Metagenome Family F078404

Overview

Basic Information

• Family ID: F078404
• Family Type: Metagenome
• Number of Sequences: 116
• Average Sequence Length: 36 residues
• Representative Sequence: MRQHYKPEPVARPWAGALLAVTIGLALAVILLEYL
• Number of Associated Samples: 66
• Number of Associated Scaffolds: 116

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 91.38 %
• % of genes near scaffold ends (potentially truncated): 9.48 %
• % of genes from short scaffolds (< 2000 bps): 50.86 %
• Associated GOLD sequencing projects: 53
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (74.138 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (59.483 % of family members)
• Environment Ontology (ENVO): Unclassified (80.172 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (89.655 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 34.92%
  β-sheet: 0.00%
  Coil/Unstructured: 65.08%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF03237	Terminase_6N	6.90
PF16510	P22_portal	5.17
PF10926	DUF2800	4.31
PF00476	DNA_pol_A	3.45
PF12708	Pectate_lyase_3	1.72
PF13229	Beta_helix	1.72
PF16793	RepB_primase	0.86
PF00959	Phage_lysozyme	0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	3.45

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
All Organisms	root	All Organisms	25.86 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
Viruses	superkingdom	All Organisms → Viruses	22.41 %
cellular organisms	root	All Organisms → cellular organisms	3.45 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	19.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	19.83 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.59 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	19.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.86 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.86 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	19.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	19.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.86 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.86 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.86 %
Xanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	0.86 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	74.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.59 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.86 %
Xanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	0.86 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005581|Ga0049081_10027791	Not Available	2150
3300006037|Ga0075465_10042874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	945
3300006802|Ga0070749_10692113	Not Available	545
3300006805|Ga0075464_10218073	Not Available	1136
3300006920|Ga0070748_1164041	Not Available	822
3300007734|Ga0104986_1752	Not Available	28664
3300009068|Ga0114973_10003118	Not Available	11786
3300009068|Ga0114973_10009021	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6534
3300009068|Ga0114973_10036580	Not Available	2945
3300009068|Ga0114973_10040002	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2801
3300009068|Ga0114973_10076698	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1925
3300009068|Ga0114973_10101112	Not Available	1638
3300009068|Ga0114973_10271488	Not Available	910
3300009151|Ga0114962_10000461	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	36195
3300009151|Ga0114962_10002505	Not Available	15270
3300009151|Ga0114962_10035045	Not Available	3411
3300009151|Ga0114962_10342717	Not Available	822
3300009152|Ga0114980_10003083	Not Available	11537
3300009152|Ga0114980_10082226	Not Available	1931
3300009155|Ga0114968_10001508	Not Available	17850
3300009158|Ga0114977_10038211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2997
3300009158|Ga0114977_10058629	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2373
3300009158|Ga0114977_10103262	Not Available	1727
3300009158|Ga0114977_10152918	Not Available	1373
3300009159|Ga0114978_10038880	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3351
3300009159|Ga0114978_10039526	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3317
3300009159|Ga0114978_10311562	Not Available	961
3300009159|Ga0114978_10377351	Not Available	853
3300009159|Ga0114978_10377709	Not Available	853
3300009160|Ga0114981_10611393	Not Available	579
3300009161|Ga0114966_10070259	Not Available	2421
3300009163|Ga0114970_10006298	Not Available	8505
3300009163|Ga0114970_10016284	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5085
3300009163|Ga0114970_10041362	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3015
3300009163|Ga0114970_10064411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2333
3300009163|Ga0114970_10162521	Not Available	1335
3300009164|Ga0114975_10019059	Not Available	4171
3300009180|Ga0114979_10198132	Not Available	1217
3300009180|Ga0114979_10278848	Not Available	996
3300009181|Ga0114969_10004468	Not Available	11050
3300009181|Ga0114969_10729630	Not Available	531
3300009183|Ga0114974_10064975	Not Available	2406
3300009184|Ga0114976_10266457	Not Available	925
3300009419|Ga0114982_1043625	Not Available	1426
3300010157|Ga0114964_10476046	Not Available	588
3300010160|Ga0114967_10125731	Not Available	1454
3300010885|Ga0133913_10787419	Not Available	2479
3300010885|Ga0133913_10850040	Not Available	2374
3300010885|Ga0133913_10898411	Not Available	2300
3300010885|Ga0133913_11877361	All Organisms → Viruses → Predicted Viral	1495
3300010885|Ga0133913_13096639	All Organisms → Viruses → Predicted Viral	1104
3300011010|Ga0139557_1001244	Not Available	5922
3300011116|Ga0151516_10246	Not Available	31624
3300011335|Ga0153698_1161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31831
3300011339|Ga0153700_10291	Not Available	27167
3300013014|Ga0164295_10577090	Not Available	865
3300013372|Ga0177922_10882086	Not Available	1260
3300015050|Ga0181338_1015054	Not Available	1239
3300017736|Ga0181365_1079741	Not Available	802
3300017761|Ga0181356_1094415	Not Available	980
3300017780|Ga0181346_1011567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3764
3300017780|Ga0181346_1219140	Not Available	678
3300017785|Ga0181355_1189425	Not Available	813
3300017785|Ga0181355_1247941	Not Available	684
3300017785|Ga0181355_1312670	Not Available	587
3300018416|Ga0181553_10706074	Not Available	527
3300019784|Ga0181359_1004130	Not Available	4567
3300019784|Ga0181359_1050918	Not Available	1597
3300019784|Ga0181359_1099785	Not Available	1066
3300019784|Ga0181359_1134112	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	869
3300019784|Ga0181359_1134615	Not Available	867
3300020157|Ga0194049_1132775	Not Available	671
3300021340|Ga0194041_10061441	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1190
3300021600|Ga0194059_1101960	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	894
3300022190|Ga0181354_1011508	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2626
3300022752|Ga0214917_10004566	Not Available	15325
3300023179|Ga0214923_10569080	Not Available	542
3300023184|Ga0214919_10001406	Not Available	39518
3300023184|Ga0214919_10049215	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4055
3300025595|Ga0208248_1072995	Not Available	771
3300025616|Ga0208613_1059144	Not Available	879
3300025896|Ga0208916_10000742	Not Available	14772
3300027659|Ga0208975_1069449	Not Available	1054
3300027733|Ga0209297_1000996	Not Available	16824
3300027733|Ga0209297_1047132	All Organisms → Viruses → Predicted Viral	1955
3300027733|Ga0209297_1064877	Not Available	1622
3300027734|Ga0209087_1008218	Not Available	5453
3300027734|Ga0209087_1010078	Not Available	4853
3300027734|Ga0209087_1013099	Not Available	4191
3300027736|Ga0209190_1002949	Not Available	11334
3300027736|Ga0209190_1004009	Not Available	9682
3300027736|Ga0209190_1004273	Not Available	9305
3300027736|Ga0209190_1028772	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3006
3300027736|Ga0209190_1030380	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2903
3300027749|Ga0209084_1000524	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	36217
3300027749|Ga0209084_1001237	Not Available	21947
3300027749|Ga0209084_1008466	Not Available	6476
3300027754|Ga0209596_1001470	Not Available	20302
3300027754|Ga0209596_1006554	Not Available	8379
3300027759|Ga0209296_1011209	All Organisms → cellular organisms → Bacteria → Proteobacteria	5374
3300027763|Ga0209088_10000264	Not Available	37988
3300027763|Ga0209088_10032841	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2607
3300027764|Ga0209134_10000715	Not Available	8781
3300027764|Ga0209134_10032540	Not Available	1693
3300027770|Ga0209086_10036875	All Organisms → cellular organisms → Bacteria	2858
3300027782|Ga0209500_10212892	Not Available	865
3300027782|Ga0209500_10232523	Not Available	814
3300027782|Ga0209500_10267652	Not Available	738
3300027808|Ga0209354_10261094	Not Available	694
3300027969|Ga0209191_1216163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	746
3300027971|Ga0209401_1001035	Not Available	18600
3300031952|Ga0315294_10216637	Not Available	1891
3300031999|Ga0315274_11364094	Not Available	686
3300032018|Ga0315272_10381929	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	692
3300032173|Ga0315268_10278330	Not Available	1616
3300034121|Ga0335058_0216450	Not Available	1118

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.14%
Terrestrial	Environmental → Terrestrial	0.86%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	93.97%
Marine	Environmental → Aquatic → Marine	5.17%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.86%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	73.28%
Lentic	Environmental → Aquatic → Freshwater → Lentic	18.10%
Coastal	Environmental → Aquatic → Marine → Coastal	4.31%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.72%
Ice	Environmental → Aquatic → Freshwater → Ice	0.86%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.86%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.86%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	69.83%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	18.10%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	4.31%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.45%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.72%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.86%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.86%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.86%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	59.48%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	14.66%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.17%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	4.31%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.45%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	2.59%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.59%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.72%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.72%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.72%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.86%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.86%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.86%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300006037	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA	Environmental
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental
3300007734	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan	Environmental
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental
3300011116	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov	Environmental
3300011335	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman	Environmental
3300011339	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam	Environmental
3300013014	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG	Environmental
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020157	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m	Environmental
3300021340	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m	Environmental
3300021600	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m	Environmental
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental
3300025595	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)	Environmental
3300025616	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)	Environmental
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0049081_100277914	3300005581	Freshwater Lentic	MREHYKPAPTPNPLADVLLAVSIGLALAAILLEYL*
Ga0075465_100428744	3300006037	Aqueous	MRQHYKPEPVARPWADVLLAVTIGLALAAILLEYL*
Ga0070749_106921131	3300006802	Aqueous	SMRQHYKPDLVARPWADALLAVTIGLVLAVLLVRYL*
Ga0075464_102180736	3300006805	Aqueous	MRQHYKPDPVARPWAGALLAVTIGLALAVILLEYL*
Ga0070748_11640411	3300006920	Aqueous	GGRSMNRQHYKPEPVARPWAGALLAVTIGLALAAILLEYL*
Ga0104986_175233	3300007734	Freshwater	MRQHYKPEPVARPWADMLLAVSIGLILAAILLEYL*
Ga0114973_1000311811	3300009068	Freshwater Lake	MREHYKPTPTPHPLADVLLAVSIGLILAAILLEYL*
Ga0114973_100090213	3300009068	Freshwater Lake	MREHYKPEPTRNPLADALLAVSIGLILAAILLEYL*
Ga0114973_100365803	3300009068	Freshwater Lake	MRQHYKPEPGARPWAGALLAVTIGLALAVLLVRYL*
Ga0114973_100400026	3300009068	Freshwater Lake	MNRQHYKPEPAPRPWADALLAISIGLALAFILLEYLP*
Ga0114973_100766983	3300009068	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAVLLLEYL*
Ga0114973_101011125	3300009068	Freshwater Lake	MNRQHYKPEPVARPWAGALLAVTIGLALAVILLEYL*
Ga0114973_102714883	3300009068	Freshwater Lake	MREHYKPEPVARPWAGALLAVTIGLTLAAILLEYL*
Ga0114962_1000046151	3300009151	Freshwater Lake	MREHYTPMPRPRPLAGAALAVAIGLALAVLLVRYL*
Ga0114962_100025058	3300009151	Freshwater Lake	MTRQHYKPAPPARPIASAALAVSIGLILAVLLVRYL*
Ga0114962_100350452	3300009151	Freshwater Lake	MREHYTPAPIARLWASAMLAVAIGLALAVLLLEYL*
Ga0114962_103427173	3300009151	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAAILLEYL*
Ga0114980_100030838	3300009152	Freshwater Lake	MNRQHYKPEPAPRPWANALLAISIGLALAFILLEYL*
Ga0114980_100822263	3300009152	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAVILLEYL*
Ga0114968_1000150824	3300009155	Freshwater Lake	MRQHYKPAPIPRPWADALLAVSIGLILAAILLEYLA*
Ga0114977_100382113	3300009158	Freshwater Lake	MREHYTPAPIARPWADVLLAVTIGLALAVLLLEYL*
Ga0114977_100586292	3300009158	Freshwater Lake	MRKHYTPAPIARPWVDVLLAVTIGLALAVLLLEYL*
Ga0114977_101032622	3300009158	Freshwater Lake	MREHYKPEPVARPWAGALLAVTIGLVLAAILLEYL*
Ga0114977_101529183	3300009158	Freshwater Lake	MRQHYKPEPVARLWAGALLAVTIGLALAVILLEYL*
Ga0114978_100388808	3300009159	Freshwater Lake	MREHYKPEPIRNPLADALLAVSIGLILAAILLEYL*
Ga0114978_100395263	3300009159	Freshwater Lake	MRQHYKPVPVARPWAGALLAVTIGLALAVLLVRYL*
Ga0114978_103115622	3300009159	Freshwater Lake	MRQHYKPDPVARPWAGALLAVTIGLALAAILLEYL*
Ga0114978_103773511	3300009159	Freshwater Lake	MNRQHYKPEPVARLWAGALLAVLIGLILAVILLEYL*
Ga0114978_103777091	3300009159	Freshwater Lake	SMRQHYKPDPVARPWAGALLAVTIGLVLAVILLEYL*
Ga0114981_106113932	3300009160	Freshwater Lake	MRQHYKPDPVARPWAGALLAVLIGLILAVILLEYL*
Ga0114966_100702595	3300009161	Freshwater Lake	MRQHYTPTRPVRPLAGAALAVAIGLALAVLLVRYL*
Ga0114970_100062984	3300009163	Freshwater Lake	MTRQHYTQAPPARPIAGAALAVAIGLALAVLLVGYL*
Ga0114970_100162844	3300009163	Freshwater Lake	MRQHYKPAPTPRPWADALLAVSIGLILAAILLEYLP*
Ga0114970_100413623	3300009163	Freshwater Lake	MREHYKPEPVARPWAGALLAVSIGLALAVLLVRYL*
Ga0114970_100644114	3300009163	Freshwater Lake	MREHYKPTPPPHPLADVLLAVSIGLILAAILLEYL*
Ga0114970_101625212	3300009163	Freshwater Lake	MNRQHYKPEPVARPWAGALLAVTIGLALAAILLEYL*
Ga0114975_100190598	3300009164	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAVLLVRYL*
Ga0114979_101981322	3300009180	Freshwater Lake	MNRQHYKPEPVARPWAGALLAVIIGLALAVLLVRYL*
Ga0114979_102788482	3300009180	Freshwater Lake	MRQHYKPDPVARPWAGALLAVTIGLALAVLLVRYL*
Ga0114969_100044686	3300009181	Freshwater Lake	MTRQHYKPAPPARPIASAVLAVSIGLILAVLLVRYL*
Ga0114969_107296303	3300009181	Freshwater Lake	MRQHYKLEPVARPWAGALLAVTIGLALAVILLEYL*
Ga0114974_100649751	3300009183	Freshwater Lake	MRQPYPPAPAPRPWADALLAVSIGLILAVILLEYLA*
Ga0114976_102664571	3300009184	Freshwater Lake	TTLLNWKCKMREHYTIKPTPNPLADVLLAVSIGLVLAAILLEYLA*
Ga0114982_10436251	3300009419	Deep Subsurface	RQHYKPDPVARPWAGALLAVTIGLALAAILLEYL*
Ga0114964_104760461	3300010157	Freshwater Lake	MTRQHYTQAPPARPIAGAALAVAIGLALAVLLVRYL*
Ga0114967_101257311	3300010160	Freshwater Lake	TMRQHYTPTRPVRPLAGAALAVAIGLALAVLLVRYL*
Ga0133913_107874192	3300010885	Freshwater Lake	MREHYTPAPVARPIASAALAVAIGLTLTVLLAGYL*
Ga0133913_108500405	3300010885	Freshwater Lake	MREHYKPEPVARPWAGALLAVSIGLVLAVLLVRYL*
Ga0133913_108984113	3300010885	Freshwater Lake	MREHYTIKPTPNPLADVLLAVSIGLVLAAILLEYLA*
Ga0133913_118773614	3300010885	Freshwater Lake	MRQHYTPAPAPRPWADALLAVSIGLILAVILLEYLA*
Ga0133913_130966392	3300010885	Freshwater Lake	MNRQHYKPEPVARPWADLLLAVSIGLILAAILLEYL*
Ga0139557_10012444	3300011010	Freshwater	MNREHYKLEPVARPWAGALLAVTIGLTLAVILLEYL*
Ga0151516_1024620	3300011116	Freshwater	MRQHYKPEPAPRPWADALLAISIGLILAFILLEYLP*
Ga0153698_116148	3300011335	Freshwater	MRQHYKPEPVARPWADLLLAVSIGLILAAILLEYL*
Ga0153700_1029111	3300011339	Freshwater	MTRQHYTPDPAPRDAAGIALAVAIGLALAVLLVRYL*
Ga0164295_105770904	3300013014	Freshwater	MREHYKPEPVARPWAGALLAVTIGLALAVILLEYL*
Ga0177922_108820864	3300013372	Freshwater	MNREHYKLEPVARPWAGALLAVTIGLTLPVILLEYL*
Ga0181338_10150544	3300015050	Freshwater Lake	MRQHYTPDPVARPWAGALLAVTIGVALAVILLEYL*
Ga0181365_10797413	3300017736	Freshwater Lake	MRQHYKPEPVARPWAGALLAVSIGLALAVLLVRYL
Ga0181356_10944153	3300017761	Freshwater Lake	MNRQHYKPEPVARPWAGAMLAVTIGLALAVLLVRYL
Ga0181346_10115672	3300017780	Freshwater Lake	MRQHYKPEPVARPWAGALLAVIIGLALAAILLEYL
Ga0181346_12191402	3300017780	Freshwater Lake	MRQHYKPEPVARPWAGALLAVIIGLALAVILLEYL
Ga0181355_11894252	3300017785	Freshwater Lake	MREHYKPEPVARPWAGALLAVIIGLALAVILLEYL
Ga0181355_12479414	3300017785	Freshwater Lake	MNRQHYKPEPVARPWASAMLAVTIGLALAAILLEYL
Ga0181355_13126701	3300017785	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTICLALAVILLEYL
Ga0181553_107060742	3300018416	Salt Marsh	MRQHYNPAPIARPWAGALLAVSIGLILAAILLEYL
Ga0181359_10041306	3300019784	Freshwater Lake	MNRQHYKPEPAPRPWAGALLAILIGLALAFILLEYL
Ga0181359_10509183	3300019784	Freshwater Lake	MRQHYKPDPVARPWAGALLAVTIGLALAAILLEYL
Ga0181359_10997853	3300019784	Freshwater Lake	MRQHYTPDPVARPWAGALLAVTIGVALAVILLEYL
Ga0181359_11341121	3300019784	Freshwater Lake	MRQHYKPEPAPRPWADALLAISIGLALAFILLEYLP
Ga0181359_11346151	3300019784	Freshwater Lake	RRRFYGGRSMRQHYKPDPVARPWAGALLAVTIGLALAVLLVRYL
Ga0194049_11327752	3300020157	Anoxic Zone Freshwater	MRQHYKPEPVARPWAGALLAVTIGLALAVILLEYL
Ga0194041_100614412	3300021340	Anoxic Zone Freshwater	MRQHYKPEPVARPWAGALLAVTIGLALAAILLEYL
Ga0194059_11019603	3300021600	Anoxic Zone Freshwater	MRQHYKPEPVARPWAGAMLAVTIGLALAAILLEYL
Ga0181354_10115081	3300022190	Freshwater Lake	MNRQHYKPEPVARPWAGALLAVTIGLALAVILLEYL
Ga0214917_1000456617	3300022752	Freshwater	MREHYTIKPTRNPLADALLAVSIGLILAVILLEYL
Ga0214923_105690801	3300023179	Freshwater	MRQHYKPEPAPRPWAGALLAVTIGLALAVILLEYL
Ga0214919_1000140617	3300023184	Freshwater	MRQHYKPEPVARPWADLLLAVSIGLILAVILLEYL
Ga0214919_100492153	3300023184	Freshwater	MREHYKPAPVARPWAGALLAVTIGLALAAILLEYL
Ga0208248_10729953	3300025595	Freshwater	MREHYKPAPPARPIASAALAVSIGLALAVILLEYL
Ga0208613_10591442	3300025616	Freshwater	MREHYKPEPVARPWADALLAVSIGLALAVILLEYL
Ga0208916_100007423	3300025896	Aqueous	MRQHYKPEPVARPWADVLLAVTIGLALAAILLEYL
Ga0208975_10694492	3300027659	Freshwater Lentic	MREHYKPAPTPNPLADVLLAVSIGLALAAILLEYL
Ga0209297_100099620	3300027733	Freshwater Lake	MNRQHYKPEPAPRPWADALLAISIGLALAFILLEYLP
Ga0209297_10471323	3300027733	Freshwater Lake	MREHYTPAPIARPWADVLLAVTIGLALAVLLLEYL
Ga0209297_10648773	3300027733	Freshwater Lake	MRQHYKPEPVARLWAGALLAVTIGLALAVILLEYL
Ga0209087_100821810	3300027734	Freshwater Lake	MRKHYTPAPIARPWVDVLLAVTIGLALAVLLLEYL
Ga0209087_10100788	3300027734	Freshwater Lake	MREHYKPEPVARPWAGALLAVTIGLVLAAILLEYL
Ga0209087_10130998	3300027734	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAVLLVRYL
Ga0209190_10029496	3300027736	Freshwater Lake	MREHYKPTPTPHPLADVLLAVSIGLILAAILLEYL
Ga0209190_10040094	3300027736	Freshwater Lake	MTRQHYTQAPPARPIAGAALAVAIGLALAVLLVGYL
Ga0209190_10042737	3300027736	Freshwater Lake	MREHYKPEPTRNPLADALLAVSIGLILAAILLEYL
Ga0209190_10287725	3300027736	Freshwater Lake	MRQHYKPEPVARPWAGALLAVTIGLALAVLLLEYL
Ga0209190_10303803	3300027736	Freshwater Lake	MREHYKPEPVARPWAGALLAVSIGLALAVLLVRYL
Ga0209084_100052413	3300027749	Freshwater Lake	MREHYTPMPRPRPLAGAALAVAIGLALAVLLVRYL
Ga0209084_100123725	3300027749	Freshwater Lake	MTRQHYKPAPPARPIASAALAVSIGLILAVLLVRYL
Ga0209084_10084663	3300027749	Freshwater Lake	MREHYTPAPIARLWASAMLAVAIGLALAVLLLEYL
Ga0209596_100147024	3300027754	Freshwater Lake	MRQHYKPAPIPRPWADALLAVSIGLILAAILLEYLA
Ga0209596_10065545	3300027754	Freshwater Lake	MTRQHYKPAPPARPIASAVLAVSIGLILAVLLVRYL
Ga0209296_10112094	3300027759	Freshwater Lake	MREHYKIKPAINPLADVLLAVSIGLILAAILLEYL
Ga0209088_1000026457	3300027763	Freshwater Lake	MNRQHYKPEPAPRPWANALLAISIGLALAFILLEYL
Ga0209088_100328412	3300027763	Freshwater Lake	MNRQHYKPEPVARPWAGALLAVIIGLALAVLLVRYL
Ga0209134_100007153	3300027764	Freshwater Lake	MRQHYKPEPVARPWADLLLAVSIGLVMGVLLAVYL
Ga0209134_100325403	3300027764	Freshwater Lake	MNREHYKPEPVARPWAGALLAVTIGLALAVILLEYL
Ga0209086_100368755	3300027770	Freshwater Lake	MRQHYTPTRPVRPLAGAALAVAIGLALAVLLVRYL
Ga0209500_102128921	3300027782	Freshwater Lake	SMRQHYKPDPVARPWAGALLAVTIGLVLAVILLEYL
Ga0209500_102325233	3300027782	Freshwater Lake	MNRQHYKPEPVARLWAGALLAVLIGLILAVILLEYL
Ga0209500_102676521	3300027782	Freshwater Lake	MNRQHYKPEPVARLWAGALLAVTIGLTLAVILLEYL
Ga0209354_102610943	3300027808	Freshwater Lake	MREHYKSEPVARPWAGALLAVTIGLALAAILLEYL
Ga0209191_12161632	3300027969	Freshwater Lake	MRQHYKPEPVARPWAGAMLAVTIGLALAVILLEYL
Ga0209401_10010358	3300027971	Freshwater Lake	MRQHYKPEPGARPWAGALLAVTIGLALAVLLVRYL
Ga0315294_102166372	3300031952	Sediment	MREHYKPAPVARPWAGALLAVSIGLALAVLLVRYL
Ga0315274_113640943	3300031999	Sediment	MNRQHYKPEPVARPWAGALLAVTIGLALAVLLVRYL
Ga0315272_103819293	3300032018	Sediment	MREHYTIKPTPNPLAGALLAVSIGLILAVLLVRYL
Ga0315268_102783306	3300032173	Sediment	MRQHYKPAPVARPWAGALLAVSIGLVLAVLLVGYL
Ga0335058_0216450_954_1061	3300034121	Freshwater	MRQHYKPEPVARPWAGVLLAVTIGLALAVILLEYL