| Basic Information | |
|---|---|
| Family ID | F078499 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSQET |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 2.59 % |
| % of genes from short scaffolds (< 2000 bps) | 2.59 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.414 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.828 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.138 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00092 | VWA | 62.93 |
| PF13519 | VWA_2 | 24.14 |
| PF01882 | DUF58 | 2.59 |
| PF07726 | AAA_3 | 0.86 |
| PF01479 | S4 | 0.86 |
| PF02616 | SMC_ScpA | 0.86 |
| PF13646 | HEAT_2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 2.59 |
| COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.41 % |
| All Organisms | root | All Organisms | 2.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009089|Ga0099828_10332257 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1369 | Open in IMG/M |
| 3300026333|Ga0209158_1076750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1308 | Open in IMG/M |
| 3300032180|Ga0307471_100618231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1243 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25390J43892_101083502 | 3300002911 | Grasslands Soil | MAFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAAQWSEETV |
| JGI25387J43893_10757272 | 3300002915 | Grasslands Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSHETVRQA |
| Ga0066680_101554041 | 3300005174 | Soil | MSFDAPAVLALAPLLGGAVWFGAAWARRARIRRAALWSEE |
| Ga0066675_100514761 | 3300005187 | Soil | MAFDAPIVLAVAPLVGGAVWFAAAWARRIRIRRAAQWSEETVRRAIGAGRFGP |
| Ga0066675_100576511 | 3300005187 | Soil | MSFDAPVVLALAPLLGGAVWFGAAWARRARVRRAALWSQETVRAAL |
| Ga0070694_1014281551 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFDAPMVLLIAPIVGGAGWFAAAWARHARLKRAARWSPETERAARAAGRWGPTTVS |
| Ga0070698_1005159442 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSQETVRQAVTA |
| Ga0070698_1016856592 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFDAPMVLLIAPIVGGAGWFAAAWARHARLKRAARWSPE |
| Ga0070731_104848461 | 3300005538 | Surface Soil | VITFDAPVVLALAPVVGGVVWFAAAWARRVRLGRAAL |
| Ga0070704_1005574672 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MITFDAPVVFALAPVVGAAVWVAAIWARGSRIRRAAAWSESTARIARGAGRL |
| Ga0066701_100985211 | 3300005552 | Soil | VITFDAPFVLALAPLVGGAVWFGAAWARRVRIRRAALWSDATAT |
| Ga0066695_102654622 | 3300005553 | Soil | MTFDAPIVVALSPVVAVAVWFAAAWARRTRIRRAAAWSEQTARTARAAGRLGSGTLGLA |
| Ga0066692_103946632 | 3300005555 | Soil | VITFDAPFVLALAPLVGGAVWFGAAWARRVRIRRAALWSDATATLARNAGRGGPTVL |
| Ga0066692_108435722 | 3300005555 | Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALW |
| Ga0066704_107335911 | 3300005557 | Soil | VITFDAPFVLALAPLVGGGVWFGAAWARRVRIRRAALWSEAT |
| Ga0066698_101500943 | 3300005558 | Soil | VITFDAPFVLALAPLVGGAVWFGAAWARRVRIRRAALWSDATATLARN |
| Ga0066698_106891032 | 3300005558 | Soil | MITFDAPVVIVLAPIVAGAVWSAAAWARRTRLRRAAAWSESTAR |
| Ga0066700_100292975 | 3300005559 | Soil | MSFDAPVVLALAPLLGGAVWFGAAWARRARVRRAALWSQETVRA |
| Ga0066700_108308432 | 3300005559 | Soil | MAFDAPVVLAIAPLVGGAVWFAAAWARRVRIRRAALWSEETVRR |
| Ga0066670_100596873 | 3300005560 | Soil | MAFDAPIVLAVAPLVGGAVWFAAAWARRIRIRRAAQWSEETVRRA |
| Ga0066699_100003231 | 3300005561 | Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSHETVRQAVAAGRL |
| Ga0066658_101666842 | 3300006794 | Soil | MSFDAPVVLALAPLLGGAVWFGAAWARRARVRRAALWSQE |
| Ga0066665_105810472 | 3300006796 | Soil | MSFDAPVVLALAPLVGGAVWFAAAWARRARIRRAGLWSEE |
| Ga0079220_101051663 | 3300006806 | Agricultural Soil | MAFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSEETVRRALA |
| Ga0075434_1007917601 | 3300006871 | Populus Rhizosphere | MITFDAPSVGALAPVVGGAVWAAAAWARRVRVRRAAAWSEA |
| Ga0075426_102224403 | 3300006903 | Populus Rhizosphere | MTFDAPVVVFLSPIVAAAVWAAAAWARRARIRRAAAWSE |
| Ga0075436_1012006331 | 3300006914 | Populus Rhizosphere | MSFDAPMVLLIAPIVGGAGWFAAAWARHARLKRAARWSPETERAAR |
| Ga0075435_1009432791 | 3300007076 | Populus Rhizosphere | MTFDAPIVLALAPLIGGAVWFAAAWARRVRIRRAALWSQETVRQAVTAG |
| Ga0099793_102698962 | 3300007258 | Vadose Zone Soil | VITFDAPIVVALAPIVGGAVWTAAAWARRTRVRRAAAWSEATARIAR |
| Ga0099829_102252261 | 3300009038 | Vadose Zone Soil | VTCDAPIVLAIAPLIGGAVWFAAAWARRTRIRRAALW |
| Ga0099829_106327551 | 3300009038 | Vadose Zone Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSQETVRQAVAAGR |
| Ga0099830_101809623 | 3300009088 | Vadose Zone Soil | MTFDAPVVLALAPLVGGAVWFAAAWARRVRLRRAALW |
| Ga0099830_103945582 | 3300009088 | Vadose Zone Soil | MAFDAPVVLLLAPLLGGAVWFAAAWARRVRVRRAAAWA |
| Ga0099830_108341502 | 3300009088 | Vadose Zone Soil | MTFDAPVVLLLAPLLGGAVWFAAAWARRVRVRRAAA |
| Ga0099828_103322571 | 3300009089 | Vadose Zone Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSQETVRQAVAAGRL |
| Ga0066709_1025307082 | 3300009137 | Grasslands Soil | MTFDAPVVLALSPLVGGAVWLAAAWALFVRLWRAALLPAD |
| Ga0134088_100963911 | 3300010304 | Grasslands Soil | MSFDAPFVLALAPLVAGAAWFGAAWARRVRVRRAARWS |
| Ga0134109_104024292 | 3300010320 | Grasslands Soil | MTFDAPVVVLLAPIVGGAVWAAAVWARRSRIRRAAAWSEATARIARSAGRL |
| Ga0134111_100153661 | 3300010329 | Grasslands Soil | MSFDAPVVLALAPLLGGAVWFAAAWARRARVRRAAL |
| Ga0136847_112000191 | 3300010391 | Freshwater Sediment | MSIDTPLVLLLAPLVGAAVWAGAAWARGVRVRRAAQ |
| Ga0134121_129643671 | 3300010401 | Terrestrial Soil | MTFDAPVVLAIAPLIGGAVWFAAAWARRTRIRRAALWSQETVRQAVTAGRLGPT |
| Ga0137326_11278452 | 3300011417 | Soil | VITFDAPFVLWLAPVVAAAVWLGAAWARRVRLRRAALWSEQTAA |
| Ga0137452_11059341 | 3300011441 | Soil | VITFDAPFVLWLAPVVAAAVWLGAAWARRVRLRRAALWS* |
| Ga0137321_10067251 | 3300012175 | Soil | MITFDAPIVFALAPVVGAAVWAAAVWARRSRIRRAA |
| Ga0137399_111159721 | 3300012203 | Vadose Zone Soil | MITFDAPVVVLLAPVVGAAVWLAAAWARRSRIRRAAAWSEATARIARGAGRLGTPA |
| Ga0137374_111145201 | 3300012204 | Vadose Zone Soil | MTFDAPALVALSPLIGAAAWFAAAWGRRARVRRAAAWSP |
| Ga0137362_109075342 | 3300012205 | Vadose Zone Soil | MITFDAPVVITLAPVVAGAVWAASAWARRARVRRAAAWSES |
| Ga0137381_105562602 | 3300012207 | Vadose Zone Soil | MSFDAPVVLALAPLAGGAVWFAAAWARRARIRRAALWSE |
| Ga0137377_103829503 | 3300012211 | Vadose Zone Soil | MITFDAPVVIILAPVVAGAVWAAAAWARRSRLRRAAAWSE |
| Ga0137387_101727341 | 3300012349 | Vadose Zone Soil | MSFDAPIVLALAPLVGGAVWFAAAWARRVRIRRAALWSEETERLARGA |
| Ga0137369_102913561 | 3300012355 | Vadose Zone Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSQETVRQALAAGGLGPTALA |
| Ga0137368_100565691 | 3300012358 | Vadose Zone Soil | MTFDAPALVALSPAIGGAAWFAAAWARRVRVRRAA |
| Ga0137385_109613541 | 3300012359 | Vadose Zone Soil | VITFDAPFVLALAPLVGGAAWFGAAWARRVRIRRASL |
| Ga0137361_113256241 | 3300012362 | Vadose Zone Soil | VITFDAPIVVALAPMVAGAVWAAAAWTRRSRVRRAAAWS |
| Ga0137404_104215681 | 3300012929 | Vadose Zone Soil | MSFDAPMVLLIAPIVGGAGWFAAAWARHARLKRAARW |
| Ga0134079_104227172 | 3300014166 | Grasslands Soil | MITFDAPIVVVLAPLVARAVWASAAWARRSRVRRDAAWSEATARIARSAGKLG |
| Ga0180066_10467472 | 3300014873 | Soil | MAFDAPAVLALAPVIGGFVWFVAAWARRVRLRRASRWSPATARVARDAG |
| Ga0137411_12543912 | 3300015052 | Vadose Zone Soil | MTFDAPIVLAIAPLIGGAVWFAAAWARRTRIRRAALWSQETVRQAVAAG |
| Ga0137412_109492481 | 3300015242 | Vadose Zone Soil | MTFDAPVVLAIAPLIGGAVWFAAAWARRTRIRRAALWSQETVRQAVGAGR |
| Ga0180073_11404702 | 3300015256 | Soil | VIAFDAPAVLALAPVIGGFVWFAAAWARRVRLRRAAHWSPATARVA |
| Ga0134072_100041905 | 3300015357 | Grasslands Soil | MTFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSQET |
| Ga0134089_103082821 | 3300015358 | Grasslands Soil | MMTFDAPFVLLCAPFVGGAVWFAAAWARRVRIRRALRWSVE |
| Ga0134085_104894632 | 3300015359 | Grasslands Soil | MITFDAPVVIILAPVVAGAVWGAAAWARRVRVRRAA |
| Ga0132258_137748751 | 3300015371 | Arabidopsis Rhizosphere | MTFDAPVVLLLAPLVGGAVWFAAAWARRVRLRRAALWSQETVR |
| Ga0134069_11211352 | 3300017654 | Grasslands Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSHETVRQAVAAGR |
| Ga0134112_102862691 | 3300017656 | Grasslands Soil | MSFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSEDTVRRAL |
| Ga0134112_104238901 | 3300017656 | Grasslands Soil | MITFDAPVVFALAPVVAGAVWTAAAWARRSRLRRAAAWSEATGRIA |
| Ga0134112_104660342 | 3300017656 | Grasslands Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSQETVRQAVA |
| Ga0134074_12403942 | 3300017657 | Grasslands Soil | MSFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSQETVRQA |
| Ga0134074_13521072 | 3300017657 | Grasslands Soil | MITFDAPVVILLAPIVGAVVWSAAAWARRSRIRRAA |
| Ga0134074_13976262 | 3300017657 | Grasslands Soil | MSFDAPIVLALAPLVGGAVWFAAAWARRVRIRRAALWSDETERLARG |
| Ga0134083_101778182 | 3300017659 | Grasslands Soil | MTFDAPIVLAIAPLIGGAVWFAAAWARRTRIRRAALWSQETVRQAVAAGRLGPTALAVAAFLG |
| Ga0134083_101918441 | 3300017659 | Grasslands Soil | MTFDAPFVLALAPLIGGAVWFAAAWARRVRVRRAGLWSQETVRQALAAGRPGPTAVAV |
| Ga0134083_103427952 | 3300017659 | Grasslands Soil | MITFDAPIVIMLAPIVAGAIWAAAAWARRSRLRRAAAWSESTAR |
| Ga0187776_108704171 | 3300017966 | Tropical Peatland | MITFDAPFVLALAPLVGGAVWFGAAWARRVRIHRAALWSQQT |
| Ga0193725_10035176 | 3300019883 | Soil | VITFDAPFVLWLAPLVAAAVWFGAAWARRVRLRRAALWSE |
| Ga0193755_11029172 | 3300020004 | Soil | MTFDAPIVVALSPLVVTAVWFAAAWARRARIRRAAAWSEQTA |
| Ga0193733_10645512 | 3300020022 | Soil | MTFDAPVVLVLAPLIGGAVWFAAAWARRVRIRRAA |
| Ga0179594_103909441 | 3300020170 | Vadose Zone Soil | MITFDAPVVITLAPVVAGAVWAASAWARRARVRRAAAWS |
| Ga0210382_100559061 | 3300021080 | Groundwater Sediment | MTFDAPVVVALSPVVGAVIWFAAAWARRARVRRAA |
| Ga0210379_103253492 | 3300021081 | Groundwater Sediment | MITFDAPVVVALSPIVGGAVWAAAVWARRSRIRRAA |
| Ga0224452_10339713 | 3300022534 | Groundwater Sediment | MTFDAPILVALSPLLAAAVWFAAVWARRARIRRAAAWSEQTA |
| Ga0222622_111477992 | 3300022756 | Groundwater Sediment | MMTFDAPIVVALSPLLAIAVWFAAGWARRARIRRAAAWSEQ |
| Ga0207648_118519332 | 3300026089 | Miscanthus Rhizosphere | MITFDAPVVVVLAPILGAVVWAAASWARRSRIRRAAAWSEATARIARSA |
| Ga0209235_12517051 | 3300026296 | Grasslands Soil | VITFDAPIVVALAPMVAGAVWAAAAWTRRSRVRRAAAWSEATA |
| Ga0209236_12037721 | 3300026298 | Grasslands Soil | MITFDAPVVIILAPVVAGAVWAASAWARRARVRRAAAWSEGTARIARA |
| Ga0209236_13031622 | 3300026298 | Grasslands Soil | MSFDAPFVLALAPLVAGAAWFGAAWARRVRVRRAAQW |
| Ga0209027_12293621 | 3300026300 | Grasslands Soil | MSFDAPVVLALAPLLGGAVWFGAAWARRARVRRAGLWSQETVRA |
| Ga0209468_12048582 | 3300026306 | Soil | MTFDAPFVLALAPLIGGAVWFAAAWARRVRVRRAGLWSQET |
| Ga0209469_10165291 | 3300026307 | Soil | MTFDAPVVLALAPLIGGAAWFAAAWARRVRIRRAALWSH |
| Ga0209055_10241584 | 3300026309 | Soil | MAFDAPVVLAIAPLVGGAVWFAAAWARRVRIRRAALWSEETVRRAIGAG |
| Ga0209268_10089376 | 3300026314 | Soil | VITFDAPIVVALAPVVAAAVWSMAAWARRSRLRRAAAWSEAT |
| Ga0209687_11695502 | 3300026322 | Soil | MAFDAPVVLGLAPLVGGAVWFAAAWARRVRIRRAAL |
| Ga0209470_11762681 | 3300026324 | Soil | MTFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSQETVRQA |
| Ga0209267_10055741 | 3300026331 | Soil | MSFDAPVVLALAPLVGGAVWFAAAWARRVRIRRAALWSEDT |
| Ga0209267_12945561 | 3300026331 | Soil | MSFDAPVVLALAPLLGGAVWFGAAWARRARVRRAGLWSQETVRAA |
| Ga0209158_10767503 | 3300026333 | Soil | MTFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSHETVRQ |
| Ga0209160_12712531 | 3300026532 | Soil | VITFDAPFVLALAPLVGGGVWFGAAWARRVRIRRA |
| Ga0209058_10082581 | 3300026536 | Soil | MSFDAPFVLALAPLVAGAAWFGAAWARRVRVRRAARWSQE |
| Ga0209156_103521622 | 3300026547 | Soil | MSFDAPIVLALAPLVGGAVWFAAAWARRVRIRRAAL |
| Ga0209884_10168332 | 3300027013 | Groundwater Sand | MITFDAPVVVALSPIVGGAVWAAAAWARRSRIRRAAAWSEE |
| Ga0209590_104408982 | 3300027882 | Vadose Zone Soil | VIAFDAPFVLALAPLVGGGVWFGAAWARRVRIRRAALWSEATAALARAAGRGGPTALSVV |
| Ga0209590_106028162 | 3300027882 | Vadose Zone Soil | MTFDAPVVLLLAPLVGGAVWFAAAWARRVRLRRAALWSQDTVRLALAA |
| Ga0209382_111257182 | 3300027909 | Populus Rhizosphere | VTFDAPIVVALAPILGAAVWFAAAWARRARIRRAAAWSEQ |
| Ga0307293_102666432 | 3300028711 | Soil | MMTFDAPIVVALSPLLAIAVWFAAGWARRARIRRA |
| Ga0307501_101054612 | 3300031152 | Soil | VITFDAPIVGALAPVAAGVIWATAAWARRSRVRRAAA |
| Ga0307473_105787772 | 3300031820 | Hardwood Forest Soil | MTFDAPIVLALAPLIGGAVWFAAAWARRVRIRRAAL |
| Ga0307471_1006182313 | 3300032180 | Hardwood Forest Soil | MSFDAPVVLALAPLIGGAVWFAAAWARRVRIRRAALWSEETVRRALSAGR |
| Ga0307471_1008974812 | 3300032180 | Hardwood Forest Soil | MSFDAPAVLLIAPLIGGVMWFAAAWARRVRLRRAAQWSPD |
| Ga0307471_1031001852 | 3300032180 | Hardwood Forest Soil | MITFDAPVVFALAPVVGAAVWVAAIWARRSRIRRA |
| Ga0307472_1004386301 | 3300032205 | Hardwood Forest Soil | MITFDAPIVGALAPVVGGAVWAAAAWARRARVRRAAAW |
| Ga0307472_1018740232 | 3300032205 | Hardwood Forest Soil | MTFDAPVVLAIAPLIGGAVWFAAAWARRTRIRRAALWSQETVRQAVTAGRLGPTAL |
| Ga0335085_105193683 | 3300032770 | Soil | MEFDAPLVLFLAPLVGGAVWFAAAWARRARLSRAARWSAEAA |
| Ga0335083_104701581 | 3300032954 | Soil | MITFDAPFVLALAPLVGGAVWFGAAWARRVRIRRAALW |
| Ga0314867_162372_1_174 | 3300033808 | Peatland | MITFDAPFVLALAPVVGGAIWFGAAWARRVRIRRAALWSERTETAARDAGRGGPTSLS |
| Ga0364940_0150418_557_670 | 3300034164 | Sediment | MITFDAPVALALAPLVAMAVWLAAAWARRVRIGRAARW |
| ⦗Top⦘ |