NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078414

Metagenome / Metatranscriptome Family F078414

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078414
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 41 residues
Representative Sequence ALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV
Number of Associated Samples 80
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 3.74 %
% of genes near scaffold ends (potentially truncated) 87.07 %
% of genes from short scaffolds (< 2000 bps) 88.79 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (64.655 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(20.690 % of family members)
Environment Ontology (ENVO) Unclassified
(56.034 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(63.793 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.76%    β-sheet: 0.00%    Coil/Unstructured: 52.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF01844HNH 1.72
PF09723Zn-ribbon_8 0.86
PF14279HNH_5 0.86



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.24 %
UnclassifiedrootN/A7.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003497|JGI25925J51416_10123409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300004448|Ga0065861_1099659All Organisms → Viruses → Predicted Viral1694Open in IMG/M
3300005527|Ga0068876_10146110All Organisms → Viruses → Predicted Viral1391Open in IMG/M
3300005581|Ga0049081_10182602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300006802|Ga0070749_10223323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1073Open in IMG/M
3300006805|Ga0075464_10198550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1191Open in IMG/M
3300006805|Ga0075464_10787625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300006805|Ga0075464_10787708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300006805|Ga0075464_10821524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300006805|Ga0075464_10874070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300006805|Ga0075464_11094704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300006920|Ga0070748_1320725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300007363|Ga0075458_10015594All Organisms → Viruses → Predicted Viral2421Open in IMG/M
3300007363|Ga0075458_10155249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300007520|Ga0105054_11126688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300007538|Ga0099851_1067035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1394Open in IMG/M
3300007542|Ga0099846_1298219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300008266|Ga0114363_1074285All Organisms → Viruses → Predicted Viral1283Open in IMG/M
3300008266|Ga0114363_1091024All Organisms → Viruses → Predicted Viral1115Open in IMG/M
3300008266|Ga0114363_1144708All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300008266|Ga0114363_1167894All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300008266|Ga0114363_1186888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300008266|Ga0114363_1193770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300008267|Ga0114364_1057645All Organisms → Viruses → Predicted Viral1361Open in IMG/M
3300008267|Ga0114364_1178996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300008448|Ga0114876_1051934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1845Open in IMG/M
3300008448|Ga0114876_1234215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300008450|Ga0114880_1074855All Organisms → Viruses → Predicted Viral1366Open in IMG/M
3300008450|Ga0114880_1098590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1134Open in IMG/M
3300008450|Ga0114880_1137387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300008450|Ga0114880_1235929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300008450|Ga0114880_1275137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300009026|Ga0102829_1132932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300009068|Ga0114973_10104685All Organisms → Viruses → Predicted Viral1605Open in IMG/M
3300009082|Ga0105099_10566523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300009082|Ga0105099_11043256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300009151|Ga0114962_10713094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300009154|Ga0114963_10607315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300009155|Ga0114968_10157133All Organisms → Viruses → Predicted Viral1345Open in IMG/M
3300009159|Ga0114978_10822879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300009163|Ga0114970_10618615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300009164|Ga0114975_10130671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1444Open in IMG/M
3300009164|Ga0114975_10530169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300009165|Ga0105102_10680298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300009165|Ga0105102_10849707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300009169|Ga0105097_10171428All Organisms → Viruses → Predicted Viral1194Open in IMG/M
3300009169|Ga0105097_10873326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300009184|Ga0114976_10276029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage905Open in IMG/M
3300009184|Ga0114976_10489878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300009187|Ga0114972_10781270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300009469|Ga0127401_1030278All Organisms → Viruses → Predicted Viral1570Open in IMG/M
3300009469|Ga0127401_1096635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300009470|Ga0126447_1119861All Organisms → cellular organisms → Bacteria → PVC group640Open in IMG/M
3300009864|Ga0132193_100835All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300010158|Ga0114960_10441609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300010368|Ga0129324_10212240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300010885|Ga0133913_11253064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1898Open in IMG/M
3300010885|Ga0133913_11359431All Organisms → Viruses → Predicted Viral1810Open in IMG/M
3300012000|Ga0119951_1141175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300012352|Ga0157138_1016492All Organisms → Viruses → Predicted Viral1193Open in IMG/M
3300012352|Ga0157138_1022697All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300012964|Ga0153916_11572612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300013004|Ga0164293_10196687All Organisms → Viruses → Predicted Viral1460Open in IMG/M
3300013004|Ga0164293_10503545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300013005|Ga0164292_10150613All Organisms → Viruses → Predicted Viral1701Open in IMG/M
3300014811|Ga0119960_1004513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1036Open in IMG/M
3300017736|Ga0181365_1125057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300017780|Ga0181346_1087786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1219Open in IMG/M
3300017780|Ga0181346_1174450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300017784|Ga0181348_1283043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300017785|Ga0181355_1038014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2066Open in IMG/M
3300019784|Ga0181359_1053110All Organisms → Viruses → Predicted Viral1561Open in IMG/M
3300020205|Ga0211731_10610977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300020551|Ga0208360_1009725All Organisms → Viruses → Predicted Viral1384Open in IMG/M
3300021956|Ga0213922_1042225All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300022190|Ga0181354_1076001All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300023174|Ga0214921_10233287All Organisms → Viruses → Predicted Viral1102Open in IMG/M
3300024343|Ga0244777_10836887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300024481|Ga0256330_1038688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300024503|Ga0255152_1037322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage891Open in IMG/M
3300024509|Ga0255175_1073094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300025635|Ga0208147_1051203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1057Open in IMG/M
3300025635|Ga0208147_1069104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300027396|Ga0255146_1016395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1580Open in IMG/M
3300027712|Ga0209499_1031380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2337Open in IMG/M
3300027749|Ga0209084_1333054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300027759|Ga0209296_1283408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300027759|Ga0209296_1285887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300027764|Ga0209134_10239893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300027797|Ga0209107_10474005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300027963|Ga0209400_1115221All Organisms → Viruses → Predicted Viral1224Open in IMG/M
3300027969|Ga0209191_1225182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300027971|Ga0209401_1061332All Organisms → Viruses → Predicted Viral1663Open in IMG/M
3300028025|Ga0247723_1016290All Organisms → Viruses → Predicted Viral2635Open in IMG/M
3300028392|Ga0304729_1174565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300031857|Ga0315909_10189145All Organisms → Viruses → Predicted Viral1645Open in IMG/M
3300031951|Ga0315904_10930650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300031963|Ga0315901_11129213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300033996|Ga0334979_0539252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300034061|Ga0334987_0480857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300034103|Ga0335030_0376509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300034105|Ga0335035_0287485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300034106|Ga0335036_0119219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1914Open in IMG/M
3300034118|Ga0335053_0144616All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300034119|Ga0335054_0332223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage884Open in IMG/M
3300034283|Ga0335007_0228990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1268Open in IMG/M
3300034283|Ga0335007_0638895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake20.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.62%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton7.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.45%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond2.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.72%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.86%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.86%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.86%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.86%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.86%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.86%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007520Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009864Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024481Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25925J51416_1012340913300003497Freshwater LakeVLVKLARSMESAKVDTYIDAAAYIAIAGQLHTEENELYV*
Ga0065861_109965913300004448MarineMALVKVARSMETAKVDNFIDGAAYFAISGQLATEENELYV*
Ga0068876_1014611043300005527Freshwater LakeVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV*
Ga0049081_1018260213300005581Freshwater LenticVKIARSMETAKTDTYVDLVAYAAIAGQLHTEENEHYV*
Ga0070749_1022332333300006802AqueousALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0075464_1019855043300006805AqueousVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV*
Ga0075464_1078762513300006805AqueousMCMALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0075464_1078770823300006805AqueousCMALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0075464_1082152413300006805AqueousLVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0075464_1087407023300006805AqueousARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV*
Ga0075464_1109470413300006805AqueousALVKLARSMESSLVDHYLDAAAYIAISGALHTQENELYV*
Ga0070748_124600523300006920AqueousMPINDYQVAMCLALVKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV*
Ga0070748_132072513300006920AqueousTDYQVAMCMALVKIARSMETAKTDTYIDLVAYTSLAAQLHTEENDLYV*
Ga0075458_1001559463300007363AqueousVKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV*
Ga0075458_1015524913300007363AqueousALVKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV*
Ga0105054_1112668823300007520FreshwaterCMALVKVARSMETAKVDTYIDAAAYIAIAGQLHTEENELYV*
Ga0099851_106703553300007538AqueousKIARSMESAKVDNYIDASAYLAIAGQLHTEENELYV*
Ga0099846_129821913300007542AqueousVANCMALVKLARSMESAKVDNYIDGAAYFAIAGQLHTTENELYV*
Ga0114340_125523413300008107Freshwater, PlanktonASLWSAYLEMPVADSQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0114363_107428513300008266Freshwater, PlanktonSCMALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV*
Ga0114363_109102413300008266Freshwater, PlanktonMVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV*
Ga0114363_114470823300008266Freshwater, PlanktonMVLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV*
Ga0114363_116789433300008266Freshwater, PlanktonITDYQVAMCMALVKIARSMESGKPDNYIDGCAYFAIAGQLHTEENDLYV*
Ga0114363_118688813300008266Freshwater, PlanktonLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV*
Ga0114363_119377013300008266Freshwater, PlanktonSCMVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV*
Ga0114364_105764513300008267Freshwater, PlanktonLVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV*
Ga0114364_117899613300008267Freshwater, PlanktonMVLVKLARSMESGKVDTYIDGAAYMAIAGTLHTQEDDLYA*
Ga0114876_105193413300008448Freshwater LakeALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENQLYV*
Ga0114876_123421513300008448Freshwater LakeVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV*
Ga0114880_107485513300008450Freshwater LakeKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV*
Ga0114880_109859043300008450Freshwater LakeVKIARSMETAKTDTYVDLVAYAAIAAQLHTEENEQYV*
Ga0114880_113738713300008450Freshwater LakeVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV*
Ga0114880_123592913300008450Freshwater LakeMCMALVKIARSMESGKPDNYIDGCAYFAIAGQLHTEENDLYV*
Ga0114880_127513723300008450Freshwater LakeVKVARSMETGKVDNYIDGAAYMAIAGQLHTEENELYV*
Ga0102829_113293213300009026EstuarineIARSMETAKADTYIDLAAYVAIAGQLHTEENELYV*
Ga0114973_1010468553300009068Freshwater LakeMALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV*
Ga0105099_1056652323300009082Freshwater SedimentARSMESAKVDTYIDAAAYMAIAGQLHTQENELYV*
Ga0105099_1104325623300009082Freshwater SedimentARSMETGKVDNYIDGAAYFAIAGQLHTEENDIYV*
Ga0114962_1071309413300009151Freshwater LakeKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV*
Ga0114963_1060731513300009154Freshwater LakeALVKVARSMESAKSDNFVDGCAYFALSGMLHTEENDLYV*
Ga0114968_1015713313300009155Freshwater LakeALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV*
Ga0114978_1082287923300009159Freshwater LakeLVKIARSMESPKTDTYVDLVAYTSLAAQLHTEENDLYV*
Ga0114970_1061861523300009163Freshwater LakeMCMALVKIARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV*
Ga0114975_1013067143300009164Freshwater LakeARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV*
Ga0114975_1029938023300009164Freshwater LakeSRTASLWAAYLEMPVEPHQVAMCLALVKIARSMETGKVDNYIDGAAYFAISGQLKLEENQLYV*
Ga0114975_1053016923300009164Freshwater LakeLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV*
Ga0105102_1068029813300009165Freshwater SedimentVAGIMVLVKLARSMETPKVDTYVDLCAYGAIMGTIHTQEDELYV*
Ga0105102_1084970723300009165Freshwater SedimentQVASCLALVKLARSMESPKVDTYIDAAAYMAIAGQLHTEENELYV*
Ga0105097_1017142813300009169Freshwater SedimentMALVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0105097_1087332613300009169Freshwater SedimentQVATCMALVKIARSMETAKVDNQLDACAYIAISGMLQTQENELYV*
Ga0114976_1027602933300009184Freshwater LakeVLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV*
Ga0114976_1048987823300009184Freshwater LakeLVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV*
Ga0114972_1078127023300009187Freshwater LakeVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENELYV*
Ga0127401_103027853300009469Meromictic PondMCMALVKIARSMETAKTDTYVDLVAYASLAAQLHTEENELYV*
Ga0127401_109663513300009469Meromictic PondMCMALVKIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV*
Ga0126447_111986113300009470Meromictic PondKIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV*
Ga0132193_10083543300009864Meromictic PondCMALVKIARSMEGPKVDNYVDACGYLGIAGQLHTEENELYV*
Ga0114960_1044160923300010158Freshwater LakeMALVKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV*
Ga0129324_1021224023300010368Freshwater To Marine Saline GradientVKVARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV*
Ga0133913_1125306413300010885Freshwater LakeGIMVLVKLARSMETGSVDTYVDMAAYVGIMGQLHTEENELYV*
Ga0133913_1135943153300010885Freshwater LakeMALVKIARSMETGKVDNNIDAAAYIAISGQLQTQENELYV*
Ga0119951_114117523300012000FreshwaterARSMETAKSDTYIDLAAYVAIAGQLHTEENELYV*
Ga0157138_101649243300012352FreshwaterQVAMCMALVKIARSMETAKTDTYVDLVAYTSLAAQLHTTENDLYV*
Ga0157138_102269733300012352FreshwaterCLALVKVARSMETGKVDNYIDGAAYFAISGSLRTEENELYV*
Ga0153916_1157261223300012964Freshwater WetlandsLALVKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV*
Ga0164293_1019668713300013004FreshwaterMALVKLARSMETGKVDNYIDGAAYMAIAGQLHTQENDLYV*
Ga0164293_1050354513300013004FreshwaterVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV*
Ga0164293_1061140423300013004FreshwaterSLWSAYLEIPVTDYQVAMCLALVKIARSMETPKPDNYIDGTAYFAIAGQLHTEENDLYV*
Ga0164292_1015061313300013005FreshwaterAMCLALVKIARSMETPKPDNYIDGTAYFAIAGQLHTEENDLYV*
Ga0119960_100451333300014811AquaticFPSHDRISMEGDKVDNIVDLCGYASISGQLRTEENELYV*
Ga0181365_112505723300017736Freshwater LakeCMALVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV
Ga0181346_108778643300017780Freshwater LakeVKVARSMETGKVDNYIDGAAYFAISGQLKLEENELYV
Ga0181346_117445013300017780Freshwater LakeIARSMETAKVDTYVDAVAYLAIAGQLHTEENELYV
Ga0181348_128304323300017784Freshwater LakeVKLARSMESASVDTYVDMAAYAAIAGTLHTQENELYV
Ga0181355_103801413300017785Freshwater LakePVEPHQVAMCLALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENQLYV
Ga0181359_105311013300019784Freshwater LakeVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV
Ga0211731_1061097713300020205FreshwaterAMVKIGRSMESAKVDNYIDGAAYFAISGQLRTEENELYV
Ga0208360_100972543300020551FreshwaterCMALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV
Ga0213922_104222533300021956FreshwaterMALVKIARSMETAKTDTYIDLAAYVAIAGQLHTEENDLYV
Ga0222713_1082077623300021962Estuarine WaterWSAYLEMPITDYQVAMCLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0181354_107600143300022190Freshwater LakeKMVLVKLARSMESAKVDTYIDAAAYIAIAGQLHTEENELYV
Ga0214921_1023328733300023174FreshwaterLVKIARSMETPKSDTYIDLAAYVAIAGQLHTEENELYV
Ga0244777_1083688713300024343EstuarineTDYQVAMCLALVKIARSMETPKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0256330_103868833300024481FreshwaterVARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV
Ga0255152_103732233300024503FreshwaterLVKVARSMESGKVDNYIDGAAYVAISGQLRNEENELYV
Ga0255175_107309423300024509FreshwaterMCMALVKAARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV
Ga0208147_105120313300025635AqueousITDYQVAMCLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0208147_106910433300025635AqueousALVKVARSMETPKVDNFIDGAAYFAISGQLATEENDLYV
Ga0255146_101639513300027396FreshwaterVAMCMALVKAARSMETPSNDTYLDLAAYVAIAGQLHTEENELYV
Ga0209499_103138063300027712Freshwater LakeCMALVKIARSMETAKTDTYIDLVAYTSLAAQLHTEENELYV
Ga0209084_133305413300027749Freshwater LakeKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV
Ga0209296_128340823300027759Freshwater LakeVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV
Ga0209296_128588723300027759Freshwater LakeAMCMALVKIARSMETAKSDTYIDLVAYCSIAGQLHTEENDLYV
Ga0209134_1023989313300027764Freshwater LakeASCMVLVKLARSMESGKVDTYIDAAAYMAIAGQLHTEENELYV
Ga0209107_1047400513300027797Freshwater And SedimentMCMALVKVARSMETAKTDTYVDLTAYVAIAAQLHTEENELYV
Ga0209400_111522113300027963Freshwater LakeALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV
Ga0209191_118431423300027969Freshwater LakeRTASLWAAYLEMPVEPHQVAMCLALVKIARSMETGKVDNYIDGAAYFAISGQLKLEENQLYV
Ga0209191_122518213300027969Freshwater LakeLALVKIARSMETAKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0209401_106133213300027971Freshwater LakeCMALVKIARSMETAKSDTYIDLTAYVAIAGQLHTEENDLYV
Ga0247723_101629083300028025Deep Subsurface SedimentCMALVKIARSMETAKTDTYIDLAAYVAIAGQLHTEENELYV
Ga0304729_117456523300028392Freshwater LakeMALVKIARSMETAKSDTYVDLVAYAAISGQLHTEENDLYV
Ga0315909_1018914513300031857FreshwaterCMVLVKLARSMESGKVDTYIDGAAYMAIAGQLHTEENELYV
Ga0315904_1093065023300031951FreshwaterQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0315901_1112921323300031963FreshwaterVLVKLARSMESPKVDTYVDLCAYGAIMGTIHTQEDELYV
Ga0315903_1122154423300032116FreshwaterSLWSAYLEMPVTDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0334979_0539252_3_1283300033996FreshwaterCMALVKVARSMESGKPDNFIDGCAYFAISGQLHTEENDLYV
Ga0334987_0480857_12_1343300034061FreshwaterMALVKLARSMESAKVDTYIDAAAYLAIAGQLHTEENELYV
Ga0334987_0523031_2_1633300034061FreshwaterLEMPITDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0335030_0376509_814_9273300034103FreshwaterVKIARSMETAKPDTYIDLAAYVAIAGQLHTEENELYV
Ga0335035_0287485_2_1153300034105FreshwaterVKIARSMESAKIDNAVDGCSYLAIAGMLQTQENELYV
Ga0335036_0119219_1782_19133300034106FreshwaterAMCMALVKIARSMESAKPDHFIDLCGYAAISGQLHTEENDLYV
Ga0335053_0144616_1417_15723300034118FreshwaterMPVTDYQVAMCLALVKIARSMETGKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0335053_0336669_773_9343300034118FreshwaterLEMPVTDYQVAMCLALVKIARSMESPKPDNYIDGAAYFAIAGQLHTEENDLYV
Ga0335054_0332223_722_8443300034119FreshwaterMVLVKLARSMEGSKVDNYIDMLGYAAISGMLRTEENELYV
Ga0335007_0228990_1128_12503300034283FreshwaterMALVKVARSMETGKVDNYIDGAAYMAISGQLKLEENELYV
Ga0335007_0638895_482_6073300034283FreshwaterCMALVKIARSMETAKTDTYVDLVAYAAIAAQLHTEENEQYV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.