| Basic Information | |
|---|---|
| Family ID | F078558 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 50 residues |
| Representative Sequence | METDFKNISGMFRTNTDIINKAIADVRPEDWFRAPGDDSNHLMWLLGH |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.69 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 95.69 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.345 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.414 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.42% β-sheet: 0.00% Coil/Unstructured: 56.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00300 | His_Phos_1 | 12.07 |
| PF12867 | DinB_2 | 10.34 |
| PF02321 | OEP | 7.76 |
| PF02541 | Ppx-GppA | 5.17 |
| PF00196 | GerE | 2.59 |
| PF05163 | DinB | 1.72 |
| PF13089 | PP_kinase_N | 0.86 |
| PF02954 | HTH_8 | 0.86 |
| PF05235 | CHAD | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 15.52 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 10.34 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.72 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.69 % |
| Unclassified | root | N/A | 4.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111006|2214738113 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300002568|C688J35102_118279448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300004114|Ga0062593_102816415 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005271|Ga0065713_1007401 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005290|Ga0065712_10606992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005293|Ga0065715_10456611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300005334|Ga0068869_100688686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300005334|Ga0068869_100935677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300005334|Ga0068869_100948729 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005338|Ga0068868_101235419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300005340|Ga0070689_101633627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300005344|Ga0070661_100331085 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005366|Ga0070659_100908705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300005434|Ga0070709_11203162 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005438|Ga0070701_10158809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300005438|Ga0070701_10654956 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005441|Ga0070700_101316343 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005441|Ga0070700_101579933 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005444|Ga0070694_101045783 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005445|Ga0070708_102134596 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005468|Ga0070707_101490147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300005530|Ga0070679_101681464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005539|Ga0068853_102021934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300005543|Ga0070672_101978657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005545|Ga0070695_100576914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300005547|Ga0070693_100149363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
| 3300005549|Ga0070704_101619151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005564|Ga0070664_100881331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300005578|Ga0068854_100399758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300005578|Ga0068854_100701027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300005617|Ga0068859_102036564 | Not Available | 634 | Open in IMG/M |
| 3300005841|Ga0068863_101512106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300005841|Ga0068863_102292879 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005842|Ga0068858_100685639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300005842|Ga0068858_101006651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300006755|Ga0079222_10426692 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006804|Ga0079221_10688114 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006852|Ga0075433_11302524 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006904|Ga0075424_100558374 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300009093|Ga0105240_12382563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300009147|Ga0114129_10368837 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300009148|Ga0105243_10305938 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300009162|Ga0075423_11049794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300009174|Ga0105241_12190385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300009174|Ga0105241_12431134 | Not Available | 523 | Open in IMG/M |
| 3300009177|Ga0105248_11427399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300009545|Ga0105237_12784471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009551|Ga0105238_11919721 | Not Available | 625 | Open in IMG/M |
| 3300009551|Ga0105238_12911960 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010038|Ga0126315_10854241 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010038|Ga0126315_11101633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300010041|Ga0126312_10330809 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300010042|Ga0126314_10030861 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
| 3300010042|Ga0126314_10634162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300010044|Ga0126310_10092462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
| 3300010044|Ga0126310_10558860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300010045|Ga0126311_10626186 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300010047|Ga0126382_10969924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300010047|Ga0126382_11364697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 644 | Open in IMG/M |
| 3300010359|Ga0126376_12885051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300010373|Ga0134128_12263757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300010375|Ga0105239_10746842 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300010396|Ga0134126_10906421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300010399|Ga0134127_12931721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300010399|Ga0134127_13067919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300010400|Ga0134122_11989233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 619 | Open in IMG/M |
| 3300010401|Ga0134121_12676085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 543 | Open in IMG/M |
| 3300010401|Ga0134121_12889369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010403|Ga0134123_13529918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 506 | Open in IMG/M |
| 3300011119|Ga0105246_10499054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300011119|Ga0105246_11422853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300011119|Ga0105246_12337407 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012961|Ga0164302_11775466 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012989|Ga0164305_11467881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300013100|Ga0157373_11156676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300013100|Ga0157373_11564516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 504 | Open in IMG/M |
| 3300013102|Ga0157371_11409935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300013296|Ga0157374_10157301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2212 | Open in IMG/M |
| 3300013297|Ga0157378_13140296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 513 | Open in IMG/M |
| 3300013307|Ga0157372_12343201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300013307|Ga0157372_13082117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300013308|Ga0157375_13024086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300014325|Ga0163163_11806786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300014326|Ga0157380_11240273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300014487|Ga0182000_10059071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300014968|Ga0157379_10072117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3090 | Open in IMG/M |
| 3300015374|Ga0132255_105373147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 542 | Open in IMG/M |
| 3300019361|Ga0173482_10304213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300021445|Ga0182009_10734720 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025899|Ga0207642_10943218 | Not Available | 554 | Open in IMG/M |
| 3300025900|Ga0207710_10175636 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300025900|Ga0207710_10372240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300025907|Ga0207645_10432651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300025911|Ga0207654_11037697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300025912|Ga0207707_10108120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300025914|Ga0207671_10506329 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300025922|Ga0207646_11173550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300025930|Ga0207701_10874810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300025932|Ga0207690_11782067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300025936|Ga0207670_11470214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300025945|Ga0207679_10350223 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025945|Ga0207679_11280351 | Not Available | 673 | Open in IMG/M |
| 3300026035|Ga0207703_10038670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3809 | Open in IMG/M |
| 3300026041|Ga0207639_10332848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300026095|Ga0207676_10731802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300026095|Ga0207676_11033536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300026095|Ga0207676_11276609 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026095|Ga0207676_11437344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300027909|Ga0209382_10895631 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300028380|Ga0268265_11103172 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300028380|Ga0268265_11464797 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031716|Ga0310813_10469245 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031716|Ga0310813_11290838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 674 | Open in IMG/M |
| 3300031716|Ga0310813_11345198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 661 | Open in IMG/M |
| 3300031740|Ga0307468_100287331 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300033412|Ga0310810_10820083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Miscanthus Rhizosphere | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005271 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample from Bulk Soil Replicate 2: eDNA_1 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2213744736 | 2209111006 | Arabidopsis Rhizosphere | MYKVNTDIINMAIADVKNEDWFRTPGDDSNHLMWLLGHIVVHRGKVL |
| C688J35102_1182794482 | 3300002568 | Soil | METDFKNISGMFRANTDIISKAIADVRPEDWFRTPGDDSNHLMWLLGHVVIHRGQVLKTL |
| Ga0062593_1028164151 | 3300004114 | Soil | METDFKNITGIFKANTDIVNKAIADVESDHWFKKPGDDSNHLTWLMGHLIVHRG |
| Ga0065713_10074011 | 3300005271 | Miscanthus Rhizosphere | MEMDFANVAGMFKANTDIINKAIADVSPEHWFQKPGDDSNHLMFVLGHLVVHRGRTLNTLGVDWNAPWVP |
| Ga0065712_106069922 | 3300005290 | Miscanthus Rhizosphere | MEADFKNISGMFRFNTDIIGKAIADVRNEDWFRAPGDDSNHMMWLLGHVIVHRGQVLNAIGV |
| Ga0065715_104566111 | 3300005293 | Miscanthus Rhizosphere | METDFKNISGMFRANTDIISKAIADVQPEDWFRTPGDDSNHLMWLLGHVVVHRGQVLKTLGTDW |
| Ga0068869_1006886861 | 3300005334 | Miscanthus Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRGLVLKTIGG |
| Ga0068869_1009356771 | 3300005334 | Miscanthus Rhizosphere | METDFKNISGMFRANTDIISKAIADVQPEDWFRTPGDDSNHL |
| Ga0068869_1009487292 | 3300005334 | Miscanthus Rhizosphere | METSFSNIKGMFKFNTDIINKAITDVKDEDWFRTPGDDSNHLLWMLGHVVV |
| Ga0068868_1012354191 | 3300005338 | Miscanthus Rhizosphere | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPGDNSN |
| Ga0070689_1016336271 | 3300005340 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRGLVLKTI |
| Ga0070661_1003310853 | 3300005344 | Corn Rhizosphere | METSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLLWMLGHVVVHR |
| Ga0070659_1009087053 | 3300005366 | Corn Rhizosphere | METDFRNISGMFRTNTDIINRAIADVRSEDWFRKPGDDSNHLMWL |
| Ga0070709_112031621 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MENGFSNVASMFKTNTDIINKAIADVAADDWFRKPGDDSNHLLWVLGHVVVHRGRTLGFL |
| Ga0070701_101588093 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFKNISGIYRADTDIINKAIADVSPDDWFRKPGDDSNHLMWLLGHVVVHR |
| Ga0070701_106549561 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFRNISGIYRTNTEIVNRAIAGIEPEHWLKQPGDDSNHLLWMLGHVVVHR |
| Ga0070700_1013163431 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | METSFSNIKGMYKVNTDIINMAIADVKTEDWFRTPGDDSNHLMWLLGHIVVHRGKVLTMLGADW |
| Ga0070700_1015799332 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | METSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLLWMLGHVVIHRGMVL |
| Ga0070694_1010457831 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MENGFSNVASMFKTNTDIINKAIADVAADDWFRKPGDDSNHLLWVLGHVVVHRGRTLGFLGA |
| Ga0070708_1021345961 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIAQDEEAKMETSFSNIKGMYKVNTDIINMAIADVKTEDWFRTPGDDSNHLMWLLGHIVVHRGKVLTMLG |
| Ga0070707_1014901472 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFSNIEGMFKTNTHIINKTISEVRPEDWFRNPGDDSNHLLWLLGHVVVH |
| Ga0070679_1016814641 | 3300005530 | Corn Rhizosphere | METDFKNISGMFRTNTDIINKAIADVRPEDWFRAPGDDSNHLMWLLGH |
| Ga0068853_1020219341 | 3300005539 | Corn Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGH |
| Ga0070672_1019786571 | 3300005543 | Miscanthus Rhizosphere | METDFKNISGIYRADTDIINKAIADVSPDDWFRKPGDDSNHLMWLLGHVVVHRGLVLKTLGGQW |
| Ga0070695_1005769143 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFKNISGMFRNNTEIINKAIAGVSPEDWFRKPGDDSNHLMWLLGHVV |
| Ga0070693_1001493631 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFKNISGMFRTNTDIINKAIADVRPEDWFRAPGDDSNHLMWLLGHVVVHRAQVLK |
| Ga0070704_1016191512 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFNNISGIYRANTDIINKAIADVSPEDWFRKPGDDSNHLMWLLGHVVVHR |
| Ga0070664_1008813313 | 3300005564 | Corn Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSN |
| Ga0068854_1003997581 | 3300005578 | Corn Rhizosphere | METDFKNTSGMFKFNTDIISKAIADVRDEDWFRAPGDDSNHLMWLLGHVVVHRGQVL |
| Ga0068854_1007010273 | 3300005578 | Corn Rhizosphere | METDFKNTSGMFRFNTDIIGKAIDGVRTEDWFRAPGD |
| Ga0068859_1020365642 | 3300005617 | Switchgrass Rhizosphere | METDFKNISGMFRNNTEIINKAIAGVSPEDWFRKPGD |
| Ga0068863_1015121062 | 3300005841 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVSPEDWFRTPGDDSNHLMWLLGHVVVHRGLVLKTLGS |
| Ga0068863_1022928792 | 3300005841 | Switchgrass Rhizosphere | METSFSNIKGMFKFNTDIINKAITDVKDEDWFRTPGDDSNHLLWMLGHVVVHR |
| Ga0068858_1006856391 | 3300005842 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRGLVLKTIGGQW |
| Ga0068858_1010066511 | 3300005842 | Switchgrass Rhizosphere | METDFKNISGIYRADTDIINKAIADVSPDDWFRKPGDDSNHLMWLLGHVVVHRGLVLKT |
| Ga0079222_104266923 | 3300006755 | Agricultural Soil | MENGLHNVASIFKANTDIINKAIADVSPDDWFRQPGEDSNHLLWLMGHVIVHRGRTLN |
| Ga0079221_106881141 | 3300006804 | Agricultural Soil | METDFKNISGMFKANTDIVNKAIAGVEADHWFKKPGDDSNHLTWVLGHLIVHRGQILKI |
| Ga0075433_113025243 | 3300006852 | Populus Rhizosphere | METDLTNIAGMFKTNTDIVDRAIADVPAEDWFRKPGDDSNHLLWV |
| Ga0075424_1005583741 | 3300006904 | Populus Rhizosphere | METSFSNIKGMFKVNTDIINMALGDVKTEDWFRTPG |
| Ga0105240_123825631 | 3300009093 | Corn Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHLVVHRGLVLKTIGGQW |
| Ga0114129_103688373 | 3300009147 | Populus Rhizosphere | METDFKNITGIFKANTDIVNKAIDGVEPDHWFKRPGDDSNHLTWMMGHLI |
| Ga0105243_103059381 | 3300009148 | Miscanthus Rhizosphere | MKIAQDEEAKMETSFSNIKGMYKVNTDIINMAIADVKTEDWFRTPGDDSNHLMWLLGHIVVHRG |
| Ga0075423_110497942 | 3300009162 | Populus Rhizosphere | METDFSNIAGMFKTNTSIVNKTISEVRPEDWFRNPGDDSNHLLWLLGHLTVHRGKALKTLGQHWD |
| Ga0105241_121903851 | 3300009174 | Corn Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHL |
| Ga0105241_124311341 | 3300009174 | Corn Rhizosphere | METDFKNISGMFRNNTEIINKAIAGVSPEDWFRKPGDD |
| Ga0105248_114273991 | 3300009177 | Switchgrass Rhizosphere | METDFKNISGIYRADTDIINKAIADVSPDDWFRKPGDDSNHLMWLL |
| Ga0105237_127844711 | 3300009545 | Corn Rhizosphere | METDFKNTSGMFKFNTDIISKAIADVRPEDWFRAPGDDSNHMMWLLGHV |
| Ga0105238_119197211 | 3300009551 | Corn Rhizosphere | MEADFKNISGMFRFNTDIIGKAIADVRHEDWFRAPG |
| Ga0105238_129119602 | 3300009551 | Corn Rhizosphere | MENGLHNVASIFKANTDIINKAIADVAPDDWLRQPGEDSNHLLWLMGHVIVH |
| Ga0126315_108542412 | 3300010038 | Serpentine Soil | METDFANIAGMFKTNTEIVNKAIADVSPEHWFQKPGDDSNHLM |
| Ga0126315_111016332 | 3300010038 | Serpentine Soil | METDFSNIAGMFKINTDIVNKAIADVSPEHWFQKPGDDSNHLMFVLGHLVVHR |
| Ga0126312_103308093 | 3300010041 | Serpentine Soil | METDLSNIAGMFKINTDIINKAITDISPEHWFQKPG |
| Ga0126314_100308614 | 3300010042 | Serpentine Soil | MEMDFANVAGMFKANTDIINKAIADVSEEHWFKKP |
| Ga0126314_106341621 | 3300010042 | Serpentine Soil | METDFSNIAGMFKFNTDIVNKAIADVSPEHWFKKPGDDSNHLMFVLGHL |
| Ga0126310_100924621 | 3300010044 | Serpentine Soil | MEADFKNISGMFRANTDIISKAIADVRPDDWFRKPGDDSNHLMWLLGHVVVH |
| Ga0126310_105588601 | 3300010044 | Serpentine Soil | METSFSNISGMFRANTDIISKAIADVSPEDWFRKPGDDSNHLMWL |
| Ga0126311_106261861 | 3300010045 | Serpentine Soil | MEMDFANVAGMFKANTDIINKAIADVSEEHWFKKPGDDSNHLMFVLGHLV |
| Ga0126382_109699241 | 3300010047 | Tropical Forest Soil | LQDKEAFLETDFKNTSGMFKFNTDIISKAIADVRPEDWFRAPGDDSNHMMWLLGHVV |
| Ga0126382_113646971 | 3300010047 | Tropical Forest Soil | METSFSNIKGMYKVNTDIINMAIADVKAEDWFRSPGDDSNHLLWLLGHVVVHR |
| Ga0126376_128850512 | 3300010359 | Tropical Forest Soil | METDFRNISGMFRTNTDIINKAIADVRNEDWFRAPGDD* |
| Ga0134128_122637571 | 3300010373 | Terrestrial Soil | MNRKEREMETSFSNIKGMFKFNTDIINKAIANVKDEDWYRTPGDDSNHLMWMLGHVVV* |
| Ga0105239_107468421 | 3300010375 | Corn Rhizosphere | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPG |
| Ga0134126_109064211 | 3300010396 | Terrestrial Soil | METDFKNISGMFRTNTDIINKAIADVRPEDWFRAPGDDSNH |
| Ga0134127_129317211 | 3300010399 | Terrestrial Soil | METSFSNIKGMFKFNTDIINKAITDVKTEDWFRTPGDDSNNLMWLLGHVVVHRGLVLKT |
| Ga0134127_130679191 | 3300010399 | Terrestrial Soil | METSFSNIKGMFKFNTDIINKAIADVKTEDWFRMPGDDSNHLLWLLGHVVV |
| Ga0134122_119892331 | 3300010400 | Terrestrial Soil | METSFSNIKGMFKFNTDIINKAIADVKTEDWFRMPGDDSNHLLWLLGHVVVHRGMVLKMLGA |
| Ga0134121_126760851 | 3300010401 | Terrestrial Soil | MLNEEAEMETSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLLWMLGHVVVHRGMVL |
| Ga0134121_128893691 | 3300010401 | Terrestrial Soil | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHR |
| Ga0134123_135299181 | 3300010403 | Terrestrial Soil | MLNEEAEMETSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLLWM |
| Ga0105246_104990543 | 3300011119 | Miscanthus Rhizosphere | METSFSNISGIFKINTEVINRAIADVKHEELYRKPGDDSNHM |
| Ga0105246_114228532 | 3300011119 | Miscanthus Rhizosphere | METSFSNIKGMFKFNTDIINKAITDVKDEDWFRTPGDDSNHL |
| Ga0105246_123374071 | 3300011119 | Miscanthus Rhizosphere | METSFSNIKGMFKVNTDIINMAIADVKAEDWFRTPGDDSNHLMWLLGHIVVHRGKVL |
| Ga0164302_117754661 | 3300012961 | Soil | MFKTNTDIINKAIADVAPDDWFRKPGDDSNHLLWVLGHVV |
| Ga0164305_114678812 | 3300012989 | Soil | METDFKNISGIYRANTDIISKAIADVRPEDWFRTPGDDSNHLMWMLGHVVVHRGLVL |
| Ga0157373_111566762 | 3300013100 | Corn Rhizosphere | METSFSNIKGMFKFNTDIINKAITDVKTEDWFRTPGNDSKN |
| Ga0157373_115645162 | 3300013100 | Corn Rhizosphere | METSFSNIKGMFKFNTDIINKAIADVKTEDWFRMPGDDSNHLL |
| Ga0157371_114099351 | 3300013102 | Corn Rhizosphere | METDFKNISGIYRADTDIINKAIADVSPDDWFRKPGDDSNHLMWLLGH |
| Ga0157374_101573011 | 3300013296 | Miscanthus Rhizosphere | METDFKNISGMFRANTDIISKAIANVQPEDWCRTPGDDSNHLMWLLGHVVVHRGQVLKT |
| Ga0157378_131402961 | 3300013297 | Miscanthus Rhizosphere | METSFSNIKGMFKFNTDIINKAIADVKSEDWFRTP |
| Ga0157372_123432011 | 3300013307 | Corn Rhizosphere | METDFKNISGMFRNNTEIINKAIAGVSPEDWFRKPGDDSNHLMWLL |
| Ga0157372_130821171 | 3300013307 | Corn Rhizosphere | METSFSNIKGMFKFNTDIINTAIADVKAEDWFRMPGDDSNHLLWLL |
| Ga0157375_130240861 | 3300013308 | Miscanthus Rhizosphere | METDFKNISGIYRANTDIINKAIADVSPEDWFRTPGDDSNHLMWLLGHV |
| Ga0163163_118067861 | 3300014325 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRG |
| Ga0157380_112402731 | 3300014326 | Switchgrass Rhizosphere | VKVILNEEAEMETSFSNIKGMFKFNTDIINKAIAEVKDEDWFRRPGDDSNHL |
| Ga0182000_100590711 | 3300014487 | Soil | METDFKNISGMYRTNTDIINKAIADVSPEDWFRKPGGDSNHLMWLLGHVVVHRGQVL* |
| Ga0157379_100721174 | 3300014968 | Switchgrass Rhizosphere | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPGDNS |
| Ga0132255_1053731471 | 3300015374 | Arabidopsis Rhizosphere | METSFSNIKGMYKVNTDIINKAIADVQTEDWFRTPGDDSNHL |
| Ga0173482_103042131 | 3300019361 | Soil | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPGDDSNHLMWLLGHLVVHRGH |
| Ga0182009_107347202 | 3300021445 | Soil | MEADFKNITGMFRFNTDIVNRAIADVEPDDWFKKPGDDSNH |
| Ga0207642_109432181 | 3300025899 | Miscanthus Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMW |
| Ga0207710_101756361 | 3300025900 | Switchgrass Rhizosphere | METSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLLWMLGHVVVHRGMVLKLF |
| Ga0207710_103722401 | 3300025900 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRGLVLKTM |
| Ga0207645_104326513 | 3300025907 | Miscanthus Rhizosphere | METSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNHLMWLLGHVVVHRGLVLKTVGAD |
| Ga0207654_110376971 | 3300025911 | Corn Rhizosphere | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPGDNSNHLMWLLGHLVVH |
| Ga0207707_101081203 | 3300025912 | Corn Rhizosphere | METDFRNISGMFKANTDIVNKAIAGVEADHWFKAPGDDSNHLTW |
| Ga0207671_105063291 | 3300025914 | Corn Rhizosphere | METDFRNISGMFKANTDIVNKAIAGVEADHWFKAPGDDSNHLTWVLGHLI |
| Ga0207646_111735502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFSNIEGMFKTNTHIINKTISEVRPEDWFRNPGDDSNHLLWLLGHVVVHRGHVLK |
| Ga0207701_108748101 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDESNHLMWLLGHVV |
| Ga0207690_117820671 | 3300025932 | Corn Rhizosphere | METDFKNISGIYRADTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVV |
| Ga0207670_114702141 | 3300025936 | Switchgrass Rhizosphere | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHLV |
| Ga0207679_103502233 | 3300025945 | Corn Rhizosphere | METSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNH |
| Ga0207679_112803512 | 3300025945 | Corn Rhizosphere | METDFRNISGMFRTNTDIINRAIADVRSEDWFRKPGEDSNH |
| Ga0207703_100386701 | 3300026035 | Switchgrass Rhizosphere | METSFSNISGIFKINTEVINRAIADVKPEDWFRKPGDDSNHLMWLLGHLVVH |
| Ga0207639_103328481 | 3300026041 | Corn Rhizosphere | METDFKNISGMFRNNTEIINKAIAGVSPEDWFRKPGDDSNHLM |
| Ga0207676_107318023 | 3300026095 | Switchgrass Rhizosphere | METDFKNISGIYRADTDIINKAIADVRPEDWFRKPGDDSNHLMWLLGHVVVHRGLV |
| Ga0207676_110335363 | 3300026095 | Switchgrass Rhizosphere | METDFKNISGMFRANTDIISKAIADVQPEDWFRTPGDDSNHLMWLLGHV |
| Ga0207676_112766093 | 3300026095 | Switchgrass Rhizosphere | MGEDLSNIAGMFRTNTEIVNRAIAGVPQEDWFRKPG |
| Ga0207676_114373442 | 3300026095 | Switchgrass Rhizosphere | METSFSNIKGMFKTNTDIINKAIADVKAEDWYRQPGDESNHLMWLLGHVIVHRGLV |
| Ga0209382_108956312 | 3300027909 | Populus Rhizosphere | METDFKNITGIFKANTDIVNKAIDGVEPDHWFKRPGDDSNHLTWMMGHLII |
| Ga0268265_111031721 | 3300028380 | Switchgrass Rhizosphere | METDFKNITAIFKANTDIVNKAIEGVEPDHWFRRPGDDSNH |
| Ga0268265_114647973 | 3300028380 | Switchgrass Rhizosphere | MESEFTNVKGMFKINTDIVNKAIADVAADDWFRKPGDDSNHLMWV |
| Ga0310813_104692451 | 3300031716 | Soil | MLNEEAKMETSFSNIKGMFKFNTDIINKAIAEVKDEDWFRTPGDDSNH |
| Ga0310813_112908382 | 3300031716 | Soil | METDFKNISGMFKANTDIVNKAIAGVDADHWFKAPGDDSNHLTWVLGHLIVHRGKT |
| Ga0310813_113451982 | 3300031716 | Soil | METDFKNIAGMFKANTDIVTRAISDVEPDHWFKKPGDDSNHLTWVL |
| Ga0307468_1002873311 | 3300031740 | Hardwood Forest Soil | METSFSNIKGIYRANTDIITKAIADVKAEDWFRQPGDDSNHLMWLLGHVVVHRG |
| Ga0310810_108200831 | 3300033412 | Soil | METDFKNISGIYRANTDIINKAIADVRPEDWFRKPGDDSNHLMWL |
| ⦗Top⦘ |