NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F078407

Metagenome Family F078407

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078407
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 46 residues
Representative Sequence MATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV
Number of Associated Samples 89
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.24 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (90.517 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(32.759 % of family members)
Environment Ontology (ENVO) Unclassified
(65.517 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(62.069 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.27%    β-sheet: 0.00%    Coil/Unstructured: 47.73%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13392HNH_3 2.59
PF06305LapA_dom 1.72
PF05065Phage_capsid 1.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 1.72
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.41 %
UnclassifiedrootN/A2.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109030088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300002408|B570J29032_109084570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300003277|JGI25908J49247_10013625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2498Open in IMG/M
3300003411|JGI25911J50253_10216483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300006030|Ga0075470_10136263Not Available722Open in IMG/M
3300006802|Ga0070749_10368644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300006875|Ga0075473_10045640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1692Open in IMG/M
3300006875|Ga0075473_10477295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300007541|Ga0099848_1213951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300008055|Ga0108970_10679404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300008448|Ga0114876_1062518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1621Open in IMG/M
3300008448|Ga0114876_1258293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300009026|Ga0102829_1298662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300009068|Ga0114973_10456085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300009068|Ga0114973_10640833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300009085|Ga0105103_10093105All Organisms → Viruses → Predicted Viral1559Open in IMG/M
3300009158|Ga0114977_10620549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300009158|Ga0114977_10714930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300009159|Ga0114978_10038102All Organisms → Viruses → Predicted Viral3392Open in IMG/M
3300009159|Ga0114978_10502190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300009165|Ga0105102_10767118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300009180|Ga0114979_10025775All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3738Open in IMG/M
3300009180|Ga0114979_10253541All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300009184|Ga0114976_10653480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300009435|Ga0115546_1192108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300012006|Ga0119955_1035138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1641Open in IMG/M
(restricted) 3300013137|Ga0172375_10885606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300013372|Ga0177922_11285842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1151Open in IMG/M
3300014811|Ga0119960_1050515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300017699|Ga0181345_103988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300017707|Ga0181363_1037610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300017722|Ga0181347_1152050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300017722|Ga0181347_1206028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300017736|Ga0181365_1015936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1886Open in IMG/M
3300017747|Ga0181352_1113181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300017747|Ga0181352_1124670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300017754|Ga0181344_1133498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300017774|Ga0181358_1212456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300017774|Ga0181358_1231926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300017774|Ga0181358_1257461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300017777|Ga0181357_1042610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1783Open in IMG/M
3300017777|Ga0181357_1321735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300017778|Ga0181349_1074482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1299Open in IMG/M
3300017778|Ga0181349_1275637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300017780|Ga0181346_1047043All Organisms → Viruses → Predicted Viral1754Open in IMG/M
3300017780|Ga0181346_1182993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300017780|Ga0181346_1243163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300017784|Ga0181348_1262750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300017785|Ga0181355_1304097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300019784|Ga0181359_1148574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300019784|Ga0181359_1262356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300019784|Ga0181359_1263853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300020151|Ga0211736_10950578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1225Open in IMG/M
3300020205|Ga0211731_10468374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300020546|Ga0208853_1055529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300021959|Ga0222716_10041386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3309Open in IMG/M
3300021963|Ga0222712_10761262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300022173|Ga0181337_1042555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300022179|Ga0181353_1144784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300022190|Ga0181354_1160580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300022190|Ga0181354_1215953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300022407|Ga0181351_1140211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300022407|Ga0181351_1198857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300022407|Ga0181351_1207071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300024346|Ga0244775_11241636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300025889|Ga0208644_1325059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300027132|Ga0255110_1063624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300027143|Ga0255105_1044505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300027146|Ga0255104_1080668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300027149|Ga0255108_1038516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage924Open in IMG/M
3300027508|Ga0255072_1111137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300027586|Ga0208966_1149380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300027594|Ga0255120_1083490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300027697|Ga0209033_1001458Not Available13687Open in IMG/M
(restricted) 3300027730|Ga0247833_1008158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10741Open in IMG/M
3300027756|Ga0209444_10048897All Organisms → Viruses → Predicted Viral1919Open in IMG/M
3300027756|Ga0209444_10225307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300027764|Ga0209134_10143528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300027782|Ga0209500_10342211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300027785|Ga0209246_10394397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300027798|Ga0209353_10423573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300027836|Ga0209230_10799067All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300027900|Ga0209253_10851704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300027973|Ga0209298_10131097All Organisms → Viruses → Predicted Viral1069Open in IMG/M
(restricted) 3300028114|Ga0247835_1037859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2267Open in IMG/M
(restricted) 3300028557|Ga0247832_1005592Not Available14454Open in IMG/M
(restricted) 3300028581|Ga0247840_10456942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300031707|Ga0315291_10289461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1612Open in IMG/M
3300031746|Ga0315293_11137217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300031951|Ga0315904_10389755All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300031951|Ga0315904_11256232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300031952|Ga0315294_10403974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1277Open in IMG/M
3300031999|Ga0315274_10596609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1221Open in IMG/M
3300031999|Ga0315274_11994675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300032046|Ga0315289_10354947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1484Open in IMG/M
3300032092|Ga0315905_10616437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage978Open in IMG/M
3300032092|Ga0315905_11137999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300032156|Ga0315295_10589726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1126Open in IMG/M
3300032156|Ga0315295_10760569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300032173|Ga0315268_10714930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300032342|Ga0315286_11434306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300033994|Ga0334996_0546767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300034012|Ga0334986_0542347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300034020|Ga0335002_0552326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300034061|Ga0334987_0262494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1169Open in IMG/M
3300034062|Ga0334995_0256312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
3300034092|Ga0335010_0170826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1358Open in IMG/M
3300034101|Ga0335027_0257300All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300034102|Ga0335029_0607645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300034104|Ga0335031_0011210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6607Open in IMG/M
3300034111|Ga0335063_0187405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1173Open in IMG/M
3300034111|Ga0335063_0372288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300034112|Ga0335066_0313623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300034112|Ga0335066_0363025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300034118|Ga0335053_0595947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300034122|Ga0335060_0155747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1328Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake32.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.24%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake9.48%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.62%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.17%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.72%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.86%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.86%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.86%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.86%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.86%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.86%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.86%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017699Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022173Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027132Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027143Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027146Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027149Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027594Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10903008813300002408FreshwaterMPTIGYKPNSRLSSDEIEVRVWAFVIVVLVTILLA
B570J29032_10908457013300002408FreshwaterMPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAF
JGI25908J49247_1001362563300003277Freshwater LakeMAVIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGSMAAI
JGI25911J50253_1021648313300003411Freshwater LakeMSTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGSMAAID
Ga0075470_1013626313300006030AqueousMMPTVGYKPSNRMTAEEIEVRIWAMVILALLVVLVGSMGMFLYSVTYVTQPMNGHMAAID
Ga0070749_1036864433300006802AqueousMPTVGYKPNNRMTAEEIEVRIWAAVILALLIVLVGSMGMFLYSVTYVTQPMSG
Ga0075473_1004564013300006875AqueousMPTIGYKPNNRMTAEEIEVRIWAIVIFSLTMILLGSVAMFLYSVS
Ga0075473_1047729523300006875AqueousMPTIIRNTSNRLTAEEIEVRVWAFVIVVLVSILLGAMAM
Ga0099848_121395113300007541AqueousMATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGM
Ga0108970_1067940413300008055EstuaryMPTVGYKPNNRLTADEIEVRVCAFVIVVLVTILLASMGMFLYSVSFVQQPMNGAM
Ga0114876_106251853300008448Freshwater LakeMPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAM
Ga0114876_125829323300008448Freshwater LakeMPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFL
Ga0102829_129866213300009026EstuarineMPTIGYKPNNRLTPEEIEARVWAFVIVVIALILIGSC
Ga0114973_1045608533300009068Freshwater LakeMMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQ
Ga0114973_1064083313300009068Freshwater LakeMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSM
Ga0105103_1009310513300009085Freshwater SedimentMATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGAMAAIDK
Ga0114977_1062054913300009158Freshwater LakeMPTIGYKPNNRLNADEIEVRVWAFVIVVLVSILLGAMAMFLYS
Ga0114977_1071493013300009158Freshwater LakeMMPTVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFLYAL
Ga0114978_1003810213300009159Freshwater LakeMATIGYKTNNRLTSDEIEVSVWAFVIVVLVTILLGAMAMFLYSVSFVTQP
Ga0114978_1050219033300009159Freshwater LakeMPTIGYKPNSRLTSDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNG
Ga0105102_1076711813300009165Freshwater SedimentMPTIGYKPNSRLNSDEIEVRVWAFVIVVLVTILLASMGMF
Ga0114979_1002577583300009180Freshwater LakeMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGQMAA
Ga0114979_1025354113300009180Freshwater LakeMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDK
Ga0114976_1065348013300009184Freshwater LakeMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV
Ga0115546_119210843300009435Pelagic MarineMPTVAYKTNNRLTAEEIEVRVWAFVIVTLVSILLGAMAMFL
Ga0119955_103513853300012006FreshwaterMPTIVRNTSSRLTAEEIEVRVWAFVIVVLVTILLGAMAMFLYSVTYVTQPMSG
(restricted) Ga0172375_1088560613300013137FreshwaterMATIGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMAMFLYSVSFVTQPMNG
Ga0177922_1128584233300013372FreshwaterMATIGYKPINRLSADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0119960_105051533300014811AquaticMMATVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFL
Ga0181345_10398823300017699Freshwater LakeMSTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV
Ga0181363_103761033300017707Freshwater LakeMPTVGYKPNNRLNSDEIEVRVWAFVIVVLVTILLASMGMF
Ga0181347_115205013300017722Freshwater LakeMPTIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0181347_120602833300017722Freshwater LakeMPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLAS
Ga0181365_101593613300017736Freshwater LakeMAVIGYKPNSRLSADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGAMAAIDRVY
Ga0181352_111318143300017747Freshwater LakeMPTIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASM
Ga0181352_112467013300017747Freshwater LakeMPTVGYKPNNRLNSDEIEVRVWAFVIVVLVTILLASMG
Ga0181344_113349833300017754Freshwater LakeMPTVGYKPTTRLTAEEIEVRVWAFVIIILVTILFGAMVAFLYSVTYVTQ
Ga0181358_121245613300017774Freshwater LakeMPTVGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDK
Ga0181358_123192633300017774Freshwater LakeMMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASM
Ga0181358_125746113300017774Freshwater LakeMPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLA
Ga0181357_104261013300017777Freshwater LakeMATIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQP
Ga0181357_132173533300017777Freshwater LakeMATIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLY
Ga0181349_107448253300017778Freshwater LakeMMPTIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAAI
Ga0181349_127563713300017778Freshwater LakeMATVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLYSVTYVTQPM
Ga0181346_104704353300017780Freshwater LakeMPTVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLY
Ga0181346_118299343300017780Freshwater LakeMATIGYKPNNRLTVDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMNGAMAAID
Ga0181346_124316333300017780Freshwater LakeMMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAIDKV
Ga0181348_126275013300017784Freshwater LakeMMPTIGYIPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFL
Ga0181355_130409713300017785Freshwater LakeMMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMAAID
Ga0181359_114857433300019784Freshwater LakeMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPM
Ga0181359_126235613300019784Freshwater LakeMPTIGYKQNSRLTADEIEVRVWAFVIVVLVTILLA
Ga0181359_126385323300019784Freshwater LakeMPTIGYKPNNRLTAEEIEVRIWAIVIFSLTMILLGSVAMFLYSVSFV
Ga0211736_1095057813300020151FreshwaterMATVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFLYSVTY
Ga0211731_1046837413300020205FreshwaterMPTVGYKQNNRMTAEEIEVRIWAVVIFSLTMILLGSVAMFLYSVSFVT
Ga0208853_105552913300020546FreshwaterMPTVAYKTNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFLYSVT
Ga0222716_1004138613300021959Estuarine WaterMPTVGYKPSTRMTAEEIEVRIWAMVILALLIVLVGSMGMFLYSVTYVTQPMSG
Ga0222712_1076126223300021963Estuarine WaterMMATVGYKPNNRMTAEEIEARVWAFVIVCLILILLGSVAMFLYAL
Ga0181337_104255513300022173Freshwater LakeMATIGYKPNNRLTVDEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQPMN
Ga0181353_114478423300022179Freshwater LakeMSTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASM
Ga0181354_116058033300022190Freshwater LakeMATIGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMGMFLYF
Ga0181354_121595313300022190Freshwater LakeMMPTIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMN
Ga0181351_114021143300022407Freshwater LakeMPTVGYKQNNRMTAEEIEVRIWAVVIFSLTMILLGSVAMFLYSVSFA
Ga0181351_119885713300022407Freshwater LakeMMATIGYKPNNRLTAEEIEVRVWAFVIVCLILILLGSVAMFLYALTYVTQ
Ga0181351_120707113300022407Freshwater LakeMMPTIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQP
Ga0244775_1124163633300024346EstuarineMPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV
Ga0208644_132505923300025889AqueousMATVGYKPNNRLTADEIEVRVWAFVIVVLVTILLSSMGMFLYSVSFVTQPMNGMA
Ga0255110_106362413300027132FreshwaterMPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVAFLYSVS
Ga0255105_104450533300027143FreshwaterMPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVA
Ga0255104_108066813300027146FreshwaterMPTVGYKPNNRLTAEEIEVRVWAFVIVILVTILLGAMVAFLYSVTYVTQPM
Ga0255108_103851613300027149FreshwaterMPTIGYKPNNRLNADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAA
Ga0255072_111113713300027508FreshwaterMPTIGYKPNNRLSSDEIEVRVWAFVIVVLVTILLASMGMF
Ga0208966_114938013300027586Freshwater LenticMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSV
Ga0255120_108349013300027594FreshwaterMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSF
Ga0209033_100145813300027697Freshwater LakeMPTIGYKPNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLY
(restricted) Ga0247833_1008158173300027730FreshwaterMMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAM
Ga0209444_1004889753300027756Freshwater LakeMATIGYKLNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0209444_1022530713300027756Freshwater LakeMPTIGYKPNSRLTADEIEVRVWAFVIVVLVTILLASM
Ga0209134_1014352813300027764Freshwater LakeMPTIGYKPNTRLSSDEIEVRVWAFVIVVLVTILLASMGMFLYSV
Ga0209500_1034221123300027782Freshwater LakeMATIGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVQQPMNGSMA
Ga0209246_1039439713300027785Freshwater LakeMPTVGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMN
Ga0209353_1042357323300027798Freshwater LakeMPTIGYKQNSRLTADEIEVRVWAFVIVVLVTILLASMGMFLYS
Ga0209230_1079906723300027836Freshwater And SedimentMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVS
Ga0209253_1085170413300027900Freshwater Lake SedimentMANRMTAEEIEARVWAFVIVSLVVILLGSMAMFLYSVSFVTQPMSGL
Ga0209298_1013109733300027973Freshwater LakeMMATIGYKPSNRLSADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSMA
(restricted) Ga0247835_103785913300028114FreshwaterMMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGAMVAFL
(restricted) Ga0247832_1005592263300028557FreshwaterMMPTVGYKPNNRLTAEEIEVRVWAFVIIILVTILLGA
(restricted) Ga0247840_1045694223300028581FreshwaterMMPTVAYKPNNRLTAEEIEVRVWAFVIVVLVSILLGAMAMFLYSVTYVTQPMS
Ga0315291_1028946113300031707SedimentMPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYS
Ga0315293_1113721713300031746SedimentMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVTQPMNGSMAAID
Ga0315904_1038975543300031951FreshwaterMATIGYKPNSRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFV
Ga0315904_1125623213300031951FreshwaterMPTIGYKPNNRMTAEEIEVRIWAIVIFALTLILLG
Ga0315294_1040397413300031952SedimentMPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMG
Ga0315274_1059660913300031999SedimentMPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFL
Ga0315274_1199467513300031999SedimentMMPTIGYKPNNRLSADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0315289_1035494763300032046SedimentMPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASM
Ga0315905_1061643713300032092FreshwaterMPTIGYKPNNRLNADEIEVRVWAFVIVVLVTILLA
Ga0315905_1113799923300032092FreshwaterMPTIGYKKNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVMQPMNG
Ga0315295_1058972643300032156SedimentMPTIGYKTNNRLTADEIEVRVWAFVIVVLVTILLA
Ga0315295_1076056913300032156SedimentMMPTIGYKPSNRLSADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0315268_1071493013300032173SedimentMPTIGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYSVSFVQQPMNGSM
Ga0315286_1143430613300032342SedimentMPTVGYKTNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLY
Ga0334996_0546767_368_5083300033994FreshwaterMPTVAYKTTNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFV
Ga0334986_0542347_434_5623300034012FreshwaterMATIGYKPNNRLTADEIEVRVWAFVIVVLVSILLASMGMFLYS
Ga0335002_0552326_457_6033300034020FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQ
Ga0334987_0262494_3_1643300034061FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQPMSGM
Ga0334995_0256312_1059_11723300034062FreshwaterMPTVGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMG
Ga0335010_0170826_1_1113300034092FreshwaterMPTVAYKTNNRLTAEEIEVRVWAFVIVVLVSILLGAM
Ga0335027_0257300_1097_12013300034101FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVTILLA
Ga0335029_0607645_2_1363300034102FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVS
Ga0335031_0011210_6492_66053300034104FreshwaterMATIGYKPNNRLNADEIEVRVWAFVIVVLVTILLASMG
Ga0335063_0187405_1_1053300034111FreshwaterMPTVVKNVSNRLTAEEIEVRVWAFVIVVLVSILLG
Ga0335063_0372288_582_7313300034111FreshwaterMATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVTQP
Ga0335066_0313623_3_1343300034112FreshwaterMATVGYKQNNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSV
Ga0335066_0363025_1_1593300034112FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSVSFVTQPMSG
Ga0335053_0595947_506_6373300034118FreshwaterMATIGYKTNNRLTSDEIEVRVWAFVIVVLVSILLGAMAMFLYSV
Ga0335060_0155747_1185_13283300034122FreshwaterMPTVAYKTTNRLTADEIEVRVWAFVIVVLVTILLASMGMFLYSVSFVT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.