NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F078384

Metagenome Family F078384

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078384
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 47 residues
Representative Sequence MTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCLGGW
Number of Associated Samples 88
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 71.55 %
% of genes near scaffold ends (potentially truncated) 20.69 %
% of genes from short scaffolds (< 2000 bps) 50.00 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (53.448 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(38.793 % of family members)
Environment Ontology (ENVO) Unclassified
(85.345 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(91.379 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.22%    β-sheet: 16.22%    Coil/Unstructured: 67.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF02467Whib 21.55
PF00436SSB 7.76
PF01930Cas_Cas4 7.76
PF13704Glyco_tranf_2_4 6.90
PF13392HNH_3 3.45
PF00166Cpn10 2.59
PF01988VIT1 1.72
PF07659DUF1599 1.72
PF08281Sigma70_r4_2 1.72
PF09834DUF2061 1.72
PF00745GlutR_dimer 0.86
PF04973NMN_transporter 0.86
PF09723Zn-ribbon_8 0.86
PF02675AdoMet_dc 0.86
PF00004AAA 0.86
PF13830DUF4192 0.86
PF12804NTP_transf_3 0.86
PF06067DUF932 0.86
PF00271Helicase_C 0.86
PF03237Terminase_6N 0.86
PF00011HSP20 0.86
PF00145DNA_methylase 0.86
PF13439Glyco_transf_4 0.86
PF13362Toprim_3 0.86
PF08401ArdcN 0.86
PF13481AAA_25 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 7.76
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 7.76
COG2965Primosomal replication protein NReplication, recombination and repair [L] 7.76
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 2.59
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 1.72
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 1.72
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.86
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.86
COG0373Glutamyl-tRNA reductaseCoenzyme transport and metabolism [H] 0.86
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.86
COG3201Nicotinamide riboside transporter PnuCCoenzyme transport and metabolism [H] 0.86
COG4227Antirestriction protein ArdCReplication, recombination and repair [L] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.14 %
UnclassifiedrootN/A25.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000162|TB03JUN2009H_c001723Not Available4575Open in IMG/M
3300000176|TB03JUN2009E_c001716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5413Open in IMG/M
3300000176|TB03JUN2009E_c005495Not Available2602Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1008340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5913Open in IMG/M
3300001282|B570J14230_10225635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300001850|RCM37_1153772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300002091|JGI24028J26656_1002079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3897Open in IMG/M
3300002091|JGI24028J26656_1010823All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300002092|JGI24218J26658_1003233All Organisms → Viruses → Predicted Viral3829Open in IMG/M
3300002092|JGI24218J26658_1003939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3297Open in IMG/M
3300002092|JGI24218J26658_1013681All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1248Open in IMG/M
3300002098|JGI24219J26650_1004779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2867Open in IMG/M
3300002098|JGI24219J26650_1013098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1287Open in IMG/M
3300002307|JGI24890J29729_1007016All Organisms → cellular organisms → Bacteria3365Open in IMG/M
3300002408|B570J29032_109137185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300002408|B570J29032_109593928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300003375|JGI26470J50227_1004182All Organisms → Viruses → Predicted Viral4221Open in IMG/M
3300003375|JGI26470J50227_1046620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300003783|Ga0007850_1003550Not Available1446Open in IMG/M
3300003783|Ga0007850_1004863Not Available1196Open in IMG/M
3300003789|Ga0007835_1020556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300003798|Ga0007842_1001702Not Available1875Open in IMG/M
3300003806|Ga0007864_1001758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2380Open in IMG/M
3300003809|Ga0007869_1000090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17858Open in IMG/M
3300003815|Ga0007856_1001328All Organisms → Viruses → Predicted Viral2567Open in IMG/M
3300003820|Ga0007863_1015774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300003820|Ga0007863_1021997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales538Open in IMG/M
3300003823|Ga0007875_1010449All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300004461|Ga0066223_1380623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300004770|Ga0007804_1009571Not Available2885Open in IMG/M
3300004806|Ga0007854_10218626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300004807|Ga0007809_10097937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300005527|Ga0068876_10267366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage977Open in IMG/M
3300005528|Ga0068872_10631108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300005581|Ga0049081_10139910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300005758|Ga0078117_1031612All Organisms → Viruses → Predicted Viral1786Open in IMG/M
3300005805|Ga0079957_1070937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2012Open in IMG/M
3300006071|Ga0007876_1151613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300006103|Ga0007813_1000390Not Available15977Open in IMG/M
3300006103|Ga0007813_1089219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300006108|Ga0007862_1030741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1154Open in IMG/M
3300006108|Ga0007862_1043420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300006112|Ga0007857_1036814All Organisms → cellular organisms → Bacteria → Proteobacteria975Open in IMG/M
3300006116|Ga0007807_1067052Not Available684Open in IMG/M
3300006118|Ga0007859_1016856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1627Open in IMG/M
3300006118|Ga0007859_1080347All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300006128|Ga0007828_1064711All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300006805|Ga0075464_10104173All Organisms → Viruses → Predicted Viral1633Open in IMG/M
3300007169|Ga0102976_1002604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage40016Open in IMG/M
3300007171|Ga0102977_1004593All Organisms → Viruses → Predicted Viral2246Open in IMG/M
3300007212|Ga0103958_1224395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1427Open in IMG/M
3300008108|Ga0114341_10039946All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3550Open in IMG/M
3300009154|Ga0114963_10020124All Organisms → Viruses → Predicted Viral4452Open in IMG/M
3300009154|Ga0114963_10140868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1439Open in IMG/M
3300009159|Ga0114978_10025667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4266Open in IMG/M
3300009159|Ga0114978_10054302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2749Open in IMG/M
3300009183|Ga0114974_10031608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3655Open in IMG/M
3300009470|Ga0126447_1013067All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2102Open in IMG/M
3300013004|Ga0164293_10268209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1197Open in IMG/M
3300013005|Ga0164292_10165165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1606Open in IMG/M
3300013093|Ga0164296_1004368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12872Open in IMG/M
3300013094|Ga0164297_10043479All Organisms → Viruses → Predicted Viral2286Open in IMG/M
3300014962|Ga0134315_1006361All Organisms → Viruses → Predicted Viral1957Open in IMG/M
3300020159|Ga0211734_10414692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2955Open in IMG/M
3300020159|Ga0211734_11219149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2870Open in IMG/M
3300020541|Ga0208359_1023223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300020563|Ga0208082_1076715Not Available530Open in IMG/M
3300020712|Ga0214255_1000864Not Available6435Open in IMG/M
3300020718|Ga0214178_1000763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8656Open in IMG/M
3300020727|Ga0214246_1005407Not Available2602Open in IMG/M
3300020727|Ga0214246_1011332Not Available1630Open in IMG/M
3300020729|Ga0214251_1019666Not Available1206Open in IMG/M
3300020729|Ga0214251_1029952Not Available906Open in IMG/M
3300021115|Ga0214174_100118Not Available10169Open in IMG/M
3300021131|Ga0214206_1001801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4798Open in IMG/M
3300021134|Ga0214171_1001427Not Available6789Open in IMG/M
3300021139|Ga0214166_1000570Not Available18080Open in IMG/M
3300021139|Ga0214166_1015145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2048Open in IMG/M
3300021963|Ga0222712_10679105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300022591|Ga0236341_1004546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6154Open in IMG/M
3300022591|Ga0236341_1017244Not Available2304Open in IMG/M
3300022591|Ga0236341_1019351Not Available2118Open in IMG/M
3300022591|Ga0236341_1038575Not Available1293Open in IMG/M
3300022594|Ga0236340_1008772Not Available3311Open in IMG/M
3300022602|Ga0248169_100252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage89059Open in IMG/M
3300022602|Ga0248169_112140Not Available6402Open in IMG/M
3300022602|Ga0248169_140386All Organisms → Viruses → Predicted Viral2269Open in IMG/M
3300023174|Ga0214921_10024540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6214Open in IMG/M
3300023311|Ga0256681_12073790All Organisms → Viruses → Predicted Viral1294Open in IMG/M
3300025316|Ga0209697_10387411Not Available683Open in IMG/M
3300025357|Ga0208383_1001340All Organisms → Viruses → Predicted Viral3948Open in IMG/M
3300025357|Ga0208383_1001381Not Available3887Open in IMG/M
3300025358|Ga0208504_1004401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2287Open in IMG/M
3300025369|Ga0208382_1038243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300025381|Ga0208871_1002833Not Available3752Open in IMG/M
3300025382|Ga0208256_1045042All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300025383|Ga0208250_1004601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2941Open in IMG/M
3300025389|Ga0208257_1002056Not Available4482Open in IMG/M
3300025389|Ga0208257_1003258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3329Open in IMG/M
3300025389|Ga0208257_1006556Not Available2102Open in IMG/M
3300025389|Ga0208257_1010331Not Available1568Open in IMG/M
3300025390|Ga0208743_1000597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9361Open in IMG/M
3300025400|Ga0208387_1064724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300025402|Ga0208876_1000888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7904Open in IMG/M
3300025426|Ga0208739_1009090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1952Open in IMG/M
3300025430|Ga0208622_1021901All Organisms → Viruses → Predicted Viral1312Open in IMG/M
3300025467|Ga0208260_1006371Not Available2807Open in IMG/M
3300025778|Ga0208388_1057443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300025785|Ga0208498_1014453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1454Open in IMG/M
3300025896|Ga0208916_10034478All Organisms → Viruses → Predicted Viral2044Open in IMG/M
3300027708|Ga0209188_1046002All Organisms → Viruses → Predicted Viral1967Open in IMG/M
3300027734|Ga0209087_1295982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300028025|Ga0247723_1000074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes58778Open in IMG/M
3300028025|Ga0247723_1102036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300028392|Ga0304729_1000345Not Available34560Open in IMG/M
3300034280|Ga0334997_0174871All Organisms → cellular organisms → Bacteria1420Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater38.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater10.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.76%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic6.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater5.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.72%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.72%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.72%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.86%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.86%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.86%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.86%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.86%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.86%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000162Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300000176Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002307Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003783Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08EnvironmentalOpen in IMG/M
3300003789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08EnvironmentalOpen in IMG/M
3300003798Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07EnvironmentalOpen in IMG/M
3300003806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07EnvironmentalOpen in IMG/M
3300003809Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09EnvironmentalOpen in IMG/M
3300003815Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07EnvironmentalOpen in IMG/M
3300003820Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07EnvironmentalOpen in IMG/M
3300003823Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006116Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020541Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020563Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020712Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300020718Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnionEnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300020729Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnionEnvironmentalOpen in IMG/M
3300021115Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021134Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021139Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022591Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2EnvironmentalOpen in IMG/M
3300022594Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1EnvironmentalOpen in IMG/M
3300022602Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnionEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025316Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025358Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025382Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025383Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025390Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025402Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025430Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025467Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025778Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB03JUN2009H_00172373300000162FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY*
TB03JUN2009E_001716193300000176FreshwaterMTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCLGGW*
TB03JUN2009E_00549543300000176FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLHQYSIHTHSNDCLGGY*
TBL_comb48_EPIDRAFT_1008340123300000439FreshwaterMTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSDKCLGGY*
B570J14230_1022563523300001282FreshwaterMTYDFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY*
RCM37_115377223300001850Marine PlanktonMVKYDFFGQEWFGKCGACKKDMYAPTKGEYLVSFALHTHSEECLGGW*
JGI24028J26656_1002079103300002091LenticMKYDFFGQEWFGKCGACSSELYAPTKGEYLVQFSMHTHSDSCLGGY*
JGI24028J26656_101082333300002091LenticMTYDFFAGEWSGKCGACKQEMYAPTKGEYLVAFALHTHSKNCLGGW*
JGI24218J26658_100323323300002092LenticMNKLVKIMSYNFFEGEWAGNCGACLKDLYAPTKGEYLLNYTIHTHSDDCLGGY*
JGI24218J26658_100393943300002092LenticMTYDFYGREWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY*
JGI24218J26658_101368113300002092LenticSNAGVVMTYDFYAQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY*
JGI24219J26650_100477963300002098LenticMTYDFYGQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY*
JGI24219J26650_101309823300002098LenticMTYDFYAQEWYGKCGACRTELFAPTKGAYLVQYSIHTHSDNCLGGY*
JGI24890J29729_100701673300002307LenticMKFDFFGGEWFGACGACGTELFAPSKSEYQMLYSRHTHSKECLGGY*
B570J29032_10913718513300002408FreshwaterVKYMTYDFYAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY*
B570J29032_10959392823300002408FreshwaterMNPKIKYMTYDFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTH
JGI26470J50227_1004182143300003375FreshwaterMTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY*
JGI26470J50227_104662013300003375FreshwaterHQVTYDYFAQEWFGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGY*
Ga0007850_100355043300003783FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLG
Ga0007850_100486363300003783FreshwaterMTYDYMAGEWFGKCGACDTPLFAPNKSAYILQYSIHTHSDKCLGGW*
Ga0007835_102055613300003789FreshwaterMTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW*
Ga0007842_100170253300003798FreshwaterMTYDFYAKEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY*
Ga0007864_100175833300003806FreshwaterMTYDFFAEEWSGKCGACNTELFAPTKGEYLLQYSIHTHSDKCLGGW*
Ga0007869_100009053300003809FreshwaterMKYMTYGFFAKEWSGECGACGTELFAPTQGAYIVNHSAHTHSNKCLGGY*
Ga0007856_100132833300003815FreshwaterMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW*
Ga0007863_101577423300003820FreshwaterMTYDFMAEEWYGKCGACGTELYAPTKGAYILQYSIHTHSDDCIGGW*
Ga0007863_102199733300003820FreshwaterMTYDFMAQEWYGSCGACGTELFAPTKGAYILQYSIHTHSNDCIG
Ga0007875_101044923300003823FreshwaterMTYDFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW*
Ga0066223_138062313300004461MarineMKYDFFGEEWNGKCGACGTEMYAPTKSEYLMSFSIHTHSNHCLGGY*
Ga0007804_100957123300004770FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLGGY*
Ga0007854_1021862623300004806FreshwaterMTYDFQAGEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY*
Ga0007809_1009793713300004807FreshwaterMTYDFFAEEWSGKCGACNTELFAPTKGAYILQYSIHTHSNDCLGGW
Ga0068876_1026736623300005527Freshwater LakeMTYDFFGGEWFGKCGACDTELYAPTKGEYLLNRSLHTHSSLCLGGW*
Ga0068872_1063110823300005528Freshwater LakeMRYKLMEYDFFAEEWSGQCGACGFWLYAPNKEAYNESRWIHTHSDQCLGGY*
Ga0049081_1013991023300005581Freshwater LenticMRYKLMEYDFFAEEWSGQCGACGFWLYAPNKEAYNVSRWIHTHSDQCLGGY*
Ga0078117_103161233300005758Lake WaterMTYDFFGQEWFGKCGACKTEMYAPTKGEYLVAYALHTHSDKCLGGW*
Ga0079957_107093733300005805LakeMRYMTYDFFAEEWTGECGACGFELFAPTKEAYNESRWIHTHSDQCLGGY*
Ga0007876_115161313300006071FreshwaterTIMTYDFMAQEWYGSCGACGTELFAPSKGEYLLQYSIHTHSNDCIGGW*
Ga0007813_100039093300006103FreshwaterMTYDFFGEEWYGSCGACGTELFAPTKGEYLLQYSIHTHSDDCLGGW*
Ga0007813_108921943300006103FreshwaterPQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW*
Ga0007862_103074153300006108FreshwaterMTYDFFAEEWSGKCGACNTELFAPTKGAYILQYSIHTHSNDCLGGW*
Ga0007862_104342013300006108FreshwaterVTYDYFAQEWFGECGACGTELFAPNKGAYILQYSIHTHSNDCLG
Ga0007857_103681413300006112FreshwaterHPQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW*
Ga0007807_106705223300006116FreshwaterMTYDYMAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW*
Ga0007859_101685643300006118FreshwaterMTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCLGGW*
Ga0007859_108034743300006118FreshwaterDFFGQEWYGACGACGTELFAPTKGEYLLQYSIHTHSQDCLGGW*
Ga0007828_106471133300006128FreshwaterMTYDYTAKEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW*
Ga0075464_1010417323300006805AqueousMTYDFFADEWHGKCGACSTALYAPTKGEYLVAFALHTHSKSCLGGW*
Ga0102976_1002604443300007169Freshwater LakeVKYDFFGQEWHGVCGACKEELYAPSKGAWLVQFNMHTHSSNCLGGW*
Ga0102977_100459353300007171Freshwater LakeMTYDFFGEEWFGKCGACKTEMYAPTKGEYLVAYALHTHSDKCLGGW*
Ga0103958_122439543300007212Freshwater LakeMRYMTYDFFAQEWTGECGACGFELFAPTKAAYNESRWIHTHSDQCLGGY*
Ga0114341_1003994683300008108Freshwater, PlanktonMTYDFFGKEWAGKCGACDTELYAPTKGEYLVNRSLHTHSDKCLGGW*
Ga0114963_10020124143300009154Freshwater LakeMKYDFFGGEWFGKCNACNTELFAPTKGAYDVQRQLHTHSEECLGGW*
Ga0114963_1014086813300009154Freshwater LakeTISRNPRIKFMTYDFFGDEWSGNCGACGLDLYAPTKGEYLMQYSKHTHSKNCLGGY*
Ga0114978_1002566723300009159Freshwater LakeMKYDFFGEEWHGMCKACGTEMYAPTKSEYLMSFSTHTHSNDCLGGY*
Ga0114978_1005430273300009159Freshwater LakeMKYDFFGEEWHGKCGACGNEMYAPTKSEYLMSFSIHTHSNDCLGGY*
Ga0114974_1003160893300009183Freshwater LakeMKYDFFGEEWHGKCGACGTQMYAPTKSEYLMSFNLHTHSENCLGGY*
Ga0126447_101306713300009470Meromictic PondMTYDFYAGEWSGNCGACFTDLFAPTKSEYLLQFSKHTHSDNCLG
Ga0164293_1026820923300013004FreshwaterMTYDFFGQAWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW*
Ga0164292_1016516523300013005FreshwaterMTYDFFGQEWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW*
Ga0164296_1004368293300013093FreshwaterMCQIGWVVAMTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY*
Ga0164297_1004347933300013094FreshwaterMTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW*
Ga0134315_100636153300014962Surface WaterVKYDFFGQEWFGKCGACSKDMYAPTKGEYLVAFALHTHSKDCLGGW*
Ga0211734_1041469273300020159FreshwaterMNPKIKYMTYDFYAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY
Ga0211734_1121914933300020159FreshwaterMTYDFFAKEWYGICGACKTELYAPSKGSYIVQHSIHTHSEKCLGGW
Ga0208359_102322313300020541FreshwaterYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY
Ga0208082_107671533300020563FreshwaterYAGEWSGSCGACGTELFAPTKSEYQLQFSKHTHSDKCLGGY
Ga0214255_100086473300020712FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY
Ga0214178_1000763253300020718FreshwaterMTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCLGGW
Ga0214246_100540743300020727FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLHQYSIHTHSNDCLGGY
Ga0214246_101133213300020727FreshwaterNAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY
Ga0214251_101966613300020729FreshwaterMTYDWHAEEWSGKCGACGVELFAPTKGEYLLQYSIHTHSDKCL
Ga0214251_102995223300020729FreshwaterMKFDFFGGEWFGACGACGAELFAPSKSEYQMLYSRHTHSKECLGGY
Ga0214174_100118193300021115FreshwaterMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGW
Ga0214206_100180183300021131FreshwaterMTYDFFAGEWIGNCGACKHEVFGLTKSHYLLEYSKHTHSKDCLGGW
Ga0214171_1001427143300021134FreshwaterMTYDFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW
Ga0214166_1000570163300021139FreshwaterMTYDYMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW
Ga0214166_101514533300021139FreshwaterMTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSDKCLGGY
Ga0222712_1067910513300021963Estuarine WaterMKYDFFAEEWTGKCGACNTEMYAPTKSEYLMSFNIHTHSKDCLGGY
Ga0236341_100454633300022591FreshwaterMTYDFFAGEWLGNCGACGHEVFGMTKGHYLLEYSKHTHSKDCLGVW
Ga0236341_101724453300022591FreshwaterMTYDFFAQEWFGACGACKTELFAPTKGEYLHNYSVHTHSKDCLGGW
Ga0236341_101935163300022591FreshwaterMIYDFYAEEWYGKCGACNHELFAPSKGEYLLQYSIHTHSQDCLGGW
Ga0236341_103857533300022591FreshwaterMTYDYMAGEWYGKCGACKHELFAPSKGEYLLQYSIHTHSKDCLGGW
Ga0236340_100877253300022594FreshwaterMTYDFFAEEWSGKCGACNTELFAPTKGEYILQYSIHTHSKDCLGGW
Ga0248169_1002521353300022602FreshwaterMCQIGWVVAMTYDFFAQEWSGECGACGTELFAPTKGEYLLQYSIHTHSNDCLGGY
Ga0248169_11214063300022602FreshwaterMTYDYLAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW
Ga0248169_14038633300022602FreshwaterMTYDFMAEEWYGKCGACGTELFAPTKGAYLLQYSIHTHSNDCIGGW
Ga0214921_10024540133300023174FreshwaterMKYDFFGDEWYGKCGACNTELFAPTKGAYTVQRQIHTHSEECLGGW
Ga0256681_1207379013300023311FreshwaterKYDFFEGDWSGNCGACGKDFYAPTKSEYLMQYTKHTKSINCLGGY
Ga0209697_1038741123300025316Freshwater Lake HypolimnionMKFDFFGGEWFGACGACGTELFAPSKSEYQMLYSRHTHSKECLGGY
Ga0208383_100134043300025357FreshwaterMTYDFMAQEWYGSCGACGTELFAPTKGAYILQYSIHTHSNDCIGGW
Ga0208383_100138143300025357FreshwaterMTYDFMAEEWYGKCGACGTELYAPTKGAYILQYSIHTHSDDCIGGW
Ga0208504_100440163300025358FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLLQYSLHTHSDNCLGGY
Ga0208382_103824323300025369FreshwaterMTYDYMAQEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCLGGW
Ga0208871_100283373300025381FreshwaterMTYDFFGEEWYGSCGACGTELFAPTKGEYLLQYSIHTHSDDCLGGW
Ga0208256_104504223300025382FreshwaterMTYNFFEEEWSGNCGACGKDFYAPSKSEYLMQYTRHTKSINCLGGY
Ga0208250_100460193300025383FreshwaterNQFIYQSNAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSLHTHSDNCLGGY
Ga0208257_100205673300025389FreshwaterMTYDFYAKEWYGKCGACRTELYAPTKSAYLLQYSLHTHSDNCLGGY
Ga0208257_1003258113300025389FreshwaterMTYDYTAKEWTGECGACGTELFAPNKGAYILQYSIHTHSNDCIGGW
Ga0208257_100655673300025389FreshwaterMTYDFFAEEWSGKCGACNTELFAPTKGEYLLQYSIHTHSDKCLGGW
Ga0208257_101033123300025389FreshwaterMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNNCLGGW
Ga0208743_100059723300025390FreshwaterMKYMTYGFFAKEWSGECGACGTELFAPTQGAYIVNHSAHTHSNKCLGGY
Ga0208387_106472413300025400FreshwaterPQKGQLMTYDFFGQEWFGECGACGTELFAPTKGEYLLQYSIHTHSNDCIGGW
Ga0208876_100088893300025402FreshwaterMTYDFFAEEWSGKCGACNTELFAPSKGAYLLQYSIHTHSNDCLGGW
Ga0208739_100909063300025426FreshwaterYQSNAGVVMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY
Ga0208622_102190133300025430FreshwaterMTYDYMAEEWYGKCGACGTELFAPTKGAYILQYSIHTHSDDCLGGW
Ga0208260_100637123300025467FreshwaterMTYDFYAKEWYGKCGACRTELYAPTKGAYLVQYSIHTHSDNCLGGY
Ga0208388_105744333300025778FreshwaterDFMAEEWYGKCGACGTELFAPTKSAYLLQYSIHTHSNDCLGGW
Ga0208498_101445333300025785FreshwaterMTYDFYAREWYGKCGACRTELYAPTKGAYLVQYSLHTHSDNCLGGY
Ga0208916_1003447833300025896AqueousMTYDFFADEWHGKCGACSTALYAPTKGEYLVAFALHTHSKSCLGGW
Ga0209188_104600213300027708Freshwater LakeMTYDFFGDEWSGNCGACGLDFYAPTKGEYLMQYSKHTHSKNCLGGY
Ga0209087_129598213300027734Freshwater LakeMKYDFFGEEWHGKCGACGNEMYAPTKSEYLMSFSIHTHSNDCLGGY
Ga0247723_1000074413300028025Deep Subsurface SedimentMTYDFFAQEWFGGCGACGTELFAPTKGSYLVQRSLHTHSNSCLGGW
Ga0247723_110203633300028025Deep Subsurface SedimentMTYDFFGQEWFGGCGACGTELYAPTKGAYLLQRSLHTHSKNCLGGW
Ga0304729_1000345483300028392Freshwater LakeMKYDFFGGEWFGKCNACNTELFAPTKGAYDVQRQLHTHSEECLGGW
Ga0334997_0174871_1288_14193300034280FreshwaterDFYAGEWHGNCGACFTDLFAPTKSEYLMQFSKHTHSDKCLGGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.