| Basic Information | |
|---|---|
| Family ID | F078414 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 3.74 % |
| % of genes near scaffold ends (potentially truncated) | 87.07 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (64.655 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.690 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 1.72 |
| PF09723 | Zn-ribbon_8 | 0.86 |
| PF14279 | HNH_5 | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.24 % |
| Unclassified | root | N/A | 7.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003497|JGI25925J51416_10123409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300004448|Ga0065861_1099659 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300005527|Ga0068876_10146110 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300005581|Ga0049081_10182602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300006802|Ga0070749_10223323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
| 3300006805|Ga0075464_10198550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
| 3300006805|Ga0075464_10787625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300006805|Ga0075464_10787708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300006805|Ga0075464_10821524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300006805|Ga0075464_10874070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300006805|Ga0075464_11094704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300006920|Ga0070748_1320725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300007363|Ga0075458_10015594 | All Organisms → Viruses → Predicted Viral | 2421 | Open in IMG/M |
| 3300007363|Ga0075458_10155249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300007520|Ga0105054_11126688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300007538|Ga0099851_1067035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
| 3300007542|Ga0099846_1298219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300008266|Ga0114363_1074285 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300008266|Ga0114363_1091024 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300008266|Ga0114363_1144708 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300008266|Ga0114363_1167894 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300008266|Ga0114363_1186888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300008266|Ga0114363_1193770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300008267|Ga0114364_1057645 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300008267|Ga0114364_1178996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300008448|Ga0114876_1051934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300008448|Ga0114876_1234215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300008450|Ga0114880_1074855 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300008450|Ga0114880_1098590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300008450|Ga0114880_1137387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300008450|Ga0114880_1235929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300008450|Ga0114880_1275137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300009026|Ga0102829_1132932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300009068|Ga0114973_10104685 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300009082|Ga0105099_10566523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300009082|Ga0105099_11043256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300009151|Ga0114962_10713094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009154|Ga0114963_10607315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300009155|Ga0114968_10157133 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300009159|Ga0114978_10822879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300009163|Ga0114970_10618615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009164|Ga0114975_10130671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300009164|Ga0114975_10530169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300009165|Ga0105102_10680298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300009165|Ga0105102_10849707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300009169|Ga0105097_10171428 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300009169|Ga0105097_10873326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300009184|Ga0114976_10276029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300009184|Ga0114976_10489878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300009187|Ga0114972_10781270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300009469|Ga0127401_1030278 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300009469|Ga0127401_1096635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300009470|Ga0126447_1119861 | All Organisms → cellular organisms → Bacteria → PVC group | 640 | Open in IMG/M |
| 3300009864|Ga0132193_100835 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300010158|Ga0114960_10441609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300010368|Ga0129324_10212240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300010885|Ga0133913_11253064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
| 3300010885|Ga0133913_11359431 | All Organisms → Viruses → Predicted Viral | 1810 | Open in IMG/M |
| 3300012000|Ga0119951_1141175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300012352|Ga0157138_1016492 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300012352|Ga0157138_1022697 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300012964|Ga0153916_11572612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300013004|Ga0164293_10196687 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300013004|Ga0164293_10503545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300013005|Ga0164292_10150613 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300014811|Ga0119960_1004513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300017736|Ga0181365_1125057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300017780|Ga0181346_1087786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300017780|Ga0181346_1174450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300017784|Ga0181348_1283043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300017785|Ga0181355_1038014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2066 | Open in IMG/M |
| 3300019784|Ga0181359_1053110 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300020205|Ga0211731_10610977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300020551|Ga0208360_1009725 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300021956|Ga0213922_1042225 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300022190|Ga0181354_1076001 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300023174|Ga0214921_10233287 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300024343|Ga0244777_10836887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300024481|Ga0256330_1038688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300024503|Ga0255152_1037322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
| 3300024509|Ga0255175_1073094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300025635|Ga0208147_1051203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
| 3300025635|Ga0208147_1069104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300027396|Ga0255146_1016395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
| 3300027712|Ga0209499_1031380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2337 | Open in IMG/M |
| 3300027749|Ga0209084_1333054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027759|Ga0209296_1283408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300027759|Ga0209296_1285887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300027764|Ga0209134_10239893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300027797|Ga0209107_10474005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300027963|Ga0209400_1115221 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300027969|Ga0209191_1225182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300027971|Ga0209401_1061332 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300028025|Ga0247723_1016290 | All Organisms → Viruses → Predicted Viral | 2635 | Open in IMG/M |
| 3300028392|Ga0304729_1174565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300031857|Ga0315909_10189145 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300031951|Ga0315904_10930650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300031963|Ga0315901_11129213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300033996|Ga0334979_0539252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300034061|Ga0334987_0480857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300034103|Ga0335030_0376509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300034105|Ga0335035_0287485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300034106|Ga0335036_0119219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1914 | Open in IMG/M |
| 3300034118|Ga0335053_0144616 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300034119|Ga0335054_0332223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300034283|Ga0335007_0228990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
| 3300034283|Ga0335007_0638895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.79% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.62% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.45% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.45% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.86% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.86% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.86% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009864 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25925J51416_101234091 | 3300003497 | Freshwater Lake | VLVKLARSMESAKVDTYIDAAAYIAIAGQLHTEENELYV* |
| Ga0065861_10996591 | 3300004448 | Marine | MALVKVARSMETAKVDNFIDGAAYFAISGQLATEENELYV* |
| Ga0068876_101461104 | 3300005527 | Freshwater Lake | VKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV* |
| Ga0049081_101826021 | 3300005581 | Freshwater Lentic | VKIARSMETAKTDTYVDLVAYAAIAGQLHTEENEHYV* |
| Ga0070749_102233233 | 3300006802 | Aqueous | ALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0075464_101985504 | 3300006805 | Aqueous | VKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV* |
| Ga0075464_107876251 | 3300006805 | Aqueous | MCMALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0075464_107877082 | 3300006805 | Aqueous | CMALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0075464_108215241 | 3300006805 | Aqueous | LVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0075464_108740702 | 3300006805 | Aqueous | ARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV* |
| Ga0075464_110947041 | 3300006805 | Aqueous | ALVKLARSMESSLVDHYLDAAAYIAISGALHTQENELYV* |
| Ga0070748_12460052 | 3300006920 | Aqueous | MPINDYQVAMCLALVKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV* |
| Ga0070748_13207251 | 3300006920 | Aqueous | TDYQVAMCMALVKIARSMETAKTDTYIDLVAYTSLAAQLHTEENDLYV* |
| Ga0075458_100155946 | 3300007363 | Aqueous | VKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV* |
| Ga0075458_101552491 | 3300007363 | Aqueous | ALVKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV* |
| Ga0105054_111266882 | 3300007520 | Freshwater | CMALVKVARSMETAKVDTYIDAAAYIAIAGQLHTEENELYV* |
| Ga0099851_10670355 | 3300007538 | Aqueous | KIARSMESAKVDNYIDASAYLAIAGQLHTEENELYV* |
| Ga0099846_12982191 | 3300007542 | Aqueous | VANCMALVKLARSMESAKVDNYIDGAAYFAIAGQLHTTENELYV* |
| Ga0114340_12552341 | 3300008107 | Freshwater, Plankton | ASLWSAYLEMPVADSQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0114363_10742851 | 3300008266 | Freshwater, Plankton | SCMALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV* |
| Ga0114363_10910241 | 3300008266 | Freshwater, Plankton | MVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV* |
| Ga0114363_11447082 | 3300008266 | Freshwater, Plankton | MVLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV* |
| Ga0114363_11678943 | 3300008266 | Freshwater, Plankton | ITDYQVAMCMALVKIARSMESGKPDNYIDGCAYFAIAGQLHTEENDLYV* |
| Ga0114363_11868881 | 3300008266 | Freshwater, Plankton | LARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV* |
| Ga0114363_11937701 | 3300008266 | Freshwater, Plankton | SCMVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV* |
| Ga0114364_10576451 | 3300008267 | Freshwater, Plankton | LVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV* |
| Ga0114364_11789961 | 3300008267 | Freshwater, Plankton | MVLVKLARSMESGKVDTYIDGAAYMAIAGTLHTQEDDLYA* |
| Ga0114876_10519341 | 3300008448 | Freshwater Lake | ALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENQLYV* |
| Ga0114876_12342151 | 3300008448 | Freshwater Lake | VKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV* |
| Ga0114880_10748551 | 3300008450 | Freshwater Lake | KLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV* |
| Ga0114880_10985904 | 3300008450 | Freshwater Lake | VKIARSMETAKTDTYVDLVAYAAIAAQLHTEENEQYV* |
| Ga0114880_11373871 | 3300008450 | Freshwater Lake | VKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV* |
| Ga0114880_12359291 | 3300008450 | Freshwater Lake | MCMALVKIARSMESGKPDNYIDGCAYFAIAGQLHTEENDLYV* |
| Ga0114880_12751372 | 3300008450 | Freshwater Lake | VKVARSMETGKVDNYIDGAAYMAIAGQLHTEENELYV* |
| Ga0102829_11329321 | 3300009026 | Estuarine | IARSMETAKADTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0114973_101046855 | 3300009068 | Freshwater Lake | MALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV* |
| Ga0105099_105665232 | 3300009082 | Freshwater Sediment | ARSMESAKVDTYIDAAAYMAIAGQLHTQENELYV* |
| Ga0105099_110432562 | 3300009082 | Freshwater Sediment | ARSMETGKVDNYIDGAAYFAIAGQLHTEENDIYV* |
| Ga0114962_107130941 | 3300009151 | Freshwater Lake | KIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV* |
| Ga0114963_106073151 | 3300009154 | Freshwater Lake | ALVKVARSMESAKSDNFVDGCAYFALSGMLHTEENDLYV* |
| Ga0114968_101571331 | 3300009155 | Freshwater Lake | ALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV* |
| Ga0114978_108228792 | 3300009159 | Freshwater Lake | LVKIARSMESPKTDTYVDLVAYTSLAAQLHTEENDLYV* |
| Ga0114970_106186152 | 3300009163 | Freshwater Lake | MCMALVKIARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV* |
| Ga0114975_101306714 | 3300009164 | Freshwater Lake | ARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV* |
| Ga0114975_102993802 | 3300009164 | Freshwater Lake | SRTASLWAAYLEMPVEPHQVAMCLALVKIARSMETGKVDNYIDGAAYFAISGQLKLEENQLYV* |
| Ga0114975_105301692 | 3300009164 | Freshwater Lake | LALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV* |
| Ga0105102_106802981 | 3300009165 | Freshwater Sediment | VAGIMVLVKLARSMETPKVDTYVDLCAYGAIMGTIHTQEDELYV* |
| Ga0105102_108497072 | 3300009165 | Freshwater Sediment | QVASCLALVKLARSMESPKVDTYIDAAAYMAIAGQLHTEENELYV* |
| Ga0105097_101714281 | 3300009169 | Freshwater Sediment | MALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0105097_108733261 | 3300009169 | Freshwater Sediment | QVATCMALVKIARSMETAKVDNQLDACAYIAISGMLQTQENELYV* |
| Ga0114976_102760293 | 3300009184 | Freshwater Lake | VLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV* |
| Ga0114976_104898782 | 3300009184 | Freshwater Lake | LVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV* |
| Ga0114972_107812702 | 3300009187 | Freshwater Lake | VKIARSMETAKSDTYIDLTAYVAIAGQLHTEENELYV* |
| Ga0127401_10302785 | 3300009469 | Meromictic Pond | MCMALVKIARSMETAKTDTYVDLVAYASLAAQLHTEENELYV* |
| Ga0127401_10966351 | 3300009469 | Meromictic Pond | MCMALVKIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV* |
| Ga0126447_11198611 | 3300009470 | Meromictic Pond | KIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV* |
| Ga0132193_1008354 | 3300009864 | Meromictic Pond | CMALVKIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV* |
| Ga0114960_104416092 | 3300010158 | Freshwater Lake | MALVKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV* |
| Ga0129324_102122402 | 3300010368 | Freshwater To Marine Saline Gradient | VKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV* |
| Ga0133913_112530641 | 3300010885 | Freshwater Lake | GIMVLVKLARSMETGSVDTYVDMAAYVGIMGQLHTEENELYV* |
| Ga0133913_113594315 | 3300010885 | Freshwater Lake | MALVKIARSMETGKVDNNIDAAAYIAISGQLQTQENELYV* |
| Ga0119951_11411752 | 3300012000 | Freshwater | ARSMETAKSDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0157138_10164924 | 3300012352 | Freshwater | QVAMCMALVKIARSMETAKTDTYVDLVAYTSLAAQLHTTENDLYV* |
| Ga0157138_10226973 | 3300012352 | Freshwater | CLALVKVARSMETGKVDNYIDGAAYFAISGSLRTEENELYV* |
| Ga0153916_115726122 | 3300012964 | Freshwater Wetlands | LALVKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV* |
| Ga0164293_101966871 | 3300013004 | Freshwater | MALVKLARSMETGKVDNYIDGAAYMAIAGQLHTQENDLYV* |
| Ga0164293_105035451 | 3300013004 | Freshwater | VKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV* |
| Ga0164293_106114042 | 3300013004 | Freshwater | SLWSAYLEIPVTDYQVAMCLALVKIARSMETPKPDNYIDGTAYFAIAGQLHTEENDLYV* |
| Ga0164292_101506131 | 3300013005 | Freshwater | AMCLALVKIARSMETPKPDNYIDGTAYFAIAGQLHTEENDLYV* |
| Ga0119960_10045133 | 3300014811 | Aquatic | FPSHDRISMEGDKVDNIVDLCGYASISGQLRTEENELYV* |
| Ga0181365_11250572 | 3300017736 | Freshwater Lake | CMALVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV |
| Ga0181346_10877864 | 3300017780 | Freshwater Lake | VKVARSMETGKVDNYIDGAAYFAISGQLKLEENELYV |
| Ga0181346_11744501 | 3300017780 | Freshwater Lake | IARSMETAKVDTYVDAVAYLAIAGQLHTEENELYV |
| Ga0181348_12830432 | 3300017784 | Freshwater Lake | VKLARSMESASVDTYVDMAAYAAIAGTLHTQENELYV |
| Ga0181355_10380141 | 3300017785 | Freshwater Lake | PVEPHQVAMCLALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENQLYV |
| Ga0181359_10531101 | 3300019784 | Freshwater Lake | VARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV |
| Ga0211731_106109771 | 3300020205 | Freshwater | AMVKIGRSMESAKVDNYIDGAAYFAISGQLRTEENELYV |
| Ga0208360_10097254 | 3300020551 | Freshwater | CMALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV |
| Ga0213922_10422253 | 3300021956 | Freshwater | MALVKIARSMETAKTDTYIDLAAYVAIAGQLHTEENDLYV |
| Ga0222713_108207762 | 3300021962 | Estuarine Water | WSAYLEMPITDYQVAMCLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0181354_10760014 | 3300022190 | Freshwater Lake | KMVLVKLARSMESAKVDTYIDAAAYIAIAGQLHTEENELYV |
| Ga0214921_102332873 | 3300023174 | Freshwater | LVKIARSMETPKSDTYIDLAAYVAIAGQLHTEENELYV |
| Ga0244777_108368871 | 3300024343 | Estuarine | TDYQVAMCLALVKIARSMETPKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0256330_10386883 | 3300024481 | Freshwater | VARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV |
| Ga0255152_10373223 | 3300024503 | Freshwater | LVKVARSMESGKVDNYIDGAAYVAISGQLRNEENELYV |
| Ga0255175_10730942 | 3300024509 | Freshwater | MCMALVKAARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV |
| Ga0208147_10512031 | 3300025635 | Aqueous | ITDYQVAMCLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0208147_10691043 | 3300025635 | Aqueous | ALVKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV |
| Ga0255146_10163951 | 3300027396 | Freshwater | VAMCMALVKAARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV |
| Ga0209499_10313806 | 3300027712 | Freshwater Lake | CMALVKIARSMETAKTDTYIDLVAYTSLAAQLHTEENELYV |
| Ga0209084_13330541 | 3300027749 | Freshwater Lake | KIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV |
| Ga0209296_12834082 | 3300027759 | Freshwater Lake | VKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV |
| Ga0209296_12858872 | 3300027759 | Freshwater Lake | AMCMALVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV |
| Ga0209134_102398931 | 3300027764 | Freshwater Lake | ASCMVLVKLARSMESGKVDTYIDAAAYMAIAGQLHTEENELYV |
| Ga0209107_104740051 | 3300027797 | Freshwater And Sediment | MCMALVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV |
| Ga0209400_11152211 | 3300027963 | Freshwater Lake | ALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV |
| Ga0209191_11843142 | 3300027969 | Freshwater Lake | RTASLWAAYLEMPVEPHQVAMCLALVKIARSMETGKVDNYIDGAAYFAISGQLKLEENQLYV |
| Ga0209191_12251821 | 3300027969 | Freshwater Lake | LALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0209401_10613321 | 3300027971 | Freshwater Lake | CMALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV |
| Ga0247723_10162908 | 3300028025 | Deep Subsurface Sediment | CMALVKIARSMETAKTDTYIDLAAYVAIAGQLHTEENELYV |
| Ga0304729_11745652 | 3300028392 | Freshwater Lake | MALVKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV |
| Ga0315909_101891451 | 3300031857 | Freshwater | CMVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV |
| Ga0315904_109306502 | 3300031951 | Freshwater | QVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0315901_111292132 | 3300031963 | Freshwater | VLVKLARSMESPKVDTYVDLCAYGAIMGTIHTQEDELYV |
| Ga0315903_112215442 | 3300032116 | Freshwater | SLWSAYLEMPVTDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0334979_0539252_3_128 | 3300033996 | Freshwater | CMALVKVARSMESGKPDNFIDGCAYFAISGQLHTEENDLYV |
| Ga0334987_0480857_12_134 | 3300034061 | Freshwater | MALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV |
| Ga0334987_0523031_2_163 | 3300034061 | Freshwater | LEMPITDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0335030_0376509_814_927 | 3300034103 | Freshwater | VKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV |
| Ga0335035_0287485_2_115 | 3300034105 | Freshwater | VKIARSMESAKIDNAVDGCSYLAIAGMLQTQENELYV |
| Ga0335036_0119219_1782_1913 | 3300034106 | Freshwater | AMCMALVKIARSMESAKPDHFIDLCGYAAISGQLHTEENDLYV |
| Ga0335053_0144616_1417_1572 | 3300034118 | Freshwater | MPVTDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0335053_0336669_773_934 | 3300034118 | Freshwater | LEMPVTDYQVAMCLALVKIARSMESPKPDNYIDGAAYFAIAGQLHTEENDLYV |
| Ga0335054_0332223_722_844 | 3300034119 | Freshwater | MVLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV |
| Ga0335007_0228990_1128_1250 | 3300034283 | Freshwater | MALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENELYV |
| Ga0335007_0638895_482_607 | 3300034283 | Freshwater | CMALVKIARSMETAKTDTYVDLVAYAAIAAQLHTEENEQYV |
| ⦗Top⦘ |