_7154_7306 | 3300033994 | Freshwater | MGMGKQGGKGTAPVGKPIMGGKPGGKVVGGGNVMKGVTPKGIKGNSNKAK |
| Ga0334996_0386790_505_654 | 3300033994 | Freshwater | MIGKQGKPGKAPTSSAMVGKKNGGAVKGGGNVKQGITPKGIKGNTNKLK |
| Ga0334986_0302855_378_527 | 3300034012 | Freshwater | MFGKQGKSAKAPTATAMMGKKPAGKVVGGGMVKQGVTPKGIKGNNNKVK |
| Ga0335027_0003061_7716_7865 | 3300034101 | Freshwater | MFGKQGKSAKAPTATAMMGKKPGGKVVGGGMVKQGVTPKGIKGNNNKVK |
| Ga0335030_0051782_2125_2274 | 3300034103 | Freshwater | MFGKQGKPGKAPTSSAMVGKKNGGAVKGGGMVKQGITPKGIKGNKNKLK |
| Ga0335031_0002916_1679_1828 | 3300034104 | Freshwater | MFGKQGKAAKAPTSGAIMGKKPAGKGVGLGAVKQGVTPKGIKGNKNKLK |
| Ga0335031_0642482_130_279 | 3300034104 | Freshwater | MFGKQGKPAKAMVGKNIMGKKPGGSAKGAGMVKKGVTPKGIKGNNNKLK |
| Ga0335058_0675127_429_572 | 3300034121 | Freshwater | GKQGKSAKAPVHPGHAGKKNSGSVKGGGLVKQGVTPKGIKGNNNKVK |
| Ga0335007_0279251_707_856 | 3300034283 | Freshwater | MFGKQGKSAKAPTSMAMQGKKPAGKGVGLGAVKQGTTPKGIKGNKNKLK |
| ⦗Top⦘ |