| Basic Information | |
|---|---|
| Family ID | F078307 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.26 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.828 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.724 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.74% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 9.48 |
| PF13649 | Methyltransf_25 | 4.31 |
| PF00239 | Resolvase | 3.45 |
| PF03466 | LysR_substrate | 2.59 |
| PF02224 | Cytidylate_kin | 1.72 |
| PF00536 | SAM_1 | 1.72 |
| PF04828 | GFA | 1.72 |
| PF03061 | 4HBT | 1.72 |
| PF00561 | Abhydrolase_1 | 1.72 |
| PF00296 | Bac_luciferase | 0.86 |
| PF10282 | Lactonase | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF07690 | MFS_1 | 0.86 |
| PF01274 | Malate_synthase | 0.86 |
| PF13378 | MR_MLE_C | 0.86 |
| PF09849 | DUF2076 | 0.86 |
| PF12973 | Cupin_7 | 0.86 |
| PF04143 | Sulf_transp | 0.86 |
| PF00126 | HTH_1 | 0.86 |
| PF10137 | TIR-like | 0.86 |
| PF00067 | p450 | 0.86 |
| PF07681 | DoxX | 0.86 |
| PF01042 | Ribonuc_L-PSP | 0.86 |
| PF01979 | Amidohydro_1 | 0.86 |
| PF13432 | TPR_16 | 0.86 |
| PF08028 | Acyl-CoA_dh_2 | 0.86 |
| PF00106 | adh_short | 0.86 |
| PF03693 | ParD_antitoxin | 0.86 |
| PF00072 | Response_reg | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 3.45 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 3.45 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 1.72 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.72 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.86 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.86 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.86 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
| COG2225 | Malate synthase | Energy production and conversion [C] | 0.86 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.86 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.86 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.86 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_103090985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 623 | Open in IMG/M |
| 3300004092|Ga0062389_104554050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300004633|Ga0066395_10927273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 528 | Open in IMG/M |
| 3300005177|Ga0066690_10472422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300005179|Ga0066684_10986403 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005541|Ga0070733_10331013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300005618|Ga0068864_102240560 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005764|Ga0066903_105004399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicola → Lichenicola cladoniae | 703 | Open in IMG/M |
| 3300006031|Ga0066651_10839198 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006057|Ga0075026_100326092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 845 | Open in IMG/M |
| 3300006904|Ga0075424_100760819 | Not Available | 1034 | Open in IMG/M |
| 3300007258|Ga0099793_10268342 | Not Available | 826 | Open in IMG/M |
| 3300009012|Ga0066710_102993028 | Not Available | 658 | Open in IMG/M |
| 3300009090|Ga0099827_11837647 | Not Available | 528 | Open in IMG/M |
| 3300009101|Ga0105247_10807444 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009101|Ga0105247_11730595 | Not Available | 518 | Open in IMG/M |
| 3300009176|Ga0105242_11625405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 680 | Open in IMG/M |
| 3300009826|Ga0123355_11832878 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010048|Ga0126373_10269175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
| 3300010362|Ga0126377_12242724 | Not Available | 622 | Open in IMG/M |
| 3300010371|Ga0134125_10981637 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300010398|Ga0126383_13610963 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012202|Ga0137363_11253785 | Not Available | 629 | Open in IMG/M |
| 3300012349|Ga0137387_10681322 | Not Available | 744 | Open in IMG/M |
| 3300012357|Ga0137384_10997762 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012922|Ga0137394_10681134 | Not Available | 866 | Open in IMG/M |
| 3300012923|Ga0137359_11473440 | Not Available | 569 | Open in IMG/M |
| 3300014654|Ga0181525_10764930 | Not Available | 544 | Open in IMG/M |
| 3300016270|Ga0182036_11088043 | Not Available | 661 | Open in IMG/M |
| 3300016270|Ga0182036_11341421 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300016294|Ga0182041_11180904 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300016319|Ga0182033_11550129 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300016319|Ga0182033_11725809 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300016341|Ga0182035_12030063 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300016371|Ga0182034_10066870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2449 | Open in IMG/M |
| 3300016371|Ga0182034_11865915 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300016387|Ga0182040_10077723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2176 | Open in IMG/M |
| 3300016404|Ga0182037_10063013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2532 | Open in IMG/M |
| 3300016404|Ga0182037_12118153 | Not Available | 506 | Open in IMG/M |
| 3300016422|Ga0182039_11851013 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018007|Ga0187805_10172652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300018047|Ga0187859_10794285 | Not Available | 543 | Open in IMG/M |
| 3300018468|Ga0066662_11706468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300019279|Ga0184642_1264665 | Not Available | 573 | Open in IMG/M |
| 3300020579|Ga0210407_10053552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3017 | Open in IMG/M |
| 3300020579|Ga0210407_10565180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300020583|Ga0210401_10233192 | Not Available | 1699 | Open in IMG/M |
| 3300021088|Ga0210404_10841109 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021170|Ga0210400_11476409 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021178|Ga0210408_10644477 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300021180|Ga0210396_10388484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1228 | Open in IMG/M |
| 3300021372|Ga0213877_10127153 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300021401|Ga0210393_11036093 | Not Available | 664 | Open in IMG/M |
| 3300021403|Ga0210397_10209434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300021405|Ga0210387_10799356 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300021406|Ga0210386_10776193 | Not Available | 824 | Open in IMG/M |
| 3300021420|Ga0210394_11772174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300021475|Ga0210392_10542025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300021478|Ga0210402_10079906 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300021478|Ga0210402_11092167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300021560|Ga0126371_10577794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1273 | Open in IMG/M |
| 3300021560|Ga0126371_10916321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1020 | Open in IMG/M |
| 3300021560|Ga0126371_11603173 | Not Available | 777 | Open in IMG/M |
| 3300021560|Ga0126371_11821143 | Not Available | 730 | Open in IMG/M |
| 3300022504|Ga0242642_1057581 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300025916|Ga0207663_10742270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300027882|Ga0209590_10268893 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300028379|Ga0268266_12031146 | Not Available | 548 | Open in IMG/M |
| 3300031231|Ga0170824_102048957 | Not Available | 2163 | Open in IMG/M |
| 3300031234|Ga0302325_10737858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1407 | Open in IMG/M |
| 3300031236|Ga0302324_103331223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031469|Ga0170819_18056365 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031524|Ga0302320_10054302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7057 | Open in IMG/M |
| 3300031544|Ga0318534_10795709 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031546|Ga0318538_10274667 | Not Available | 907 | Open in IMG/M |
| 3300031561|Ga0318528_10057604 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300031668|Ga0318542_10625807 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031680|Ga0318574_10538383 | Not Available | 684 | Open in IMG/M |
| 3300031719|Ga0306917_10053468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2727 | Open in IMG/M |
| 3300031719|Ga0306917_11317617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300031744|Ga0306918_10154238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1699 | Open in IMG/M |
| 3300031744|Ga0306918_10286144 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300031748|Ga0318492_10415717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300031751|Ga0318494_10574620 | Not Available | 658 | Open in IMG/M |
| 3300031753|Ga0307477_10323939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300031754|Ga0307475_10358903 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300031768|Ga0318509_10534136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300031770|Ga0318521_10209731 | Not Available | 1127 | Open in IMG/M |
| 3300031770|Ga0318521_10258200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300031780|Ga0318508_1151875 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031782|Ga0318552_10191673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1033 | Open in IMG/M |
| 3300031782|Ga0318552_10250210 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300031794|Ga0318503_10108251 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031833|Ga0310917_10009241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5320 | Open in IMG/M |
| 3300031846|Ga0318512_10749127 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031859|Ga0318527_10236265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 776 | Open in IMG/M |
| 3300031860|Ga0318495_10083140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1434 | Open in IMG/M |
| 3300031879|Ga0306919_10410521 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031890|Ga0306925_12075082 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031893|Ga0318536_10090159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1528 | Open in IMG/M |
| 3300031897|Ga0318520_10130410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1440 | Open in IMG/M |
| 3300031910|Ga0306923_11370740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300031912|Ga0306921_10184421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2446 | Open in IMG/M |
| 3300031912|Ga0306921_10390333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1625 | Open in IMG/M |
| 3300031912|Ga0306921_11443497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300031912|Ga0306921_12030321 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031941|Ga0310912_11108625 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031946|Ga0310910_10571755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
| 3300032001|Ga0306922_10865820 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300032001|Ga0306922_11022458 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300032060|Ga0318505_10208106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300032064|Ga0318510_10035342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
| 3300032064|Ga0318510_10132322 | Not Available | 973 | Open in IMG/M |
| 3300032094|Ga0318540_10209864 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300032261|Ga0306920_102821056 | Not Available | 661 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1030909852 | 3300004092 | Bog Forest Soil | VSAANGFVIPAGGGKQIDSPTPGRFFALKLLGRETGESIMMFEETLPAGAV* |
| Ga0062389_1045540501 | 3300004092 | Bog Forest Soil | MSVANGFVIPADGGKRFDSPTPGRSFALKLLGRETDESIMM |
| Ga0066395_109272732 | 3300004633 | Tropical Forest Soil | MSKVQGFVVPAGGGQHLDGLTPGGRFDLKLFGRDTGDSIMLFEEIAPAGRKSLY |
| Ga0066690_104724221 | 3300005177 | Soil | MTVAKGFVVPAGGGKHFASPTPGRSLAMKLLGRETGESIMM |
| Ga0066684_109864032 | 3300005179 | Soil | MIAVKGFVVPAGDGKHFASATPDRFFAMKLLGRETGESIMMFEETLPAGT |
| Ga0070733_103310133 | 3300005541 | Surface Soil | MTAAKGFVIPAGGGKHFDAPTPGRSFALKLLGRETGESIM |
| Ga0068864_1022405601 | 3300005618 | Switchgrass Rhizosphere | MTKGIVVPAGGGKRYQETPGRFFDLKLLTDQTGQSIMLFEETVPAGT |
| Ga0066903_1050043991 | 3300005764 | Tropical Forest Soil | MSTAEGFVVPAGGGKHFNSPTPGRSFTMKLLGRETNESIMMFEESLP |
| Ga0066651_108391982 | 3300006031 | Soil | MIAAKGFVVPAGDGKHFASATPGRFFAMKLLGRETGESIMMFEET |
| Ga0075026_1003260922 | 3300006057 | Watersheds | MTATKGFIIPPGGGKHLDSPTPGRFFDLKLLGRDTGESIMMFEETLP |
| Ga0075424_1007608191 | 3300006904 | Populus Rhizosphere | MSAAQGFVVPADGGKRFDSPTPGRSFALKLLGRETN |
| Ga0099793_102683423 | 3300007258 | Vadose Zone Soil | MTATKGFVVPAGGGKRLDSPTQGRFFSLKLLGHETDQSIMMFE |
| Ga0066710_1029930282 | 3300009012 | Grasslands Soil | MSAAEGFVIPAGGGKRFDSPTPGRSFAVKLLGRET |
| Ga0099827_118376471 | 3300009090 | Vadose Zone Soil | MTAAKGFVVPAGGGKRFDSPTPGRFFALKLLGRETNESIMMFEETLP |
| Ga0105247_108074441 | 3300009101 | Switchgrass Rhizosphere | MSIEGFVVPAGAGRHFNSPTPGRSFAMKLLGHETNESIMMFEETLP |
| Ga0105247_117305952 | 3300009101 | Switchgrass Rhizosphere | MNAAKGFVIPAGGGKHIDSPTPGRSFHLKLLGRETNESI |
| Ga0105242_116254052 | 3300009176 | Miscanthus Rhizosphere | MSTAEGFVVPPGGGKHFTSPTPGRSFAMKLLGRETNESIMMFEE |
| Ga0123355_118328781 | 3300009826 | Termite Gut | MEVAMNETKGFVVPAGGGKRHASATPGRFFDLKLLGCETAD |
| Ga0126373_102691754 | 3300010048 | Tropical Forest Soil | MTATRGFVVPAGGGKRLDSPTPGRSFSLKLLGHETDE |
| Ga0126377_122427241 | 3300010362 | Tropical Forest Soil | MTAKGFVVPPGGGKHHASPAPGRFFDLKLLAAQTGDSIMLFEETLPAGTASLY |
| Ga0134125_109816371 | 3300010371 | Terrestrial Soil | MTTAAKGFVVPAGGGKHFPSPTPGRSFAMKLLGRETGESVMMFEETL |
| Ga0126383_136109631 | 3300010398 | Tropical Forest Soil | VVPAGCGKHFNSPTPGRFFALKLLGRETGESIMMFEETLPAGT |
| Ga0137363_112537851 | 3300012202 | Vadose Zone Soil | MTATKGFVVPAGGGKHFDSPTPDRSFALKLLGRETDESIMMFEET |
| Ga0137387_106813222 | 3300012349 | Vadose Zone Soil | MTAAKGFVVPSGGGKHLDSPTPGRSFAMKLLGRETGESIMLFEETLPA |
| Ga0137384_109977622 | 3300012357 | Vadose Zone Soil | MTATKGFVVPAGGGKHHEMTSPGRSASLKLLGHETTESIM |
| Ga0137394_106811343 | 3300012922 | Vadose Zone Soil | MTATKGFVVPAGGGKRLDSPTQGRFFSLKLLGHETDQSIMLF |
| Ga0137359_114734401 | 3300012923 | Vadose Zone Soil | MTATKGFVVPAGGGKHFDSPTPDRSFALKLLGRETDESIM |
| Ga0181525_107649301 | 3300014654 | Bog | MSAVKGFVVPADGGTHLASPTPGRWFDLKLLGRETGESIIMFE |
| Ga0182036_110880431 | 3300016270 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTRSL |
| Ga0182036_113414211 | 3300016270 | Soil | MTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFE |
| Ga0182041_111809042 | 3300016294 | Soil | MTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIMLFEETL |
| Ga0182033_115501291 | 3300016319 | Soil | MGAAKGFVVPAGGGKHLNSPTPGRSFAMKLLGRETGESIMMFEETLP |
| Ga0182033_117258091 | 3300016319 | Soil | MTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSI |
| Ga0182035_120300631 | 3300016341 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPP |
| Ga0182034_100668703 | 3300016371 | Soil | MTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEE |
| Ga0182034_118659151 | 3300016371 | Soil | MTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETS |
| Ga0182040_100777233 | 3300016387 | Soil | MTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGD |
| Ga0182037_100630131 | 3300016404 | Soil | MTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIM |
| Ga0182037_121181532 | 3300016404 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLP |
| Ga0182039_118510131 | 3300016422 | Soil | MTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIM |
| Ga0187805_101726521 | 3300018007 | Freshwater Sediment | MTAARGFVVAAGGGKHFNSPTPGRHFALKLLGRETNESIML |
| Ga0187859_107942851 | 3300018047 | Peatland | MSTAEGFVIPPGGGKHFKSPTPGRSFALKLLGRETN |
| Ga0066662_117064681 | 3300018468 | Grasslands Soil | MTVAKGFVVPAGGGKHFASPTPGRSFAMKLLGRETGESI |
| Ga0184642_12646652 | 3300019279 | Groundwater Sediment | MSTTDGSTAEGFVVPAGGGKHISSPTPGRFFDLKLLGRETNESIMMFEET |
| Ga0210407_100535521 | 3300020579 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETD |
| Ga0210407_105651803 | 3300020579 | Soil | MTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNE |
| Ga0210401_102331921 | 3300020583 | Soil | MTGAKGFVVPTGGGKHFASPTPGRSFAMKLLGRETGE |
| Ga0210404_108411091 | 3300021088 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETDDSTIL |
| Ga0210400_114764091 | 3300021170 | Soil | MTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETSESIML |
| Ga0210408_106444772 | 3300021178 | Soil | MSAAEGFVVPAGGGKRFDSPTPGRSFAMKLLGRETNEGIMMF |
| Ga0210396_103884841 | 3300021180 | Soil | MSAAKGFVIPAGGGEHIESPTPGRFFDLKLLGCETDESIMMFEETLPA |
| Ga0213877_101271532 | 3300021372 | Bulk Soil | MTPAKGFVVPAGRGKHFNSPTPGRSFALKLLGRETG |
| Ga0210393_110360931 | 3300021401 | Soil | MTAAKGFIVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML |
| Ga0210397_102094342 | 3300021403 | Soil | MTPAKGFIVPAGGGTHFASATPGRFFDLKLLGRETGQSIMIFEESLPAGTTS |
| Ga0210387_107993561 | 3300021405 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETDDSIILFEETLPPGTRS |
| Ga0210386_107761932 | 3300021406 | Soil | MTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETKESIMLFEE |
| Ga0210394_117721742 | 3300021420 | Soil | MTTAKGFVVPTGGGKRLGSPTPGRFFDLKLLGHETNQ |
| Ga0210392_105420252 | 3300021475 | Soil | MSAAEGFVVPAGGGKRFDSPTPGRSFAMKLLGRETNQ |
| Ga0210402_100799061 | 3300021478 | Soil | MTVAKGFVVPTGGGKHFASPTPGRSFAMKLLGRET |
| Ga0210402_110921672 | 3300021478 | Soil | MTAPKGFVVTPGGGKHFASPTPGRSFALKLLGRETGESIMMFEETLP |
| Ga0126371_105777941 | 3300021560 | Tropical Forest Soil | MTKVKGFVVPAGGGKRLDSPTPGRSFALKLLGHET |
| Ga0126371_109163211 | 3300021560 | Tropical Forest Soil | MTPAKGFVVPTGGGKHFASPTPGRSFAMKLLGRETGESIMMFEETLPAG |
| Ga0126371_116031731 | 3300021560 | Tropical Forest Soil | MDATTGFVVPAGGGRHFSSPTPGRSFYLKLLGRETKESIMMFEE |
| Ga0126371_118211432 | 3300021560 | Tropical Forest Soil | MSAAAGFVVPAGGGRHFDSPTPGRCFAMKVLGCET |
| Ga0242642_10575812 | 3300022504 | Soil | MTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESIMMFEET |
| Ga0207663_107422703 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATKGFVVPAGGGKHFHSPTPGRSFALKLLGRETNESIMLFE |
| Ga0207663_112363451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRILKEDSDMTATKGFVVPPGGGKRLDSPTPGRFFDLKLLGRETGETIMMFEE |
| Ga0209590_102688931 | 3300027882 | Vadose Zone Soil | MTAAKGFVVPAGGGKRFDSPTPGRFFALKLLGRETNESILMFEETLP |
| Ga0268266_120311461 | 3300028379 | Switchgrass Rhizosphere | MTETNGFVIPAGGGKHFDSPTPGRSFALKLLGRDTGD |
| Ga0170824_1020489573 | 3300031231 | Forest Soil | MTATKGFVIPPGGGKRFASPTPGRSFALKLLGRETGESIMMFEETLPA |
| Ga0302325_107378581 | 3300031234 | Palsa | MTPAKGFVVQAGGGKHFDSPTPGRFFDLKLLGHKTNESIMLFEE |
| Ga0302324_1033312231 | 3300031236 | Palsa | MTPAKGFVVQAGGGKHFDSPTPGRFFDLKLLGHKTNE |
| Ga0170819_180563652 | 3300031469 | Forest Soil | MEDTNMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETKESIM |
| Ga0302320_100543028 | 3300031524 | Bog | MSAANGAVVPAGGGTHFASPTPGRSFALKLLGRDTDESIMM |
| Ga0318534_107957092 | 3300031544 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML |
| Ga0318538_102746673 | 3300031546 | Soil | MTAAKGFVVPAGGGKQHASPTPGRFFDLKLFGRETGDSIM |
| Ga0318528_100576041 | 3300031561 | Soil | MTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIMLFEETLPPGTRS |
| Ga0318542_106258071 | 3300031668 | Soil | MGAAKGFVVPAGGGKHFNSPTPGRSFAMKLFGRETGESIMMFE |
| Ga0318574_105383831 | 3300031680 | Soil | MGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGESI |
| Ga0306917_100534681 | 3300031719 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIIL |
| Ga0306917_113176171 | 3300031719 | Soil | MGAAKGFVVPAGGGKHFNSPTPGRSFAKKLLGRETGESI |
| Ga0306918_101542381 | 3300031744 | Soil | MGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGES |
| Ga0306918_102861441 | 3300031744 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETQPLG |
| Ga0318492_104157171 | 3300031748 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFELKLFGRETGDSIM |
| Ga0318494_105746201 | 3300031751 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEET |
| Ga0307477_103239393 | 3300031753 | Hardwood Forest Soil | MTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESIMMFEETLAAGT |
| Ga0307475_103589034 | 3300031754 | Hardwood Forest Soil | MTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESI |
| Ga0318509_105341362 | 3300031768 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLP |
| Ga0318521_102097313 | 3300031770 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGD |
| Ga0318521_102582002 | 3300031770 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSII |
| Ga0318508_11518752 | 3300031780 | Soil | MTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIM |
| Ga0318552_101916732 | 3300031782 | Soil | MTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTRSLYH |
| Ga0318552_102502102 | 3300031782 | Soil | MTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIMLFEETLPPGTRSLYH |
| Ga0318503_101082512 | 3300031794 | Soil | MTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDS |
| Ga0310917_100092411 | 3300031833 | Soil | MTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETL |
| Ga0318512_107491271 | 3300031846 | Soil | MTATTGFVVPTGGGKHFASPTPGRSFAMKLLGRETGESIMMFEETLPAG |
| Ga0318527_102362651 | 3300031859 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIM |
| Ga0318495_100831402 | 3300031860 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIILFEETLPPGTR |
| Ga0306919_104105211 | 3300031879 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFEFKLFGRETGDSIMLFE |
| Ga0306925_120750822 | 3300031890 | Soil | MTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFEETLPPG |
| Ga0318536_100901591 | 3300031893 | Soil | MTATRGFVVPAGGGKRLDSPTPGRSFSLKLLGHETDESIM |
| Ga0318520_101304102 | 3300031897 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRET |
| Ga0306923_113707401 | 3300031910 | Soil | MSTAKGFVIPAGGGKHFDSPAPGRSFALKLLGHETGESIMMFEE |
| Ga0306921_101844211 | 3300031912 | Soil | MTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTR |
| Ga0306921_103903331 | 3300031912 | Soil | MGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGESIMMFEETLP |
| Ga0306921_114434971 | 3300031912 | Soil | MSTAKGFVIPAGGGKHFDSPAPGRSFALKLLGPETGESIM |
| Ga0306921_120303212 | 3300031912 | Soil | MTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIMLF |
| Ga0310912_111086251 | 3300031941 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPLGTRS |
| Ga0310910_105717551 | 3300031946 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPG |
| Ga0306922_108658201 | 3300032001 | Soil | MTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETSESIMM |
| Ga0306922_110224582 | 3300032001 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFELKLFGRETRDSIML |
| Ga0318505_102081061 | 3300032060 | Soil | MTAAKGFVAPAGGGKHHASPTPGRLFDLKLFGRETGDSIMLFE |
| Ga0318510_100353421 | 3300032064 | Soil | MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIILFEET |
| Ga0318510_101323223 | 3300032064 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPLGTRSLYH |
| Ga0318540_102098642 | 3300032094 | Soil | MTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETL |
| Ga0306920_1028210562 | 3300032261 | Soil | MTASKGFVIPAGGGKRFESDTPGRFFDLTLLCDQTGQSIMMFEETL |
| ⦗Top⦘ |