| Basic Information | |
|---|---|
| Family ID | F078311 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.98 % |
| % of genes near scaffold ends (potentially truncated) | 50.86 % |
| % of genes from short scaffolds (< 2000 bps) | 56.90 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.552 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.069 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.57% β-sheet: 15.22% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 3.48 |
| PF11154 | DUF2934 | 2.61 |
| PF02321 | OEP | 2.61 |
| PF07676 | PD40 | 2.61 |
| PF04397 | LytTR | 1.74 |
| PF07366 | SnoaL | 1.74 |
| PF13231 | PMT_2 | 1.74 |
| PF03713 | DUF305 | 1.74 |
| PF13460 | NAD_binding_10 | 1.74 |
| PF09907 | HigB_toxin | 1.74 |
| PF00578 | AhpC-TSA | 1.74 |
| PF08281 | Sigma70_r4_2 | 1.74 |
| PF01120 | Alpha_L_fucos | 0.87 |
| PF00561 | Abhydrolase_1 | 0.87 |
| PF00248 | Aldo_ket_red | 0.87 |
| PF00877 | NLPC_P60 | 0.87 |
| PF01833 | TIG | 0.87 |
| PF16640 | Big_3_5 | 0.87 |
| PF13560 | HTH_31 | 0.87 |
| PF00593 | TonB_dep_Rec | 0.87 |
| PF17131 | LolA_like | 0.87 |
| PF10282 | Lactonase | 0.87 |
| PF13683 | rve_3 | 0.87 |
| PF12704 | MacB_PCD | 0.87 |
| PF13505 | OMP_b-brl | 0.87 |
| PF00202 | Aminotran_3 | 0.87 |
| PF12697 | Abhydrolase_6 | 0.87 |
| PF03683 | UPF0175 | 0.87 |
| PF04185 | Phosphoesterase | 0.87 |
| PF01545 | Cation_efflux | 0.87 |
| PF01370 | Epimerase | 0.87 |
| PF01841 | Transglut_core | 0.87 |
| PF12833 | HTH_18 | 0.87 |
| PF08547 | CIA30 | 0.87 |
| PF01546 | Peptidase_M20 | 0.87 |
| PF13191 | AAA_16 | 0.87 |
| PF00106 | adh_short | 0.87 |
| PF03458 | Gly_transporter | 0.87 |
| PF00873 | ACR_tran | 0.87 |
| PF07635 | PSCyt1 | 0.87 |
| PF00196 | GerE | 0.87 |
| PF13432 | TPR_16 | 0.87 |
| PF03551 | PadR | 0.87 |
| PF01979 | Amidohydro_1 | 0.87 |
| PF00903 | Glyoxalase | 0.87 |
| PF00144 | Beta-lactamase | 0.87 |
| PF13646 | HEAT_2 | 0.87 |
| PF01593 | Amino_oxidase | 0.87 |
| PF01402 | RHH_1 | 0.87 |
| PF06296 | RelE | 0.87 |
| PF03544 | TonB_C | 0.87 |
| PF13174 | TPR_6 | 0.87 |
| PF13385 | Laminin_G_3 | 0.87 |
| PF00589 | Phage_integrase | 0.87 |
| PF01850 | PIN | 0.87 |
| PF02272 | DHHA1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 5.22 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 1.74 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.87 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.87 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.87 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.87 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.87 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.87 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.87 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.87 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.87 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.55 % |
| Unclassified | root | N/A | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10040262 | All Organisms → cellular organisms → Bacteria | 3647 | Open in IMG/M |
| 3300001593|JGI12635J15846_10811874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300001661|JGI12053J15887_10171482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000104 | All Organisms → cellular organisms → Bacteria | 24665 | Open in IMG/M |
| 3300002917|JGI25616J43925_10081206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300005167|Ga0066672_10306668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300005176|Ga0066679_10283851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300005180|Ga0066685_10076866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2196 | Open in IMG/M |
| 3300005451|Ga0066681_10047437 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300005542|Ga0070732_10074870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1976 | Open in IMG/M |
| 3300005553|Ga0066695_10815201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005557|Ga0066704_10045832 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300005559|Ga0066700_10598849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300005561|Ga0066699_10019946 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300005568|Ga0066703_10741446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300005569|Ga0066705_10568214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300005575|Ga0066702_10018464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3344 | Open in IMG/M |
| 3300005575|Ga0066702_10309793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300005598|Ga0066706_10415638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300005602|Ga0070762_10041813 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300005921|Ga0070766_10113378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1621 | Open in IMG/M |
| 3300006893|Ga0073928_10544237 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300007258|Ga0099793_10022020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2628 | Open in IMG/M |
| 3300007265|Ga0099794_10048609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2036 | Open in IMG/M |
| 3300007788|Ga0099795_10287664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300009090|Ga0099827_11325988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010337|Ga0134062_10606251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300012189|Ga0137388_10878816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300012198|Ga0137364_10026577 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
| 3300012198|Ga0137364_10341913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300012198|Ga0137364_10540765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300012200|Ga0137382_10057867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2444 | Open in IMG/M |
| 3300012202|Ga0137363_10083804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2382 | Open in IMG/M |
| 3300012202|Ga0137363_10462983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300012202|Ga0137363_10793109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300012202|Ga0137363_11343770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012202|Ga0137363_11552175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300012202|Ga0137363_11801222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012203|Ga0137399_10548558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300012205|Ga0137362_10228332 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300012205|Ga0137362_11483983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012208|Ga0137376_10164339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1913 | Open in IMG/M |
| 3300012211|Ga0137377_10372321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
| 3300012359|Ga0137385_10363376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1238 | Open in IMG/M |
| 3300012361|Ga0137360_10088976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2335 | Open in IMG/M |
| 3300012362|Ga0137361_10007180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7681 | Open in IMG/M |
| 3300012362|Ga0137361_10024967 | All Organisms → cellular organisms → Bacteria | 4628 | Open in IMG/M |
| 3300012363|Ga0137390_11328527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300012582|Ga0137358_10861933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300012918|Ga0137396_10011560 | All Organisms → cellular organisms → Bacteria | 5423 | Open in IMG/M |
| 3300012922|Ga0137394_10197728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1716 | Open in IMG/M |
| 3300015051|Ga0137414_1100318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2389 | Open in IMG/M |
| 3300015241|Ga0137418_10123541 | Not Available | 2306 | Open in IMG/M |
| 3300015241|Ga0137418_10349582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300015359|Ga0134085_10486373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300018468|Ga0066662_11116734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300020199|Ga0179592_10003058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7019 | Open in IMG/M |
| 3300020199|Ga0179592_10005695 | All Organisms → cellular organisms → Bacteria | 5306 | Open in IMG/M |
| 3300020199|Ga0179592_10006914 | All Organisms → cellular organisms → Bacteria | 4853 | Open in IMG/M |
| 3300020199|Ga0179592_10131174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
| 3300020579|Ga0210407_10028474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4153 | Open in IMG/M |
| 3300020579|Ga0210407_10036757 | All Organisms → cellular organisms → Bacteria | 3643 | Open in IMG/M |
| 3300020579|Ga0210407_10051709 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
| 3300020579|Ga0210407_10172392 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300020579|Ga0210407_10843478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300020580|Ga0210403_10004935 | All Organisms → cellular organisms → Bacteria | 11408 | Open in IMG/M |
| 3300020581|Ga0210399_10009947 | All Organisms → cellular organisms → Bacteria | 7435 | Open in IMG/M |
| 3300020583|Ga0210401_10025029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5708 | Open in IMG/M |
| 3300020583|Ga0210401_10184659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1941 | Open in IMG/M |
| 3300020583|Ga0210401_10314907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300021088|Ga0210404_10143558 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300021171|Ga0210405_10000269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 72641 | Open in IMG/M |
| 3300021171|Ga0210405_10003057 | All Organisms → cellular organisms → Bacteria | 16694 | Open in IMG/M |
| 3300021420|Ga0210394_10056823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3411 | Open in IMG/M |
| 3300021433|Ga0210391_11125652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300021474|Ga0210390_10025076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4858 | Open in IMG/M |
| 3300021474|Ga0210390_10553749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300021478|Ga0210402_10023581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5288 | Open in IMG/M |
| 3300021479|Ga0210410_10330498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
| 3300021479|Ga0210410_11691271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300022557|Ga0212123_10486777 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300024330|Ga0137417_1204119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300024330|Ga0137417_1420112 | All Organisms → cellular organisms → Bacteria | 4295 | Open in IMG/M |
| 3300025916|Ga0207663_10095412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1984 | Open in IMG/M |
| 3300026277|Ga0209350_1014273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2509 | Open in IMG/M |
| 3300026314|Ga0209268_1035551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1674 | Open in IMG/M |
| 3300026319|Ga0209647_1000695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30771 | Open in IMG/M |
| 3300026319|Ga0209647_1000695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30771 | Open in IMG/M |
| 3300026335|Ga0209804_1044057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2205 | Open in IMG/M |
| 3300026355|Ga0257149_1044357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300026496|Ga0257157_1025921 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300026527|Ga0209059_1022536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2863 | Open in IMG/M |
| 3300026538|Ga0209056_10071102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2985 | Open in IMG/M |
| 3300026551|Ga0209648_10032426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4552 | Open in IMG/M |
| 3300026551|Ga0209648_10341972 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300026557|Ga0179587_10012663 | All Organisms → cellular organisms → Bacteria | 4403 | Open in IMG/M |
| 3300027635|Ga0209625_1001169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6298 | Open in IMG/M |
| 3300027643|Ga0209076_1124324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300027645|Ga0209117_1031306 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300027663|Ga0208990_1034962 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300027748|Ga0209689_1149716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300027903|Ga0209488_10796698 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300028536|Ga0137415_10303537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
| 3300029636|Ga0222749_10025247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2486 | Open in IMG/M |
| 3300031090|Ga0265760_10033415 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300031231|Ga0170824_111146797 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031708|Ga0310686_113928049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300031754|Ga0307475_10671190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300031754|Ga0307475_10717822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300031754|Ga0307475_11115905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300031823|Ga0307478_10047085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3184 | Open in IMG/M |
| 3300031962|Ga0307479_10140175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2368 | Open in IMG/M |
| 3300032205|Ga0307472_100011829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4421 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.17% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100402625 | 3300001593 | Forest Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVAGTGTARHFIR |
| JGI12635J15846_108118742 | 3300001593 | Forest Soil | MFVLPLLRENNTPGCPIQRVLENDFVVVTGTGIARDFIRILTVEMHGKD |
| JGI12053J15887_101714821 | 3300001661 | Forest Soil | PGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| JGI25614J43888_100001044 | 3300002906 | Grasslands Soil | MFVLPLLRENKNPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| JGI25616J43925_100812062 | 3300002917 | Grasslands Soil | SGRPMFVLPLLRENKTPGCPIQRVLENDFVVVTSTGTARDFIRLLTVELH* |
| Ga0066672_103066683 | 3300005167 | Soil | VLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066679_102838511 | 3300005176 | Soil | PIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066685_100768662 | 3300005180 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTCTARDFIRLLTVELH* |
| Ga0066681_100474373 | 3300005451 | Soil | PLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0070732_100748703 | 3300005542 | Surface Soil | MFGLPLLRENKTPGCPVQRVLENDFAVVTGTGTERDFIRLLTVELH* |
| Ga0066695_108152012 | 3300005553 | Soil | TPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066704_100458321 | 3300005557 | Soil | ENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066700_105988491 | 3300005559 | Soil | LRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066699_100199461 | 3300005561 | Soil | RPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIWLLTVELH* |
| Ga0066703_107414461 | 3300005568 | Soil | RPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0066705_105682143 | 3300005569 | Soil | PLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVALH* |
| Ga0066702_100184644 | 3300005575 | Soil | GLRSGRPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIWLLTVELH* |
| Ga0066702_103097931 | 3300005575 | Soil | KTPGCPIQRVLENYFVVVTGTGTARDFIRLLTAELL* |
| Ga0066706_104156381 | 3300005598 | Soil | LLSGRPIFVLPLLRENKTPGCPIQRVLENNFVVVTGTGTTRDFIRILAVELH* |
| Ga0070762_100418131 | 3300005602 | Soil | MFVLALPRENKTLGCPIQRVLENDFVVVTGTGTARDFARLLTVELC* |
| Ga0070766_101133782 | 3300005921 | Soil | MFVLPLLRENKTPGCPIQRVLENNFVVVTGTASDFIRLLTVELQ* |
| Ga0073928_105442372 | 3300006893 | Iron-Sulfur Acid Spring | MFVTPLLGENEAPGCPIQRALENDFVVVTGTGTARHFIRLLTVELHSEDKEK* |
| Ga0099793_100220201 | 3300007258 | Vadose Zone Soil | MLVLPLLRENKTPGCPIQRVLENEFAVVTGTARDFIRLLTVELH* |
| Ga0099794_100486094 | 3300007265 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDSVVVTGTGPARDFIRLLTVELH* |
| Ga0099795_102876641 | 3300007788 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQSVLENDFVVVTGTGTARDFIPAPQ |
| Ga0099827_113259882 | 3300009090 | Vadose Zone Soil | MDFRPTTLQNGPFSCWIPLLRENETPIQRVLENDSVVVTGTARDFIRLL |
| Ga0134062_106062512 | 3300010337 | Grasslands Soil | SGRPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137391_111544201 | 3300011270 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARD |
| Ga0137388_108788162 | 3300012189 | Vadose Zone Soil | LLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137364_100265771 | 3300012198 | Vadose Zone Soil | LTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137364_103419131 | 3300012198 | Vadose Zone Soil | TPDCPIQRVLENDFVVVTGTGTARDFIRLLTIELH* |
| Ga0137364_105407651 | 3300012198 | Vadose Zone Soil | DGSGMTLTLLSGRPIFVLPLLRENKTPGCPIQRVPENDFVVVTGTARDFIRLLTVELH* |
| Ga0137382_100578671 | 3300012200 | Vadose Zone Soil | MFELPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137363_100838045 | 3300012202 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGSARDFIRLLTVELH* |
| Ga0137363_104629832 | 3300012202 | Vadose Zone Soil | GLPSGRPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137363_107931091 | 3300012202 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELQ* |
| Ga0137363_113437701 | 3300012202 | Vadose Zone Soil | LLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELQ* |
| Ga0137363_115521751 | 3300012202 | Vadose Zone Soil | TPGCPIQTVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137363_118012221 | 3300012202 | Vadose Zone Soil | MFVLPLLRENNTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137399_105485583 | 3300012203 | Vadose Zone Soil | MFVLPLLRENKTPGYPIQRVLENDFVVVTGTSTARDFIRLLTVELQ* |
| Ga0137362_102283321 | 3300012205 | Vadose Zone Soil | KTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137362_114839831 | 3300012205 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENNFVVVTGTGTARDF |
| Ga0137376_101643391 | 3300012208 | Vadose Zone Soil | KTPDCPIQRVLENDFVVVTGTGTARDFIRLLTIELH* |
| Ga0137377_103723211 | 3300012211 | Vadose Zone Soil | GPFSILPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137385_103633761 | 3300012359 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137360_100889761 | 3300012361 | Vadose Zone Soil | GRPMFVLPLLRENKTPGCPIQRVLENDFVVVTGTGSARDFIRLLTVELH* |
| Ga0137361_100071806 | 3300012362 | Vadose Zone Soil | RENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH* |
| Ga0137361_100249674 | 3300012362 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVVTGIGTPARDFLRLLSVELR* |
| Ga0137390_113285271 | 3300012363 | Vadose Zone Soil | MHEYALLRENEAPACPIQRALENDFVVVIGTGKVRDFIRILTVELQ* |
| Ga0137358_108619332 | 3300012582 | Vadose Zone Soil | LRENKIPGCPIRRVLENDFVVVTGTARDFIRLLTVELH* |
| Ga0137396_100115603 | 3300012918 | Vadose Zone Soil | MFVLPLLSENKTPGYPIQRVLENDFVVVTGTGTARDFIRLLTVELQ* |
| Ga0137394_101977282 | 3300012922 | Vadose Zone Soil | FVLPLLRENKTPGCPIQRVLENDFVVVTGTGIARDFIRLLTVELH* |
| Ga0137414_11003183 | 3300015051 | Vadose Zone Soil | NKTPGWLIQRVLENDSVVVTGTARDFIRLLTVELH* |
| Ga0137418_101235413 | 3300015241 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGAGPARDFIRLLTIELHWKDK |
| Ga0137418_103495821 | 3300015241 | Vadose Zone Soil | LLRENKTPGCPIQRVLENDFVVVTGTARDFIRLLTIELH* |
| Ga0134085_104863731 | 3300015359 | Grasslands Soil | SGRPIFVLPLLRENKTPGCPIQRVLENDIVVVTGTGTARDFIRLLTVELH* |
| Ga0066662_111167341 | 3300018468 | Grasslands Soil | GLARRKTPGCPIQRVLENYFVVVTGTGTARDFIRLLTAELL |
| Ga0179592_100030582 | 3300020199 | Vadose Zone Soil | MLVLPLLRENKTPGCPIQRVLENEFAVVTGTARDFIRLLTVELH |
| Ga0179592_100056956 | 3300020199 | Vadose Zone Soil | MFVLPLLRENKTPGYPIQRVLENDFVVVTGTSTARDFIRLLTVELQ |
| Ga0179592_100069145 | 3300020199 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0179592_101311743 | 3300020199 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGIARDFIRLLTVELH |
| Ga0210407_100284743 | 3300020579 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRFLTVELH |
| Ga0210407_100367572 | 3300020579 | Soil | MFVLPLLRENKIPGCPIQRVLENHFVVVTGTARDFIRLLTVELH |
| Ga0210407_100517091 | 3300020579 | Soil | MFVLPLLRENKTPGCPIQRVLENNFVVVTGTGAARDFIRLLTVELH |
| Ga0210407_101723923 | 3300020579 | Soil | MFVLALPRENKTLGCPIQRVLENDFVVVTGTGTARDFTWLLTVELC |
| Ga0210407_108434782 | 3300020579 | Soil | NKVLGCPIQRVLENDFVVVTGTAGDFIRLLTVELHGKQ |
| Ga0210403_1000493510 | 3300020580 | Soil | MFVLALPRENKTLGCPIQRVLENDFVVVTGTGTARDFTRLLTVELC |
| Ga0210399_100099477 | 3300020581 | Soil | MFVLALPPENKTLGCPIQRVLENDFVVVTGTGTARDFTRLLTVELC |
| Ga0210401_100250293 | 3300020583 | Soil | MFVLPLLRENKTPGCPIQRVLENNFVVVTGTASDFIRLLTVELQ |
| Ga0210401_101846594 | 3300020583 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGIGTARDFIRLRTVELH |
| Ga0210401_103149071 | 3300020583 | Soil | MFVLTLLRENKTPGCPIQTVLENDFVVVTGTGTARDFIRLLTIELH |
| Ga0210404_101435581 | 3300021088 | Soil | MFGLPLLRENKTPGCPIQRVLKNDFVVVTGTGTARDFIRLLTVELH |
| Ga0210405_1000026960 | 3300021171 | Soil | MKQSVDALSSDRLPLLRENKTPGCPIQRVLENDFVVVTGTARDFIRLLTVELH |
| Ga0210405_1000305712 | 3300021171 | Soil | MFVLPLRRENKTPGCPIQRVLENDFVVVTSTGTARDFVRLLTVELH |
| Ga0210394_100568232 | 3300021420 | Soil | MFVLPLLREKKTPGCPIQRVLENDFVVVTGTGTARDFIRLPTVELL |
| Ga0210391_111256522 | 3300021433 | Soil | ASGRPMFVLPLLRENKTPGCPIQRVLENDFVVVTGIGTARDFIRLRTVELH |
| Ga0210390_100250765 | 3300021474 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVLTSTGTARDFIQPLTVELH |
| Ga0210390_105537491 | 3300021474 | Soil | SGRPMFVLPLLRENKTPGCPIQRVLENDFVVVTGIGTARDFIRLRTVELH |
| Ga0210402_100235812 | 3300021478 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIQPLTLELH |
| Ga0210410_103304982 | 3300021479 | Soil | MFVLPLLRENKTPGCPDQRVLENDFVVVTGTCTARDFIRLLTVELQWKDKEKT |
| Ga0210410_116912711 | 3300021479 | Soil | RENKTPGCPIQRALENDFVVVTGTGTARDFIRLLTVELH |
| Ga0212123_104867772 | 3300022557 | Iron-Sulfur Acid Spring | MFVTPLLGENEAPGCPIQRALENDFVVVTGTGTARHFIRLLTVELHSEDKEK |
| Ga0137417_12041191 | 3300024330 | Vadose Zone Soil | LRVVQFRGKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0137417_12730631 | 3300024330 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQTVLENDFVVVTGTGTTRH |
| Ga0137417_142011210 | 3300024330 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTSTARDFIRLLTVELQ |
| Ga0207663_100954121 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SGVVAHVRTPLLRGNKTPGCPIQRVFQNDFVVVTGTGTARDFIRLLTVELH |
| Ga0209350_10142733 | 3300026277 | Grasslands Soil | RPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTSTARDFIRLLTVELH |
| Ga0209268_10355513 | 3300026314 | Soil | PIFVLPLLRENKTPGCPIQRVLQNDFVVVTGTGTARDFIRNLTAELH |
| Ga0209647_10006951 | 3300026319 | Grasslands Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTSTGTARDFIRLLTVELH |
| Ga0209647_100069517 | 3300026319 | Grasslands Soil | MFVLPLLRENKNPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0209804_10440571 | 3300026335 | Soil | NKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0257149_10443571 | 3300026355 | Soil | RSGRPIFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0257157_10259211 | 3300026496 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVE |
| Ga0257158_11258332 | 3300026515 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTAR |
| Ga0209059_10225361 | 3300026527 | Soil | TPGCPIQRVLENDFVVVTGTGTARDFIWLLTVELH |
| Ga0209056_100711021 | 3300026538 | Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTCTARDFIRLLTVELH |
| Ga0209648_100324264 | 3300026551 | Grasslands Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRVLTVELH |
| Ga0209648_103419721 | 3300026551 | Grasslands Soil | LRENKAPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELH |
| Ga0179587_100126633 | 3300026557 | Vadose Zone Soil | MFVLPLLSENKTPGYPIQRVLENDFVVVTGTGTARDFIRLLTVELQ |
| Ga0209625_10011694 | 3300027635 | Forest Soil | MIVRHWAPEWEAHVRTPLLRESKTAGSPIQRVLENDFVVVTGTVAARDFILLLTVELH |
| Ga0209076_11243242 | 3300027643 | Vadose Zone Soil | VIAGVPMFVLPLLRENKTPGYPIQRVLENDFVVVTGTSTARDFIRLLTVELQ |
| Ga0209117_10313062 | 3300027645 | Forest Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVAGTGTARHFIRLLTVELH |
| Ga0208990_10349621 | 3300027663 | Forest Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLL |
| Ga0209689_11497163 | 3300027748 | Soil | SGRPIFVLPLLRENKTPGCPIQRVLENDFVVVTGT |
| Ga0209488_107966981 | 3300027903 | Vadose Zone Soil | NKTPGCPIQRVLENDFVVVTGTGTARDFIRLLTVELQ |
| Ga0137415_103035371 | 3300028536 | Vadose Zone Soil | MFVLPLLRENKTPGCPIQRVLENDFVVVTGTGTARDFIRLLT |
| Ga0222749_100252471 | 3300029636 | Soil | MFVLPLLRENKTPGCPIQRVLENEFVVVTGTGTARDFIRLLTV |
| Ga0265760_100334151 | 3300031090 | Soil | MFVFPLLRENKTPGCPIQRVLENDLVVVTGTGTARDFIRLLTVELH |
| Ga0170824_1111467971 | 3300031231 | Forest Soil | MPFRELTTNSRPVAATPLLRENKTPGCPIQRVLENDFVVVTGTGAARDFIRLLAVEL |
| Ga0310686_1139280492 | 3300031708 | Soil | MFVLPLLRENKTPGCPIQRVLENEFVVVTGTGTARDFIRLLTVELH |
| Ga0307475_106711901 | 3300031754 | Hardwood Forest Soil | VRTPLLRENKTPGCPIQRVLENDFVVVTGTGTALDFMRLLTVEPH |
| Ga0307475_107178221 | 3300031754 | Hardwood Forest Soil | MFVLPLLRKKKTPGCPIQRVLENDFVVVTGTGTALDFIRLLTVELH |
| Ga0307475_111159051 | 3300031754 | Hardwood Forest Soil | MFVLPLLRKNKTPGCPIQRVLENDFVVVTGTGTARHFIRLLTCRT |
| Ga0307478_100470852 | 3300031823 | Hardwood Forest Soil | MFGLPLLRENKTPGCPVQRVLEHDFVVVTGTGTARDSIRLLTVELHWKGKEKTG |
| Ga0307479_101401751 | 3300031962 | Hardwood Forest Soil | MFVLPLLRENKTPGCPIQRVLENNFVVVTGTARDFIRLLSVELH |
| Ga0307472_1000118297 | 3300032205 | Hardwood Forest Soil | MFVLLLLRENETPGCPIQRVLENDFVVVTGTGTARDFIRLLTGELH |
| ⦗Top⦘ |