| Basic Information | |
|---|---|
| Family ID | F078384 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCLGGW |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 71.55 % |
| % of genes near scaffold ends (potentially truncated) | 20.69 % |
| % of genes from short scaffolds (< 2000 bps) | 50.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (53.448 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (38.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (91.379 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.22% β-sheet: 16.22% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 21.55 |
| PF00436 | SSB | 7.76 |
| PF01930 | Cas_Cas4 | 7.76 |
| PF13704 | Glyco_tranf_2_4 | 6.90 |
| PF13392 | HNH_3 | 3.45 |
| PF00166 | Cpn10 | 2.59 |
| PF01988 | VIT1 | 1.72 |
| PF07659 | DUF1599 | 1.72 |
| PF08281 | Sigma70_r4_2 | 1.72 |
| PF09834 | DUF2061 | 1.72 |
| PF00745 | GlutR_dimer | 0.86 |
| PF04973 | NMN_transporter | 0.86 |
| PF09723 | Zn-ribbon_8 | 0.86 |
| PF02675 | AdoMet_dc | 0.86 |
| PF00004 | AAA | 0.86 |
| PF13830 | DUF4192 | 0.86 |
| PF12804 | NTP_transf_3 | 0.86 |
| PF06067 | DUF932 | 0.86 |
| PF00271 | Helicase_C | 0.86 |
| PF03237 | Terminase_6N | 0.86 |
| PF00011 | HSP20 | 0.86 |
| PF00145 | DNA_methylase | 0.86 |
| PF13439 | Glyco_transf_4 | 0.86 |
| PF13362 | Toprim_3 | 0.86 |
| PF08401 | ArdcN | 0.86 |
| PF13481 | AAA_25 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 7.76 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 7.76 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 7.76 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.59 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 1.72 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 1.72 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.86 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.86 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.86 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.14 % |
| Unclassified | root | N/A | 25.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000162|TB03JUN2009H_c001723 | Not Available | 4575 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c001716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5413 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c005495 | Not Available | 2602 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1008340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5913 | Open in IMG/M |
| 3300001282|B570J14230_10225635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300001850|RCM37_1153772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300002091|JGI24028J26656_1002079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3897 | Open in IMG/M |
| 3300002091|JGI24028J26656_1010823 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300002092|JGI24218J26658_1003233 | All Organisms → Viruses → Predicted Viral | 3829 | Open in IMG/M |
| 3300002092|JGI24218J26658_1003939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3297 | Open in IMG/M |
| 3300002092|JGI24218J26658_1013681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300002098|JGI24219J26650_1004779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2867 | Open in IMG/M |
| 3300002098|JGI24219J26650_1013098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
| 3300002307|JGI24890J29729_1007016 | All Organisms → cellular organisms → Bacteria | 3365 | Open in IMG/M |
| 3300002408|B570J29032_109137185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300002408|B570J29032_109593928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300003375|JGI26470J50227_1004182 | All Organisms → Viruses → Predicted Viral | 4221 | Open in IMG/M |
| 3300003375|JGI26470J50227_1046620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300003783|Ga0007850_1003550 | Not Available | 1446 | Open in IMG/M |
| 3300003783|Ga0007850_1004863 | Not Available | 1196 | Open in IMG/M |
| 3300003789|Ga0007835_1020556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300003798|Ga0007842_1001702 | Not Available | 1875 | Open in IMG/M |
| 3300003806|Ga0007864_1001758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2380 | Open in IMG/M |
| 3300003809|Ga0007869_1000090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17858 | Open in IMG/M |
| 3300003815|Ga0007856_1001328 | All Organisms → Viruses → Predicted Viral | 2567 | Open in IMG/M |
| 3300003820|Ga0007863_1015774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300003820|Ga0007863_1021997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 538 | Open in IMG/M |
| 3300003823|Ga0007875_1010449 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300004461|Ga0066223_1380623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300004770|Ga0007804_1009571 | Not Available | 2885 | Open in IMG/M |
| 3300004806|Ga0007854_10218626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300004807|Ga0007809_10097937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300005527|Ga0068876_10267366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300005528|Ga0068872_10631108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300005581|Ga0049081_10139910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300005758|Ga0078117_1031612 | All Organisms → Viruses → Predicted Viral | 1786 | Open in IMG/M |
| 3300005805|Ga0079957_1070937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2012 | Open in IMG/M |
| 3300006071|Ga0007876_1151613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300006103|Ga0007813_1000390 | Not Available | 15977 | Open in IMG/M |
| 3300006103|Ga0007813_1089219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300006108|Ga0007862_1030741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300006108|Ga0007862_1043420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300006112|Ga0007857_1036814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300006116|Ga0007807_1067052 | Not Available | 684 | Open in IMG/M |
| 3300006118|Ga0007859_1016856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1627 | Open in IMG/M |
| 3300006118|Ga0007859_1080347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300006128|Ga0007828_1064711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300006805|Ga0075464_10104173 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
| 3300007169|Ga0102976_1002604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40016 | Open in IMG/M |
| 3300007171|Ga0102977_1004593 | All Organisms → Viruses → Predicted Viral | 2246 | Open in IMG/M |
| 3300007212|Ga0103958_1224395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
| 3300008108|Ga0114341_10039946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3550 | Open in IMG/M |
| 3300009154|Ga0114963_10020124 | All Organisms → Viruses → Predicted Viral | 4452 | Open in IMG/M |
| 3300009154|Ga0114963_10140868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
| 3300009159|Ga0114978_10025667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4266 | Open in IMG/M |
| 3300009159|Ga0114978_10054302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2749 | Open in IMG/M |
| 3300009183|Ga0114974_10031608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3655 | Open in IMG/M |
| 3300009470|Ga0126447_1013067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2102 | Open in IMG/M |
| 3300013004|Ga0164293_10268209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
| 3300013005|Ga0164292_10165165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
| 3300013093|Ga0164296_1004368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12872 | Open in IMG/M |
| 3300013094|Ga0164297_10043479 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
| 3300014962|Ga0134315_1006361 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
| 3300020159|Ga0211734_10414692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2955 | Open in IMG/M |
| 3300020159|Ga0211734_11219149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2870 | Open in IMG/M |
| 3300020541|Ga0208359_1023223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300020563|Ga0208082_1076715 | Not Available | 530 | Open in IMG/M |
| 3300020712|Ga0214255_1000864 | Not Available | 6435 | Open in IMG/M |
| 3300020718|Ga0214178_1000763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8656 | Open in IMG/M |
| 3300020727|Ga0214246_1005407 | Not Available | 2602 | Open in IMG/M |
| 3300020727|Ga0214246_1011332 | Not Available | 1630 | Open in IMG/M |
| 3300020729|Ga0214251_1019666 | Not Available | 1206 | Open in IMG/M |
| 3300020729|Ga0214251_1029952 | Not Available | 906 | Open in IMG/M |
| 3300021115|Ga0214174_100118 | Not Available | 10169 | Open in IMG/M |
| 3300021131|Ga0214206_1001801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4798 | Open in IMG/M |
| 3300021134|Ga0214171_1001427 | Not Available | 6789 | Open in IMG/M |
| 3300021139|Ga0214166_1000570 | Not Available | 18080 | Open in IMG/M |
| 3300021139|Ga0214166_1015145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2048 | Open in IMG/M |
| 3300021963|Ga0222712_10679105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300022591|Ga0236341_1004546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6154 | Open in IMG/M |
| 3300022591|Ga0236341_1017244 | Not Available | 2304 | Open in IMG/M |
| 3300022591|Ga0236341_1019351 | Not Available | 2118 | Open in IMG/M |
| 3300022591|Ga0236341_1038575 | Not Available | 1293 | Open in IMG/M |
| 3300022594|Ga0236340_1008772 | Not Available | 3311 | Open in IMG/M |
| 3300022602|Ga0248169_100252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 89059 | Open in IMG/M |
| 3300022602|Ga0248169_112140 | Not Available | 6402 | Open in IMG/M |
| 3300022602|Ga0248169_140386 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300023174|Ga0214921_10024540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6214 | Open in IMG/M |
| 3300023311|Ga0256681_12073790 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300025316|Ga0209697_10387411 | Not Available | 683 | Open in IMG/M |
| 3300025357|Ga0208383_1001340 | All Organisms → Viruses → Predicted Viral | 3948 | Open in IMG/M |
| 3300025357|Ga0208383_1001381 | Not Available | 3887 | Open in IMG/M |
| 3300025358|Ga0208504_1004401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2287 | Open in IMG/M |
| 3300025369|Ga0208382_1038243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300025381|Ga0208871_1002833 | Not Available | 3752 | Open in IMG/M |
| 3300025382|Ga0208256_1045042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300025383|Ga0208250_1004601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2941 | Open in IMG/M |
| 3300025389|Ga0208257_1002056 | Not Available | 4482 | Open in IMG/M |
| 3300025389|Ga0208257_1003258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3329 | Open in IMG/M |
| 3300025389|Ga0208257_1006556 | Not Available | 2102 | Open in IMG/M |
| 3300025389|Ga0208257_1010331 | Not Available | 1568 | Open in IMG/M |
| 3300025390|Ga0208743_1000597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9361 | Open in IMG/M |
| 3300025400|Ga0208387_1064724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300025402|Ga0208876_1000888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7904 | Open in IMG/M |
| 3300025426|Ga0208739_1009090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1952 | Open in IMG/M |
| 3300025430|Ga0208622_1021901 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300025467|Ga0208260_1006371 | Not Available | 2807 | Open in IMG/M |
| 3300025778|Ga0208388_1057443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300025785|Ga0208498_1014453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300025896|Ga0208916_10034478 | All Organisms → Viruses → Predicted Viral | 2044 | Open in IMG/M |
| 3300027708|Ga0209188_1046002 | All Organisms → Viruses → Predicted Viral | 1967 | Open in IMG/M |
| 3300027734|Ga0209087_1295982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300028025|Ga0247723_1000074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58778 | Open in IMG/M |
| 3300028025|Ga0247723_1102036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300028392|Ga0304729_1000345 | Not Available | 34560 | Open in IMG/M |
| 3300034280|Ga0334997_0174871 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 38.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.76% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 6.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 5.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.72% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.86% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.86% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.86% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.86% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.86% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.86% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.86% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020712 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020729 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021134 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009H_0017237 | 3300000162 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY* |
| TB03JUN2009E_00171619 | 3300000176 | Freshwater | MTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCLGGW* |
| TB03JUN2009E_0054954 | 3300000176 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLHQYSIHTHSNDCLGGY* |
| TBL_comb48_EPIDRAFT_100834012 | 3300000439 | Freshwater | MTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSDKCLGGY* |
| B570J14230_102256352 | 3300001282 | Freshwater | MTYDFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY* |
| RCM37_11537722 | 3300001850 | Marine Plankton | MVKYDFFGQEWFGKCGACKKDMYAPTKGEYLVSFALHTHSEECLGGW* |
| JGI24028J26656_100207910 | 3300002091 | Lentic | MKYDFFGQEWFGKCGACSSELYAPTKGEYLVQFSMHTHSDSCLGGY* |
| JGI24028J26656_10108233 | 3300002091 | Lentic | MTYDFFAGEWSGKCGACKQEMYAPTKGEYLVAFALHTHSKNCLGGW* |
| JGI24218J26658_10032332 | 3300002092 | Lentic | MNKLVKIMSYNFFEGEWAGNCGACLKDLYAPTKGEYLLNYTIHTHSDDCLGGY* |
| JGI24218J26658_10039394 | 3300002092 | Lentic | MTYDFYGREWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY* |
| JGI24218J26658_10136811 | 3300002092 | Lentic | SNAGVVMTYDFYAQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY* |
| JGI24219J26650_10047796 | 3300002098 | Lentic | MTYDFYGQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY* |
| JGI24219J26650_10130982 | 3300002098 | Lentic | MTYDFYAQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY* |
| JGI24890J29729_10070167 | 3300002307 | Lentic | MKFDFFGGEWFGACGACGTELFAPSKSEYQMLYSRHTHSKECLGGY* |
| B570J29032_1091371851 | 3300002408 | Freshwater | VKYMTYDFYAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY* |
| B570J29032_1095939282 | 3300002408 | Freshwater | MNPKIKYMTYDFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTH |
| JGI26470J50227_100418214 | 3300003375 | Freshwater | MTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY* |
| JGI26470J50227_10466201 | 3300003375 | Freshwater | HQVTYDYFAQEWFGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGY* |
| Ga0007850_10035504 | 3300003783 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLG |
| Ga0007850_10048636 | 3300003783 | Freshwater | MTYDYMAGEWFGKCGACDTPLFAPNKSAYILQYSIHTHSDKCLGGW* |
| Ga0007835_10205561 | 3300003789 | Freshwater | MTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW* |
| Ga0007842_10017025 | 3300003798 | Freshwater | MTYDFYAKEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY* |
| Ga0007864_10017583 | 3300003806 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPTKGEYLLQYSIHTHSDKCLGGW* |
| Ga0007869_10000905 | 3300003809 | Freshwater | MKYMTYGFFAKEWSGECGACGTELFAPTQGAYIVNHSAHTHSNKCLGGY* |
| Ga0007856_10013283 | 3300003815 | Freshwater | MTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW* |
| Ga0007863_10157742 | 3300003820 | Freshwater | MTYDFMAEEWYGKCGACGTELYAPTKGAYILQYSIHTHSDDCIGGW* |
| Ga0007863_10219973 | 3300003820 | Freshwater | MTYDFMAQEWYGSCGACGTELFAPTKGAYILQYSIHTHSNDCIG |
| Ga0007875_10104492 | 3300003823 | Freshwater | MTYDFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW* |
| Ga0066223_13806231 | 3300004461 | Marine | MKYDFFGEEWNGKCGACGTEMYAPTKSEYLMSFSIHTHSNHCLGGY* |
| Ga0007804_10095712 | 3300004770 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLGGY* |
| Ga0007854_102186262 | 3300004806 | Freshwater | MTYDFQAGEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY* |
| Ga0007809_100979371 | 3300004807 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPTKGAYILQYSIHTHSNDCLGGW |
| Ga0068876_102673662 | 3300005527 | Freshwater Lake | MTYDFFGGEWFGKCGACDTELYAPTKGEYLLNRSLHTHSSLCLGGW* |
| Ga0068872_106311082 | 3300005528 | Freshwater Lake | MRYKLMEYDFFAEEWSGQCGACGFWLYAPNKEAYNESRWIHTHSDQCLGGY* |
| Ga0049081_101399102 | 3300005581 | Freshwater Lentic | MRYKLMEYDFFAEEWSGQCGACGFWLYAPNKEAYNVSRWIHTHSDQCLGGY* |
| Ga0078117_10316123 | 3300005758 | Lake Water | MTYDFFGQEWFGKCGACKTEMYAPTKGEYLVAYALHTHSDKCLGGW* |
| Ga0079957_10709373 | 3300005805 | Lake | MRYMTYDFFAEEWTGECGACGFELFAPTKEAYNESRWIHTHSDQCLGGY* |
| Ga0007876_11516131 | 3300006071 | Freshwater | TIMTYDFMAQEWYGSCGACGTELFAPSKGEYLLQYSIHTHSNDCIGGW* |
| Ga0007813_10003909 | 3300006103 | Freshwater | MTYDFFGEEWYGSCGACGTELFAPTKGEYLLQYSIHTHSDDCLGGW* |
| Ga0007813_10892194 | 3300006103 | Freshwater | PQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW* |
| Ga0007862_10307415 | 3300006108 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPTKGAYILQYSIHTHSNDCLGGW* |
| Ga0007862_10434201 | 3300006108 | Freshwater | VTYDYFAQEWFGECGACGTELFAPNKGAYILQYSIHTHSNDCLG |
| Ga0007857_10368141 | 3300006112 | Freshwater | HPQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW* |
| Ga0007807_10670522 | 3300006116 | Freshwater | MTYDYMAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW* |
| Ga0007859_10168564 | 3300006118 | Freshwater | MTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCLGGW* |
| Ga0007859_10803474 | 3300006118 | Freshwater | DFFGQEWYGACGACGTELFAPTKGEYLLQYSIHTHSQDCLGGW* |
| Ga0007828_10647113 | 3300006128 | Freshwater | MTYDYTAKEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW* |
| Ga0075464_101041732 | 3300006805 | Aqueous | MTYDFFADEWHGKCGACSTALYAPTKGEYLVAFALHTHSKSCLGGW* |
| Ga0102976_100260444 | 3300007169 | Freshwater Lake | VKYDFFGQEWHGVCGACKEELYAPSKGAWLVQFNMHTHSSNCLGGW* |
| Ga0102977_10045935 | 3300007171 | Freshwater Lake | MTYDFFGEEWFGKCGACKTEMYAPTKGEYLVAYALHTHSDKCLGGW* |
| Ga0103958_12243954 | 3300007212 | Freshwater Lake | MRYMTYDFFAQEWTGECGACGFELFAPTKAAYNESRWIHTHSDQCLGGY* |
| Ga0114341_100399468 | 3300008108 | Freshwater, Plankton | MTYDFFGKEWAGKCGACDTELYAPTKGEYLVNRSLHTHSDKCLGGW* |
| Ga0114963_1002012414 | 3300009154 | Freshwater Lake | MKYDFFGGEWFGKCNACNTELFAPTKGAYDVQRQLHTHSEECLGGW* |
| Ga0114963_101408681 | 3300009154 | Freshwater Lake | TISRNPRIKFMTYDFFGDEWSGNCGACGLDLYAPTKGEYLMQYSKHTHSKNCLGGY* |
| Ga0114978_100256672 | 3300009159 | Freshwater Lake | MKYDFFGEEWHGMCKACGTEMYAPTKSEYLMSFSTHTHSNDCLGGY* |
| Ga0114978_100543027 | 3300009159 | Freshwater Lake | MKYDFFGEEWHGKCGACGNEMYAPTKSEYLMSFSIHTHSNDCLGGY* |
| Ga0114974_100316089 | 3300009183 | Freshwater Lake | MKYDFFGEEWHGKCGACGTQMYAPTKSEYLMSFNLHTHSENCLGGY* |
| Ga0126447_10130671 | 3300009470 | Meromictic Pond | MTYDFYAGEWSGNCGACFTDLFAPTKSEYLLQFSKHTHSDNCLG |
| Ga0164293_102682092 | 3300013004 | Freshwater | MTYDFFGQAWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW* |
| Ga0164292_101651652 | 3300013005 | Freshwater | MTYDFFGQEWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW* |
| Ga0164296_100436829 | 3300013093 | Freshwater | MCQIGWVVAMTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY* |
| Ga0164297_100434793 | 3300013094 | Freshwater | MTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW* |
| Ga0134315_10063615 | 3300014962 | Surface Water | VKYDFFGQEWFGKCGACSKDMYAPTKGEYLVAFALHTHSKDCLGGW* |
| Ga0211734_104146927 | 3300020159 | Freshwater | MNPKIKYMTYDFYAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY |
| Ga0211734_112191493 | 3300020159 | Freshwater | MTYDFFAKEWYGICGACKTELYAPSKGSYIVQHSIHTHSEKCLGGW |
| Ga0208359_10232231 | 3300020541 | Freshwater | YAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY |
| Ga0208082_10767153 | 3300020563 | Freshwater | YAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY |
| Ga0214255_10008647 | 3300020712 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY |
| Ga0214178_100076325 | 3300020718 | Freshwater | MTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCLGGW |
| Ga0214246_10054074 | 3300020727 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLHQYSIHTHSNDCLGGY |
| Ga0214246_10113321 | 3300020727 | Freshwater | NAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY |
| Ga0214251_10196661 | 3300020729 | Freshwater | MTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCL |
| Ga0214251_10299522 | 3300020729 | Freshwater | MKFDFFGGEWFGACGACGAELFAPSKSEYQMLYSRHTHSKECLGGY |
| Ga0214174_10011819 | 3300021115 | Freshwater | MTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGW |
| Ga0214206_10018018 | 3300021131 | Freshwater | MTYDFFAGEWIGNCGACKHEVFGLTKSHYLLEYSKHTHSKDCLGGW |
| Ga0214171_100142714 | 3300021134 | Freshwater | MTYDFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW |
| Ga0214166_100057016 | 3300021139 | Freshwater | MTYDYMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW |
| Ga0214166_10151453 | 3300021139 | Freshwater | MTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSDKCLGGY |
| Ga0222712_106791051 | 3300021963 | Estuarine Water | MKYDFFAEEWTGKCGACNTEMYAPTKSEYLMSFNIHTHSKDCLGGY |
| Ga0236341_10045463 | 3300022591 | Freshwater | MTYDFFAGEWLGNCGACGHEVFGMTKGHYLLEYSKHTHSKDCLGVW |
| Ga0236341_10172445 | 3300022591 | Freshwater | MTYDFFAQEWFGACGACKTELFAPTKGEYLHNYSVHTHSKDCLGGW |
| Ga0236341_10193516 | 3300022591 | Freshwater | MIYDFYAEEWYGKCGACNHELFAPSKGEYLLQYSIHTHSQDCLGGW |
| Ga0236341_10385753 | 3300022591 | Freshwater | MTYDYMAGEWYGKCGACKHELFAPSKGEYLLQYSIHTHSKDCLGGW |
| Ga0236340_10087725 | 3300022594 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPTKGEYILQYSIHTHSKDCLGGW |
| Ga0248169_100252135 | 3300022602 | Freshwater | MCQIGWVVAMTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY |
| Ga0248169_1121406 | 3300022602 | Freshwater | MTYDYLAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW |
| Ga0248169_1403863 | 3300022602 | Freshwater | MTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW |
| Ga0214921_1002454013 | 3300023174 | Freshwater | MKYDFFGDEWYGKCGACNTELFAPTKGAYTVQRQIHTHSEECLGGW |
| Ga0256681_120737901 | 3300023311 | Freshwater | KYDFFEGDWSGNCGACGKDFYAPTKSEYLMQYTKHTKSINCLGGY |
| Ga0209697_103874112 | 3300025316 | Freshwater Lake Hypolimnion | MKFDFFGGEWFGACGACGTELFAPSKSEYQMLYSRHTHSKECLGGY |
| Ga0208383_10013404 | 3300025357 | Freshwater | MTYDFMAQEWYGSCGACGTELFAPTKGAYILQYSIHTHSNDCIGGW |
| Ga0208383_10013814 | 3300025357 | Freshwater | MTYDFMAEEWYGKCGACGTELYAPTKGAYILQYSIHTHSDDCIGGW |
| Ga0208504_10044016 | 3300025358 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLGGY |
| Ga0208382_10382432 | 3300025369 | Freshwater | MTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW |
| Ga0208871_10028337 | 3300025381 | Freshwater | MTYDFFGEEWYGSCGACGTELFAPTKGEYLLQYSIHTHSDDCLGGW |
| Ga0208256_10450422 | 3300025382 | Freshwater | MTYNFFEEEWSGNCGACGKDFYAPSKSEYLMQYTRHTKSINCLGGY |
| Ga0208250_10046019 | 3300025383 | Freshwater | NQFIYQSNAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSLHTHSDNCLGGY |
| Ga0208257_10020567 | 3300025389 | Freshwater | MTYDFYAKEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY |
| Ga0208257_100325811 | 3300025389 | Freshwater | MTYDYTAKEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCIGGW |
| Ga0208257_10065567 | 3300025389 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPTKGEYLLQYSIHTHSDKCLGGW |
| Ga0208257_10103312 | 3300025389 | Freshwater | MTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNNCLGGW |
| Ga0208743_10005972 | 3300025390 | Freshwater | MKYMTYGFFAKEWSGECGACGTELFAPTQGAYIVNHSAHTHSNKCLGGY |
| Ga0208387_10647241 | 3300025400 | Freshwater | PQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW |
| Ga0208876_10008889 | 3300025402 | Freshwater | MTYDFFAEEWSGKCGACNTELFAPSKGAYLLQYSIHTHSNDCLGGW |
| Ga0208739_10090906 | 3300025426 | Freshwater | YQSNAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY |
| Ga0208622_10219013 | 3300025430 | Freshwater | MTYDYMAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW |
| Ga0208260_10063712 | 3300025467 | Freshwater | MTYDFYAKEWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY |
| Ga0208388_10574433 | 3300025778 | Freshwater | DFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW |
| Ga0208498_10144533 | 3300025785 | Freshwater | MTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSLHTHSDNCLGGY |
| Ga0208916_100344783 | 3300025896 | Aqueous | MTYDFFADEWHGKCGACSTALYAPTKGEYLVAFALHTHSKSCLGGW |
| Ga0209188_10460021 | 3300027708 | Freshwater Lake | MTYDFFGDEWSGNCGACGLDFYAPTKGEYLMQYSKHTHSKNCLGGY |
| Ga0209087_12959821 | 3300027734 | Freshwater Lake | MKYDFFGEEWHGKCGACGNEMYAPTKSEYLMSFSIHTHSNDCLGGY |
| Ga0247723_100007441 | 3300028025 | Deep Subsurface Sediment | MTYDFFAQEWFGGCGACGTELFAPTKGSYLVQRSLHTHSNSCLGGW |
| Ga0247723_11020363 | 3300028025 | Deep Subsurface Sediment | MTYDFFGQEWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW |
| Ga0304729_100034548 | 3300028392 | Freshwater Lake | MKYDFFGGEWFGKCNACNTELFAPTKGAYDVQRQLHTHSEECLGGW |
| Ga0334997_0174871_1288_1419 | 3300034280 | Freshwater | DFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY |
| ⦗Top⦘ |