| Basic Information | |
|---|---|
| Family ID | F078493 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VTASLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIF |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.10 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.414 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF03702 | AnmK | 89.66 |
| PF00072 | Response_reg | 1.72 |
| PF04030 | ALO | 0.86 |
| PF12680 | SnoaL_2 | 0.86 |
| PF01019 | G_glu_transpept | 0.86 |
| PF09234 | DUF1963 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 89.66 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.86 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.86 |
| COG3878 | Uncharacterized conserved protein YwqG, DUF1963 family | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.41 % |
| Unclassified | root | N/A | 2.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10714701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
| 3300002560|JGI25383J37093_10026653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1937 | Open in IMG/M |
| 3300002560|JGI25383J37093_10132771 | Not Available | 680 | Open in IMG/M |
| 3300002908|JGI25382J43887_10302172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 699 | Open in IMG/M |
| 3300002916|JGI25389J43894_1040775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 798 | Open in IMG/M |
| 3300005174|Ga0066680_10514649 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300005174|Ga0066680_10626293 | Not Available | 670 | Open in IMG/M |
| 3300005180|Ga0066685_10069197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2308 | Open in IMG/M |
| 3300005180|Ga0066685_10495988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 846 | Open in IMG/M |
| 3300005181|Ga0066678_10025392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3159 | Open in IMG/M |
| 3300005187|Ga0066675_10629008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 806 | Open in IMG/M |
| 3300005294|Ga0065705_11155920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300005436|Ga0070713_100390283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1299 | Open in IMG/M |
| 3300005552|Ga0066701_10919248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300005556|Ga0066707_10662618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
| 3300005559|Ga0066700_10590226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 775 | Open in IMG/M |
| 3300005560|Ga0066670_10559574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
| 3300005561|Ga0066699_10600138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300005574|Ga0066694_10228652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
| 3300005586|Ga0066691_10410599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 805 | Open in IMG/M |
| 3300005598|Ga0066706_10207922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1506 | Open in IMG/M |
| 3300005843|Ga0068860_102254060 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005889|Ga0075290_1032073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300006031|Ga0066651_10023217 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300006032|Ga0066696_10338229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 980 | Open in IMG/M |
| 3300006034|Ga0066656_10732211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300006794|Ga0066658_10637582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
| 3300006845|Ga0075421_100382254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1695 | Open in IMG/M |
| 3300006904|Ga0075424_100565126 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300007076|Ga0075435_101007076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 727 | Open in IMG/M |
| 3300007265|Ga0099794_10351216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 767 | Open in IMG/M |
| 3300009012|Ga0066710_101417965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1076 | Open in IMG/M |
| 3300009012|Ga0066710_102957134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300009143|Ga0099792_10470256 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
| 3300009156|Ga0111538_12663579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300009162|Ga0075423_11076456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
| 3300010323|Ga0134086_10136337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
| 3300010326|Ga0134065_10088911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1010 | Open in IMG/M |
| 3300010336|Ga0134071_10105592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1341 | Open in IMG/M |
| 3300011429|Ga0137455_1256398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300012159|Ga0137344_1093201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 557 | Open in IMG/M |
| 3300012166|Ga0137350_1112188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300012201|Ga0137365_10107704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2097 | Open in IMG/M |
| 3300012201|Ga0137365_10128719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1903 | Open in IMG/M |
| 3300012206|Ga0137380_11471199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300012207|Ga0137381_11406162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 590 | Open in IMG/M |
| 3300012207|Ga0137381_11790215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300012208|Ga0137376_10639079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
| 3300012209|Ga0137379_10532688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1082 | Open in IMG/M |
| 3300012285|Ga0137370_10270087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1010 | Open in IMG/M |
| 3300012349|Ga0137387_10143414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1697 | Open in IMG/M |
| 3300012349|Ga0137387_10521567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 862 | Open in IMG/M |
| 3300012353|Ga0137367_11133497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300012355|Ga0137369_10454965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 913 | Open in IMG/M |
| 3300012357|Ga0137384_10085623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2621 | Open in IMG/M |
| 3300012361|Ga0137360_10085243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2380 | Open in IMG/M |
| 3300012362|Ga0137361_10708877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 919 | Open in IMG/M |
| 3300012532|Ga0137373_10598390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
| 3300012683|Ga0137398_10216342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1268 | Open in IMG/M |
| 3300012683|Ga0137398_10504930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
| 3300012917|Ga0137395_10074008 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300012923|Ga0137359_10282643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1479 | Open in IMG/M |
| 3300012930|Ga0137407_10646427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 994 | Open in IMG/M |
| 3300012972|Ga0134077_10482248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300012976|Ga0134076_10103151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1133 | Open in IMG/M |
| 3300012976|Ga0134076_10247293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
| 3300012976|Ga0134076_10544809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300012976|Ga0134076_10620355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300014150|Ga0134081_10137880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 793 | Open in IMG/M |
| 3300015054|Ga0137420_1292052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300015356|Ga0134073_10237260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300017656|Ga0134112_10195282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 790 | Open in IMG/M |
| 3300017659|Ga0134083_10225480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 779 | Open in IMG/M |
| 3300017659|Ga0134083_10431623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300018029|Ga0187787_10066953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1095 | Open in IMG/M |
| 3300018056|Ga0184623_10326307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300018056|Ga0184623_10329429 | Not Available | 686 | Open in IMG/M |
| 3300018431|Ga0066655_10068558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1893 | Open in IMG/M |
| 3300018431|Ga0066655_11161720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300018433|Ga0066667_10579015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300018433|Ga0066667_10941701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 744 | Open in IMG/M |
| 3300018468|Ga0066662_12964332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300018482|Ga0066669_10783727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 843 | Open in IMG/M |
| 3300019868|Ga0193720_1013476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1142 | Open in IMG/M |
| 3300019882|Ga0193713_1005200 | All Organisms → cellular organisms → Bacteria | 4111 | Open in IMG/M |
| 3300020170|Ga0179594_10129926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 922 | Open in IMG/M |
| 3300021073|Ga0210378_10065039 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300021080|Ga0210382_10030305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2028 | Open in IMG/M |
| 3300024330|Ga0137417_1425446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1407 | Open in IMG/M |
| 3300025521|Ga0210083_1024976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 850 | Open in IMG/M |
| 3300025910|Ga0207684_10429165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1135 | Open in IMG/M |
| 3300025922|Ga0207646_10393910 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1251 | Open in IMG/M |
| 3300026277|Ga0209350_1095103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
| 3300026277|Ga0209350_1122640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
| 3300026296|Ga0209235_1233868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 581 | Open in IMG/M |
| 3300026296|Ga0209235_1267721 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300026298|Ga0209236_1323369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300026315|Ga0209686_1075317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1197 | Open in IMG/M |
| 3300026325|Ga0209152_10056434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1390 | Open in IMG/M |
| 3300026332|Ga0209803_1088036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1288 | Open in IMG/M |
| 3300026333|Ga0209158_1302459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300026334|Ga0209377_1192943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300026523|Ga0209808_1017143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3626 | Open in IMG/M |
| 3300026536|Ga0209058_1249078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300026537|Ga0209157_1068749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1785 | Open in IMG/M |
| 3300026540|Ga0209376_1229111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
| 3300026548|Ga0209161_10340826 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300026557|Ga0179587_10069090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2076 | Open in IMG/M |
| 3300027882|Ga0209590_10458509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 824 | Open in IMG/M |
| 3300028381|Ga0268264_10787699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 949 | Open in IMG/M |
| 3300028884|Ga0307308_10205690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 943 | Open in IMG/M |
| 3300030620|Ga0302046_10706440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 816 | Open in IMG/M |
| 3300031720|Ga0307469_11352565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300031740|Ga0307468_100455122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
| 3300031949|Ga0214473_12121053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300034773|Ga0364936_084502 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.86% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_107147011 | 3300001686 | Soil | MTRARLVCPAVRWRRGSFKSEQANIEQALAAGVGGFILFGG |
| JGI25383J37093_100266531 | 3300002560 | Grasslands Soil | VTTSLARLAFPALRWRPSGGGFDHERAKIDAALAAGVGGFIIFGGTRD |
| JGI25383J37093_101327712 | 3300002560 | Grasslands Soil | MTPRARLVCPALRWRRGSFKSERTKIEQALAAGVGGFILFG |
| JGI25382J43887_103021722 | 3300002908 | Grasslands Soil | VTTSLARLAFPALRWRPSGGGFDHERAKIDAALAAGVGGF |
| JGI25389J43894_10407751 | 3300002916 | Grasslands Soil | VTSSLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIF |
| Ga0066680_105146491 | 3300005174 | Soil | VIQPRARLVCPALRWRRGSFRSNRATIDAALAAGVGGFIL |
| Ga0066680_106262931 | 3300005174 | Soil | MIQPRARLVCPALRWRRGSFRSNRATIDAALAAGVGGFIL |
| Ga0066685_100691973 | 3300005180 | Soil | VTASLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIF |
| Ga0066685_104959882 | 3300005180 | Soil | MMPPPPPRARLVCPALRWRRGSFKSERTKIEQALAAGVGG |
| Ga0066678_100253921 | 3300005181 | Soil | VTDSLARLVFPALRWRRESFAHERAKIDAALAAGVGGFIIF |
| Ga0066675_106290082 | 3300005187 | Soil | VTPAPSLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIF |
| Ga0065705_111559201 | 3300005294 | Switchgrass Rhizosphere | MNRARLVFPALRARNGVFTHERAKIKAALAAGVGGFIVFGGKPEAVKTLAYAA |
| Ga0070713_1003902832 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAPPSLARLVFPALRWRPSDGSFEHERRKIDAALAAGVGGFIIFGGTRAA |
| Ga0066701_109192481 | 3300005552 | Soil | VTTSLARLVFPSLRWRSGSFAHERATIDAALAAGVGGFIVF |
| Ga0066707_106626182 | 3300005556 | Soil | VTTSLARLAFPALRWRPSGGGFDHERAKIDAALAAGVGGFIIFGGT |
| Ga0066700_105902262 | 3300005559 | Soil | VIQPRARLVCPALRWRRGSFRSNRATIDAALAAGVGGFILFGGTRD |
| Ga0066670_105595741 | 3300005560 | Soil | VTSAPSLARLVFPALRWRRGSFAHERAKIDAALAAGVGG |
| Ga0066699_106001381 | 3300005561 | Soil | VTSSLARLVFPALRGRPSAGGFDHERRKIDAALAAGVGGFIVFGGTLESVT |
| Ga0066694_102286522 | 3300005574 | Soil | VTTSLARLVFPSLRWRGGSFAHERATIDAALAAGV |
| Ga0066691_104105992 | 3300005586 | Soil | VTTSLARLVFPALRWRGGSFDHERAKIDAALAAGV |
| Ga0066706_102079223 | 3300005598 | Soil | VSASLARLVFPSLRSRPAHGGFAHERAKIDAALAAG |
| Ga0068860_1022540602 | 3300005843 | Switchgrass Rhizosphere | VCPALRWRHGSFQSEQTKVKQALAAGVGGFILFGGTRAAVST |
| Ga0075290_10320732 | 3300005889 | Rice Paddy Soil | VTASLARLVFPSLRWRPSEASFAHERRKIDAALAAGVGGFI |
| Ga0066651_100232174 | 3300006031 | Soil | VSGSLARLVFPALRWRRQSFDHEQAKIDAALAAGVGGFIIFGGT |
| Ga0066696_103382292 | 3300006032 | Soil | VSGSLARLVFPALRWRRKSFDHEQAKIDAALAAGVGGFII |
| Ga0066656_107322111 | 3300006034 | Soil | VIGSLARLVFPSLRWRPSDGSFEHERRKIDAALAAGVG |
| Ga0066658_106375822 | 3300006794 | Soil | VTPAPSLARLVFPALRWRRGSFAHERARIDAALAASVGGFIIFGGTREAITALTRE |
| Ga0075421_1003822543 | 3300006845 | Populus Rhizosphere | MMRRPRARLVCPAIRWRRGSFQSEQVRIKEALAAGVGGFILFGGTRAA |
| Ga0075424_1005651263 | 3300006904 | Populus Rhizosphere | VLLTPRARLVCPALRWRRGSFKSERTKIEQALAAGVGGFILFGGTR |
| Ga0075435_1010070761 | 3300007076 | Populus Rhizosphere | MTPRARLVCPALRFRRGSFRSERVKIEQALAAGVGGFILFGGNRAAV |
| Ga0099794_103512163 | 3300007265 | Vadose Zone Soil | MISPRARLVCPALRWRRGSFRSERTKIEQALAAGVGGFILFGGTR |
| Ga0066710_1014179652 | 3300009012 | Grasslands Soil | VTSSLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFI |
| Ga0066710_1029571342 | 3300009012 | Grasslands Soil | VTGSLARLVFPALRWRRESFGHERPKIDAALAAGV |
| Ga0099792_104702561 | 3300009143 | Vadose Zone Soil | VTGSLARLVFPALRWRRESFAHERPKIDAALAAGVGGFI |
| Ga0111538_126635791 | 3300009156 | Populus Rhizosphere | MNRARLVFPALRARNGVFTHERAKIKAALAAGVGGFILFGGTRAAVTA |
| Ga0075423_110764561 | 3300009162 | Populus Rhizosphere | MTPRARLVCPALRWRRGSFKSERSKIEQALAAGVGGFILFGG |
| Ga0134086_101363372 | 3300010323 | Grasslands Soil | VTTSLARLVFPALRWRGGSFDHERAKIDAALAAGVGGFIIFGGT |
| Ga0134065_100889112 | 3300010326 | Grasslands Soil | VTGSLARLVFPSLRWRRESFAHERPKIDAALAAGVGGFIVFG |
| Ga0134071_101055921 | 3300010336 | Grasslands Soil | VTTSLARLVFPALRLRGGSFDHERAKIDAALAAGVGGFIIFGGTPA |
| Ga0137455_12563982 | 3300011429 | Soil | VSGSLARLVFPSLRFRPSSGGFAHERAKIDAALKA |
| Ga0137344_10932012 | 3300012159 | Soil | LRSSNSRARLVFPALRARRGVFTHERAKIKAALAAGVGGFILFGGTRASVTALTRAVRIE |
| Ga0137350_11121882 | 3300012166 | Soil | VSGSLARLVFPSLRFRPSSGGFAHERAKIDAALKARVGGFILFGGDRESVKKLTT |
| Ga0137365_101077041 | 3300012201 | Vadose Zone Soil | VTGSLARLVFPALRWRRESFGHERPKIDAALAAGVGGFIVF |
| Ga0137365_101287193 | 3300012201 | Vadose Zone Soil | VTSSLARLVFPALRWRPSNGSFEHERRKIDAALAAGVGGFIIFGGNREA |
| Ga0137380_114711991 | 3300012206 | Vadose Zone Soil | VSGSLARLVFPALRWRHQSFDHEQAKIDAALAAGVG |
| Ga0137381_114061622 | 3300012207 | Vadose Zone Soil | MTRARLVFPALRARRGVFTHERAKITAALKAGVGGFILFGGTRDSVTALTRALRRE |
| Ga0137381_117902152 | 3300012207 | Vadose Zone Soil | VTSSLARLVFPALRWRPSAGGFDHERRKIDAALAAG |
| Ga0137376_106390791 | 3300012208 | Vadose Zone Soil | VTPAPSLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIFGGTREA |
| Ga0137379_105326881 | 3300012209 | Vadose Zone Soil | MIPRARLVCPALRWRRGSFRSNRATIDAALAAGVGG |
| Ga0137370_102700871 | 3300012285 | Vadose Zone Soil | VSGSLARLVFPALRWRRKSFDHEQAKIDAALAAGVGGFIIFGG |
| Ga0137387_101434141 | 3300012349 | Vadose Zone Soil | VTGSLARLVFPSLRWRRESFAHERPKIDAALAAGVGGFIVF |
| Ga0137387_105215671 | 3300012349 | Vadose Zone Soil | VTGSLARLVFPALRWRPSDGSFAHERPKIDAALAAGVGGFIV |
| Ga0137367_111334972 | 3300012353 | Vadose Zone Soil | VTSSLARLVFPALRWRPSAGSFEHERAKIDAALAAGVGGFIIF |
| Ga0137369_104549651 | 3300012355 | Vadose Zone Soil | MTRARLVFPALRAQRGVFTHERAKITAALAAGVGGFILFGGTRAAVAALTRA |
| Ga0137384_100856231 | 3300012357 | Vadose Zone Soil | VSASLARLVFPSLRSRPAHGGFAHERAKIEAALAAGVGGFILFSGNRESVAALTAE |
| Ga0137360_100852431 | 3300012361 | Vadose Zone Soil | MIPRARLVCPALRWRRGSFKSERTKIEQALAAGVG |
| Ga0137361_107088771 | 3300012362 | Vadose Zone Soil | MISPRARLVCPALRWRRGSFRSERAKIEQALAAGVGGFIL |
| Ga0137373_105983901 | 3300012532 | Vadose Zone Soil | VTGSLARLVFPALRWRRASFAHERPKIDAALVAGVGGFIV |
| Ga0137398_102163421 | 3300012683 | Vadose Zone Soil | MSDIVPRARLVCPALRWRRGSFTSERHKMGQALAAGVGGFILFG |
| Ga0137398_105049302 | 3300012683 | Vadose Zone Soil | VTASLARLVFPALRWQRAAFANERAKIDQAIAAGVGGFIVFGGTR |
| Ga0137395_100740083 | 3300012917 | Vadose Zone Soil | VTGSLARLVFPALRWRRESFAHERPKIDAALAAGVGGF |
| Ga0137359_102826431 | 3300012923 | Vadose Zone Soil | MIPRARLVCPALRWRRGSFKSERTKIEQALAAGVGG |
| Ga0137407_106464272 | 3300012930 | Vadose Zone Soil | MTPRARLVCPAVRWRRGSFKSERTKIEQALAAGVGGFIL |
| Ga0134077_104822482 | 3300012972 | Grasslands Soil | VSGSLARLVFPALRWRRQSFDHEQAKIDAALAAGVGGFIIFGGTGAT |
| Ga0134076_101031511 | 3300012976 | Grasslands Soil | VTTSLARLVFPALRWRRESFAHERPKIDAALAAGVGGFIV |
| Ga0134076_102472931 | 3300012976 | Grasslands Soil | VSQPRARLVCPALRWRHGSFRSNRATIDAALAAGVGGFIL |
| Ga0134076_105448092 | 3300012976 | Grasslands Soil | MTSLPRARLVCPALRWRRGSFKSERTKIEQALAAGVGGFILFGGT |
| Ga0134076_106203551 | 3300012976 | Grasslands Soil | MTPRARLVCPALRWRRGSFRSERTKIEQALAAGVGGFILFGGTRA |
| Ga0134081_101378801 | 3300014150 | Grasslands Soil | VTSSLARLVFPALRGRPSAGGFDHERRKIDAALAA |
| Ga0137420_12920521 | 3300015054 | Vadose Zone Soil | MIPRARLVCPALRWRRGSFRSERAKIEQALAAGVGGFIPFCLAA |
| Ga0134073_102372602 | 3300015356 | Grasslands Soil | VTASLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIFGG |
| Ga0134112_101952822 | 3300017656 | Grasslands Soil | VTTSLARLVFPALRWRRESFAHERPKIDAALAAGVGGFIVFGGTREA |
| Ga0134083_102254801 | 3300017659 | Grasslands Soil | VTGSLARLVFPALRWRRESFGHERPKIDAALAAGVGGFI |
| Ga0134083_104316231 | 3300017659 | Grasslands Soil | MIPRARLVCPALRWRRGSFKSESIKIEQALAAGVGGFILFGGTRAA |
| Ga0187787_100669532 | 3300018029 | Tropical Peatland | MTSTLARLVFPSLRFRPAHGGFDHERAKIDAALVAGVGGF |
| Ga0184623_103263072 | 3300018056 | Groundwater Sediment | MTRARLVFPALRARGGVFTHERAKITAALAAGVGGFILFGGTRAAVTA |
| Ga0184623_103294291 | 3300018056 | Groundwater Sediment | VSASLARLVFPSLRPRGGSFAQERAKIDAALAAGVGGFIV |
| Ga0066655_100685581 | 3300018431 | Grasslands Soil | VTPAPSLARLVFPALRWRRGSFAHERVKIDAALAAGV |
| Ga0066655_111617202 | 3300018431 | Grasslands Soil | VSGSLARLVFPALRWRRGSFAHERPKIDAALAAGVGGFIVFGGTRDA |
| Ga0066667_105790151 | 3300018433 | Grasslands Soil | VTTSLARLVFPSLRWRGGSFAHERATIDAALAAGVGGFI |
| Ga0066667_109417012 | 3300018433 | Grasslands Soil | MIQPRARLVCPALRWRRGSFRSNRATIDAALAAGVGGFILFGG |
| Ga0066662_129643322 | 3300018468 | Grasslands Soil | VTTSLARLVFPALRWRGGSFDHERAKIDAALAAGVGGFIIFGGTPASVGAL |
| Ga0066669_107837272 | 3300018482 | Grasslands Soil | VTSSLARLVFPALRWRRGSFAHERAKIDAALAAGVGGFIIFGGTREATA |
| Ga0193720_10134761 | 3300019868 | Soil | VTVSLARLVFPALRWRSTAGGFAHERPKIDAALAA |
| Ga0193713_10052007 | 3300019882 | Soil | MTRARLVFPALRARRGVFTHERAKITAALAAGVGGFILFGGTRRAV |
| Ga0179594_101299261 | 3300020170 | Vadose Zone Soil | MTPRARLVCPALRWRRGSFRSERTKIEQALAAGVG |
| Ga0210378_100650393 | 3300021073 | Groundwater Sediment | MTPRARLVCPALRWRRGSFKSERTKIEQAVAAGVG |
| Ga0210382_100303053 | 3300021080 | Groundwater Sediment | MTRARLVFPALRARGGVFTHERAKITAALAAGVGGFILFGGTRAAVTALTRALRLEAKRG |
| Ga0137417_14254461 | 3300024330 | Vadose Zone Soil | VTGSLARLVFPALRWRRESFAHERPKIPRSTARWP |
| Ga0210083_10249761 | 3300025521 | Natural And Restored Wetlands | VTALARLVFPALRWRNGSFAHERARIDAALAAGVGGF |
| Ga0207684_104291652 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPPPSLARLVFPALRWRPSDGSFEHERRKIDAALAAGV |
| Ga0207646_103939102 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPARARLVCPALRWRRGSFRSERAKIEQALAAGVGGFILFGGTHAA |
| Ga0209350_10951031 | 3300026277 | Grasslands Soil | VIQPRARLVCPALRWQRGSFRSNRATIDAALAAGIG |
| Ga0209350_11226402 | 3300026277 | Grasslands Soil | VTGSLARLVFPSLRWRRESFAHERPKIDAALAAGVGGFIVFGGTRE |
| Ga0209235_12338681 | 3300026296 | Grasslands Soil | VSASLARLVFPSLRSRPAHGGFAHEHAKIDAALAAGVGG |
| Ga0209235_12677212 | 3300026296 | Grasslands Soil | VTGSLARLVFPALRWRRESFGHERPKIDAALAAGVG |
| Ga0209236_13233692 | 3300026298 | Grasslands Soil | MSASLARLVFPSLRSRPAHGGFAHEHAKIDAALAAGVGGFIL |
| Ga0209686_10753172 | 3300026315 | Soil | VTASLARLVFPALRWRRGSFEQERVKIDAALAAGVGGFIIF |
| Ga0209152_100564343 | 3300026325 | Soil | VTGSLARLVFPSLRWRRESFAHERPKIDAALAAGVGGFIVFGGTREAVTT |
| Ga0209803_10880361 | 3300026332 | Soil | VTTSLARLAFPALRWRPSGGGFDHERAKIDAALAAGVGGFII |
| Ga0209158_13024591 | 3300026333 | Soil | VTASLARLVFPALRWRRGSFAHERATIDAALTAGVGGFI |
| Ga0209377_11929431 | 3300026334 | Soil | MITRARLVCPALRWRRGSFKSERTKIEQALAAGVGGFILFGGT |
| Ga0209808_10171431 | 3300026523 | Soil | VSGSLARLVFPALRWRSHSFDHEQAKIDAALAAGVGGFIIFGGTRET |
| Ga0209058_12490782 | 3300026536 | Soil | VIGSLARLVFPSLRWRPSDGSFEHERRKIDAALAAGVGGFIVF |
| Ga0209157_10687493 | 3300026537 | Soil | VSASLARLVFPSLRSRPAHGGFAHEHAKIDAALAAGVGGFILFGGDRES |
| Ga0209376_12291112 | 3300026540 | Soil | MILPPLPRARLVCPALRWRRGSFKSERTKIEQALAAGVGGFIL |
| Ga0209161_103408261 | 3300026548 | Soil | VSGSLARLVFPALRWRRKSFDHEQAKIDAALAAGVGGFIIFGGT |
| Ga0179587_100690903 | 3300026557 | Vadose Zone Soil | VTGSLARLVFPALRWRRESFAHERPKIEAALAAGVGGFIVFG |
| Ga0209590_104585093 | 3300027882 | Vadose Zone Soil | MISPRARLVCPALRWRRGSFRSERTKIEQALAAGVGGFI |
| Ga0268264_107876992 | 3300028381 | Switchgrass Rhizosphere | VCPALRWRHGSFQSEQTKVKQALAAGVGGFILFGGTRAAVSTLT |
| Ga0307308_102056901 | 3300028884 | Soil | MTRARLVFPALRAQRGVFTHERAKITAALKAGVGGF |
| Ga0302046_107064402 | 3300030620 | Soil | VNPLPSRARLVFPALRWRRGSFAQERAKIDAALAAG |
| Ga0307469_113525652 | 3300031720 | Hardwood Forest Soil | VSASLARLVFPSLRFRPAHGGFAHERAKIDAALAAG |
| Ga0307468_1004551221 | 3300031740 | Hardwood Forest Soil | MTPRARLVCPALRWRRGSFRSERSKIEQALAAGVGGFILFG |
| Ga0214473_121210532 | 3300031949 | Soil | VTRARLVCPALRWRRGSFAHERATIDAALARGVGGFI |
| Ga0364936_084502_2_148 | 3300034773 | Sediment | MTRARLVFPALRARGGVFTHERAKITAALAAGVGGFILFGGTRAAVTAL |
| ⦗Top⦘ |