| Basic Information | |
|---|---|
| Family ID | F078407 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.24 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (90.517 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (32.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.069 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.27% β-sheet: 0.00% Coil/Unstructured: 47.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 2.59 |
| PF06305 | LapA_dom | 1.72 |
| PF05065 | Phage_capsid | 1.72 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.41 % |
| Unclassified | root | N/A | 2.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109030088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300002408|B570J29032_109084570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300003277|JGI25908J49247_10013625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2498 | Open in IMG/M |
| 3300003411|JGI25911J50253_10216483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006030|Ga0075470_10136263 | Not Available | 722 | Open in IMG/M |
| 3300006802|Ga0070749_10368644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300006875|Ga0075473_10045640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1692 | Open in IMG/M |
| 3300006875|Ga0075473_10477295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300007541|Ga0099848_1213951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300008055|Ga0108970_10679404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300008448|Ga0114876_1062518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
| 3300008448|Ga0114876_1258293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300009026|Ga0102829_1298662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300009068|Ga0114973_10456085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300009068|Ga0114973_10640833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300009085|Ga0105103_10093105 | All Organisms → Viruses → Predicted Viral | 1559 | Open in IMG/M |
| 3300009158|Ga0114977_10620549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009158|Ga0114977_10714930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009159|Ga0114978_10038102 | All Organisms → Viruses → Predicted Viral | 3392 | Open in IMG/M |
| 3300009159|Ga0114978_10502190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300009165|Ga0105102_10767118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300009180|Ga0114979_10025775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3738 | Open in IMG/M |
| 3300009180|Ga0114979_10253541 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300009184|Ga0114976_10653480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300009435|Ga0115546_1192108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300012006|Ga0119955_1035138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10885606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300013372|Ga0177922_11285842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
| 3300014811|Ga0119960_1050515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300017699|Ga0181345_103988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300017707|Ga0181363_1037610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300017722|Ga0181347_1152050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300017722|Ga0181347_1206028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300017736|Ga0181365_1015936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1886 | Open in IMG/M |
| 3300017747|Ga0181352_1113181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300017747|Ga0181352_1124670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300017754|Ga0181344_1133498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300017774|Ga0181358_1212456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300017774|Ga0181358_1231926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300017774|Ga0181358_1257461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300017777|Ga0181357_1042610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1783 | Open in IMG/M |
| 3300017777|Ga0181357_1321735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017778|Ga0181349_1074482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300017778|Ga0181349_1275637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300017780|Ga0181346_1047043 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300017780|Ga0181346_1182993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300017780|Ga0181346_1243163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300017784|Ga0181348_1262750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300017785|Ga0181355_1304097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300019784|Ga0181359_1148574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300019784|Ga0181359_1262356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300019784|Ga0181359_1263853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300020151|Ga0211736_10950578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300020205|Ga0211731_10468374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300020546|Ga0208853_1055529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300021959|Ga0222716_10041386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3309 | Open in IMG/M |
| 3300021963|Ga0222712_10761262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300022173|Ga0181337_1042555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300022179|Ga0181353_1144784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300022190|Ga0181354_1160580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300022190|Ga0181354_1215953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300022407|Ga0181351_1140211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300022407|Ga0181351_1198857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300022407|Ga0181351_1207071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300024346|Ga0244775_11241636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300025889|Ga0208644_1325059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300027132|Ga0255110_1063624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300027143|Ga0255105_1044505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300027146|Ga0255104_1080668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300027149|Ga0255108_1038516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300027508|Ga0255072_1111137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300027586|Ga0208966_1149380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300027594|Ga0255120_1083490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027697|Ga0209033_1001458 | Not Available | 13687 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1008158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10741 | Open in IMG/M |
| 3300027756|Ga0209444_10048897 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
| 3300027756|Ga0209444_10225307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300027764|Ga0209134_10143528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300027782|Ga0209500_10342211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300027785|Ga0209246_10394397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300027798|Ga0209353_10423573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300027836|Ga0209230_10799067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027900|Ga0209253_10851704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027973|Ga0209298_10131097 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1037859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2267 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1005592 | Not Available | 14454 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10456942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300031707|Ga0315291_10289461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
| 3300031746|Ga0315293_11137217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300031951|Ga0315904_10389755 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300031951|Ga0315904_11256232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300031952|Ga0315294_10403974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300031999|Ga0315274_10596609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
| 3300031999|Ga0315274_11994675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300032046|Ga0315289_10354947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1484 | Open in IMG/M |
| 3300032092|Ga0315905_10616437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300032092|Ga0315905_11137999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300032156|Ga0315295_10589726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
| 3300032156|Ga0315295_10760569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300032173|Ga0315268_10714930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300032342|Ga0315286_11434306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300033994|Ga0334996_0546767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300034012|Ga0334986_0542347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300034020|Ga0335002_0552326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300034061|Ga0334987_0262494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
| 3300034062|Ga0334995_0256312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300034092|Ga0335010_0170826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
| 3300034101|Ga0335027_0257300 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300034102|Ga0335029_0607645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300034104|Ga0335031_0011210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6607 | Open in IMG/M |
| 3300034111|Ga0335063_0187405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300034111|Ga0335063_0372288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300034112|Ga0335066_0313623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300034112|Ga0335066_0363025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300034118|Ga0335053_0595947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300034122|Ga0335060_0155747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.48% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.17% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.86% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.86% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.86% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.86% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020546 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027149 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1090300881 | 3300002408 | Freshwater | MPTIGYKPNSRLSSDEIEVRVWAFVIVVLVTILLA |
| B570J29032_1090845701 | 3300002408 | Freshwater | MPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAF |
| JGI25908J49247_100136256 | 3300003277 | Freshwater Lake | MAVIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGSMAAI |
| JGI25911J50253_102164831 | 3300003411 | Freshwater Lake | MSTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGSMAAID |
| Ga0075470_101362631 | 3300006030 | Aqueous | MMPTVGYKPSNRMTAEEIEVRIWAMVILALLVVLVGSMGMFLYSVTYVTQPMNGHMAAID |
| Ga0070749_103686443 | 3300006802 | Aqueous | MPTVGYKPNNRMTAEEIEVRIWAAVILALLIVLVGSMGMFLYSVTYVTQPMSG |
| Ga0075473_100456401 | 3300006875 | Aqueous | MPTIGYKPNNRMTAEEIEVRIWAIVIFSLTMILLGSVAMFLYSVS |
| Ga0075473_104772952 | 3300006875 | Aqueous | MPTIIRNTSNRLTAEEIEVRVWAFVIVVLVSILLGAMAM |
| Ga0099848_12139511 | 3300007541 | Aqueous | MATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGM |
| Ga0108970_106794041 | 3300008055 | Estuary | MPTVGYKPNNRLTADEIEVRVCAFVIVVLVTILLASMGMFLYSVSFVQQPMNGAM |
| Ga0114876_10625185 | 3300008448 | Freshwater Lake | MPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAM |
| Ga0114876_12582932 | 3300008448 | Freshwater Lake | MPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFL |
| Ga0102829_12986621 | 3300009026 | Estuarine | MPTIGYKPNNRLTPEEIEARVWAFVIVVIALILIGSC |
| Ga0114973_104560853 | 3300009068 | Freshwater Lake | MMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQ |
| Ga0114973_106408331 | 3300009068 | Freshwater Lake | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSM |
| Ga0105103_100931051 | 3300009085 | Freshwater Sediment | MATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGAMAAIDK |
| Ga0114977_106205491 | 3300009158 | Freshwater Lake | MPTIGYKPNNRLNADEIEVRVWAFVIVVLVSILLGAMAMFLYS |
| Ga0114977_107149301 | 3300009158 | Freshwater Lake | MMPTVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFLYAL |
| Ga0114978_100381021 | 3300009159 | Freshwater Lake | MATIGYKTNNRLTSDEIEVSVWAFVIVVLVTILLGAMAMFLYSVSFVTQP |
| Ga0114978_105021903 | 3300009159 | Freshwater Lake | MPTIGYKPNSRLTSDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNG |
| Ga0105102_107671181 | 3300009165 | Freshwater Sediment | MPTIGYKPNSRLNSDEIEVRVWAFVIVVLVTILLASMGMF |
| Ga0114979_100257758 | 3300009180 | Freshwater Lake | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGQMAA |
| Ga0114979_102535411 | 3300009180 | Freshwater Lake | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDK |
| Ga0114976_106534801 | 3300009184 | Freshwater Lake | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV |
| Ga0115546_11921084 | 3300009435 | Pelagic Marine | MPTVAYKTNNRLTAEEIEVRVWAFVIVTLVSILLGAMAMFL |
| Ga0119955_10351385 | 3300012006 | Freshwater | MPTIVRNTSSRLTAEEIEVRVWAFVIVVLVTILLGAMAMFLYSVTYVTQPMSG |
| (restricted) Ga0172375_108856061 | 3300013137 | Freshwater | MATIGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMAMFLYSVSFVTQPMNG |
| Ga0177922_112858423 | 3300013372 | Freshwater | MATIGYKPINRLSADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0119960_10505153 | 3300014811 | Aquatic | MMATVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFL |
| Ga0181345_1039882 | 3300017699 | Freshwater Lake | MSTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV |
| Ga0181363_10376103 | 3300017707 | Freshwater Lake | MPTVGYKPNNRLNSDEIEVRVWAFVIVVLVTILLASMGMF |
| Ga0181347_11520501 | 3300017722 | Freshwater Lake | MPTIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0181347_12060283 | 3300017722 | Freshwater Lake | MPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLAS |
| Ga0181365_10159361 | 3300017736 | Freshwater Lake | MAVIGYKPNSRLSADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGAMAAIDRVY |
| Ga0181352_11131814 | 3300017747 | Freshwater Lake | MPTIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASM |
| Ga0181352_11246701 | 3300017747 | Freshwater Lake | MPTVGYKPNNRLNSDEIEVRVWAFVIVVLVTILLASMG |
| Ga0181344_11334983 | 3300017754 | Freshwater Lake | MPTVGYKPTTRLTAEEIEVRVWAFVIIILVTILFGAMVAFLYSVTYVTQ |
| Ga0181358_12124561 | 3300017774 | Freshwater Lake | MPTVGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDK |
| Ga0181358_12319263 | 3300017774 | Freshwater Lake | MMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASM |
| Ga0181358_12574611 | 3300017774 | Freshwater Lake | MPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLA |
| Ga0181357_10426101 | 3300017777 | Freshwater Lake | MATIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQP |
| Ga0181357_13217353 | 3300017777 | Freshwater Lake | MATIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLY |
| Ga0181349_10744825 | 3300017778 | Freshwater Lake | MMPTIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAAI |
| Ga0181349_12756371 | 3300017778 | Freshwater Lake | MATVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLYSVTYVTQPM |
| Ga0181346_10470435 | 3300017780 | Freshwater Lake | MPTVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLY |
| Ga0181346_11829934 | 3300017780 | Freshwater Lake | MATIGYKPNNRLTVDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGAMAAID |
| Ga0181346_12431633 | 3300017780 | Freshwater Lake | MMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDKV |
| Ga0181348_12627501 | 3300017784 | Freshwater Lake | MMPTIGYIPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFL |
| Ga0181355_13040971 | 3300017785 | Freshwater Lake | MMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAID |
| Ga0181359_11485743 | 3300019784 | Freshwater Lake | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPM |
| Ga0181359_12623561 | 3300019784 | Freshwater Lake | MPTIGYKQNSRLTADEIEVRVWAFVIVVLVTILLA |
| Ga0181359_12638532 | 3300019784 | Freshwater Lake | MPTIGYKPNNRLTAEEIEVRIWAIVIFSLTMILLGSVAMFLYSVSFV |
| Ga0211736_109505781 | 3300020151 | Freshwater | MATVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFLYSVTY |
| Ga0211731_104683741 | 3300020205 | Freshwater | MPTVGYKQNNRMTAEEIEVRIWAVVIFSLTMILLGSVAMFLYSVSFVT |
| Ga0208853_10555291 | 3300020546 | Freshwater | MPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFLYSVT |
| Ga0222716_100413861 | 3300021959 | Estuarine Water | MPTVGYKPSTRMTAEEIEVRIWAMVILALLIVLVGSMGMFLYSVTYVTQPMSG |
| Ga0222712_107612622 | 3300021963 | Estuarine Water | MMATVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFLYAL |
| Ga0181337_10425551 | 3300022173 | Freshwater Lake | MATIGYKPNNRLTVDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMN |
| Ga0181353_11447842 | 3300022179 | Freshwater Lake | MSTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASM |
| Ga0181354_11605803 | 3300022190 | Freshwater Lake | MATIGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMGMFLYF |
| Ga0181354_12159531 | 3300022190 | Freshwater Lake | MMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMN |
| Ga0181351_11402114 | 3300022407 | Freshwater Lake | MPTVGYKQNNRMTAEEIEVRIWAVVIFSLTMILLGSVAMFLYSVSFA |
| Ga0181351_11988571 | 3300022407 | Freshwater Lake | MMATIGYKPNNRLTAEEIEVRVWAFVIVCLILILLGSVAMFLYALTYVTQ |
| Ga0181351_12070711 | 3300022407 | Freshwater Lake | MMPTIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQP |
| Ga0244775_112416363 | 3300024346 | Estuarine | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV |
| Ga0208644_13250592 | 3300025889 | Aqueous | MATVGYKPNNRLTADEIEVRVWAFVIVVLVTILLSSMGMFLYSVSFVTQPMNGMA |
| Ga0255110_10636241 | 3300027132 | Freshwater | MPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVAFLYSVS |
| Ga0255105_10445053 | 3300027143 | Freshwater | MPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVA |
| Ga0255104_10806681 | 3300027146 | Freshwater | MPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVAFLYSVTYVTQPM |
| Ga0255108_10385161 | 3300027149 | Freshwater | MPTIGYKPNNRLNADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAA |
| Ga0255072_11111371 | 3300027508 | Freshwater | MPTIGYKPNNRLSSDEIEVRVWAFVIVVLVTILLASMGMF |
| Ga0208966_11493801 | 3300027586 | Freshwater Lentic | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV |
| Ga0255120_10834901 | 3300027594 | Freshwater | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSF |
| Ga0209033_10014581 | 3300027697 | Freshwater Lake | MPTIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLY |
| (restricted) Ga0247833_100815817 | 3300027730 | Freshwater | MMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAM |
| Ga0209444_100488975 | 3300027756 | Freshwater Lake | MATIGYKLNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0209444_102253071 | 3300027756 | Freshwater Lake | MPTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASM |
| Ga0209134_101435281 | 3300027764 | Freshwater Lake | MPTIGYKPNTRLSSDEIEVRVWAFVIVVLVTILLASMGMFLYSV |
| Ga0209500_103422112 | 3300027782 | Freshwater Lake | MATIGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGSMA |
| Ga0209246_103943971 | 3300027785 | Freshwater Lake | MPTVGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMN |
| Ga0209353_104235732 | 3300027798 | Freshwater Lake | MPTIGYKQNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYS |
| Ga0209230_107990672 | 3300027836 | Freshwater And Sediment | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVS |
| Ga0209253_108517041 | 3300027900 | Freshwater Lake Sediment | MANRMTAEEIEARVWAFVIVSLVVILLGSMAMFLYSVSFVTQPMSGL |
| Ga0209298_101310973 | 3300027973 | Freshwater Lake | MMATIGYKPSNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMA |
| (restricted) Ga0247835_10378591 | 3300028114 | Freshwater | MMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFL |
| (restricted) Ga0247832_100559226 | 3300028557 | Freshwater | MMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGA |
| (restricted) Ga0247840_104569422 | 3300028581 | Freshwater | MMPTVAYKPNNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLYSVTYVTQPMS |
| Ga0315291_102894611 | 3300031707 | Sediment | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYS |
| Ga0315293_111372171 | 3300031746 | Sediment | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAAID |
| Ga0315904_103897554 | 3300031951 | Freshwater | MATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV |
| Ga0315904_112562321 | 3300031951 | Freshwater | MPTIGYKPNNRMTAEEIEVRIWAIVIFALTLILLG |
| Ga0315294_104039741 | 3300031952 | Sediment | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMG |
| Ga0315274_105966091 | 3300031999 | Sediment | MPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFL |
| Ga0315274_119946751 | 3300031999 | Sediment | MMPTIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0315289_103549476 | 3300032046 | Sediment | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASM |
| Ga0315905_106164371 | 3300032092 | Freshwater | MPTIGYKPNNRLNADEIEVRVWAFVIVVLVTILLA |
| Ga0315905_111379992 | 3300032092 | Freshwater | MPTIGYKKNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVMQPMNG |
| Ga0315295_105897264 | 3300032156 | Sediment | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVTILLA |
| Ga0315295_107605691 | 3300032156 | Sediment | MMPTIGYKPSNRLSADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0315268_107149301 | 3300032173 | Sediment | MPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSM |
| Ga0315286_114343061 | 3300032342 | Sediment | MPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLY |
| Ga0334996_0546767_368_508 | 3300033994 | Freshwater | MPTVAYKTTNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFV |
| Ga0334986_0542347_434_562 | 3300034012 | Freshwater | MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYS |
| Ga0335002_0552326_457_603 | 3300034020 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQ |
| Ga0334987_0262494_3_164 | 3300034061 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQPMSGM |
| Ga0334995_0256312_1059_1172 | 3300034062 | Freshwater | MPTVGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMG |
| Ga0335010_0170826_1_111 | 3300034092 | Freshwater | MPTVAYKTNNRLTAEEIEVRVWAFVIVVLVSILLGAM |
| Ga0335027_0257300_1097_1201 | 3300034101 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVTILLA |
| Ga0335029_0607645_2_136 | 3300034102 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVS |
| Ga0335031_0011210_6492_6605 | 3300034104 | Freshwater | MATIGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMG |
| Ga0335063_0187405_1_105 | 3300034111 | Freshwater | MPTVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLG |
| Ga0335063_0372288_582_731 | 3300034111 | Freshwater | MATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQP |
| Ga0335066_0313623_3_134 | 3300034112 | Freshwater | MATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSV |
| Ga0335066_0363025_1_159 | 3300034112 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQPMSG |
| Ga0335053_0595947_506_637 | 3300034118 | Freshwater | MATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSV |
| Ga0335060_0155747_1185_1328 | 3300034122 | Freshwater | MPTVAYKTTNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVT |
| ⦗Top⦘ |