NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078307

Metagenome / Metatranscriptome Family F078307

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078307
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 43 residues
Representative Sequence MTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML
Number of Associated Samples 95
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.26 %
% of genes near scaffold ends (potentially truncated) 98.28 %
% of genes from short scaffolds (< 2000 bps) 90.52 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.207 % of family members)
Environment Ontology (ENVO) Unclassified
(44.828 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.724 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.74%    Coil/Unstructured: 78.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00903Glyoxalase 9.48
PF13649Methyltransf_25 4.31
PF00239Resolvase 3.45
PF03466LysR_substrate 2.59
PF02224Cytidylate_kin 1.72
PF00536SAM_1 1.72
PF04828GFA 1.72
PF030614HBT 1.72
PF00561Abhydrolase_1 1.72
PF00296Bac_luciferase 0.86
PF10282Lactonase 0.86
PF07883Cupin_2 0.86
PF07690MFS_1 0.86
PF01274Malate_synthase 0.86
PF13378MR_MLE_C 0.86
PF09849DUF2076 0.86
PF12973Cupin_7 0.86
PF04143Sulf_transp 0.86
PF00126HTH_1 0.86
PF10137TIR-like 0.86
PF00067p450 0.86
PF07681DoxX 0.86
PF01042Ribonuc_L-PSP 0.86
PF01979Amidohydro_1 0.86
PF13432TPR_16 0.86
PF08028Acyl-CoA_dh_2 0.86
PF00106adh_short 0.86
PF03693ParD_antitoxin 0.86
PF00072Response_reg 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 3.45
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 3.45
COG0283Cytidylate kinaseNucleotide transport and metabolism [F] 1.72
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.72
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.86
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.86
COG2124Cytochrome P450Defense mechanisms [V] 0.86
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.86
COG2225Malate synthaseEnergy production and conversion [C] 0.86
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.86
COG2391Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domainsGeneral function prediction only [R] 0.86
COG3609Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domainTranscription [K] 0.86
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_103090985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae623Open in IMG/M
3300004092|Ga0062389_104554050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300004633|Ga0066395_10927273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales528Open in IMG/M
3300005177|Ga0066690_10472422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300005179|Ga0066684_10986403All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005541|Ga0070733_10331013All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300005618|Ga0068864_102240560All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005764|Ga0066903_105004399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicola → Lichenicola cladoniae703Open in IMG/M
3300006031|Ga0066651_10839198All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006057|Ga0075026_100326092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales845Open in IMG/M
3300006904|Ga0075424_100760819Not Available1034Open in IMG/M
3300007258|Ga0099793_10268342Not Available826Open in IMG/M
3300009012|Ga0066710_102993028Not Available658Open in IMG/M
3300009090|Ga0099827_11837647Not Available528Open in IMG/M
3300009101|Ga0105247_10807444All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300009101|Ga0105247_11730595Not Available518Open in IMG/M
3300009176|Ga0105242_11625405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103680Open in IMG/M
3300009826|Ga0123355_11832878All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300010048|Ga0126373_10269175All Organisms → cellular organisms → Bacteria → Proteobacteria1685Open in IMG/M
3300010362|Ga0126377_12242724Not Available622Open in IMG/M
3300010371|Ga0134125_10981637All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300010398|Ga0126383_13610963All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012202|Ga0137363_11253785Not Available629Open in IMG/M
3300012349|Ga0137387_10681322Not Available744Open in IMG/M
3300012357|Ga0137384_10997762All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012922|Ga0137394_10681134Not Available866Open in IMG/M
3300012923|Ga0137359_11473440Not Available569Open in IMG/M
3300014654|Ga0181525_10764930Not Available544Open in IMG/M
3300016270|Ga0182036_11088043Not Available661Open in IMG/M
3300016270|Ga0182036_11341421All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300016294|Ga0182041_11180904All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300016319|Ga0182033_11550129All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300016319|Ga0182033_11725809All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300016341|Ga0182035_12030063All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300016371|Ga0182034_10066870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2449Open in IMG/M
3300016371|Ga0182034_11865915All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300016387|Ga0182040_10077723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2176Open in IMG/M
3300016404|Ga0182037_10063013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2532Open in IMG/M
3300016404|Ga0182037_12118153Not Available506Open in IMG/M
3300016422|Ga0182039_11851013All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018007|Ga0187805_10172652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria985Open in IMG/M
3300018047|Ga0187859_10794285Not Available543Open in IMG/M
3300018468|Ga0066662_11706468All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300019279|Ga0184642_1264665Not Available573Open in IMG/M
3300020579|Ga0210407_10053552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3017Open in IMG/M
3300020579|Ga0210407_10565180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300020583|Ga0210401_10233192Not Available1699Open in IMG/M
3300021088|Ga0210404_10841109All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300021170|Ga0210400_11476409All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300021178|Ga0210408_10644477All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300021180|Ga0210396_10388484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1228Open in IMG/M
3300021372|Ga0213877_10127153All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300021401|Ga0210393_11036093Not Available664Open in IMG/M
3300021403|Ga0210397_10209434All Organisms → cellular organisms → Bacteria → Proteobacteria1397Open in IMG/M
3300021405|Ga0210387_10799356All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300021406|Ga0210386_10776193Not Available824Open in IMG/M
3300021420|Ga0210394_11772174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium515Open in IMG/M
3300021475|Ga0210392_10542025All Organisms → cellular organisms → Bacteria → Proteobacteria860Open in IMG/M
3300021478|Ga0210402_10079906All Organisms → cellular organisms → Bacteria2907Open in IMG/M
3300021478|Ga0210402_11092167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300021560|Ga0126371_10577794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1273Open in IMG/M
3300021560|Ga0126371_10916321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1020Open in IMG/M
3300021560|Ga0126371_11603173Not Available777Open in IMG/M
3300021560|Ga0126371_11821143Not Available730Open in IMG/M
3300022504|Ga0242642_1057581All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300025916|Ga0207663_10742270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300027882|Ga0209590_10268893All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300028379|Ga0268266_12031146Not Available548Open in IMG/M
3300031231|Ga0170824_102048957Not Available2163Open in IMG/M
3300031234|Ga0302325_10737858All Organisms → cellular organisms → Bacteria → Proteobacteria1407Open in IMG/M
3300031236|Ga0302324_103331223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300031469|Ga0170819_18056365All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031524|Ga0302320_10054302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales7057Open in IMG/M
3300031544|Ga0318534_10795709All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031546|Ga0318538_10274667Not Available907Open in IMG/M
3300031561|Ga0318528_10057604All Organisms → cellular organisms → Bacteria1977Open in IMG/M
3300031668|Ga0318542_10625807All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031680|Ga0318574_10538383Not Available684Open in IMG/M
3300031719|Ga0306917_10053468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2727Open in IMG/M
3300031719|Ga0306917_11317617All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300031744|Ga0306918_10154238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1699Open in IMG/M
3300031744|Ga0306918_10286144All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300031748|Ga0318492_10415717All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300031751|Ga0318494_10574620Not Available658Open in IMG/M
3300031753|Ga0307477_10323939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1062Open in IMG/M
3300031754|Ga0307475_10358903All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300031768|Ga0318509_10534136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300031770|Ga0318521_10209731Not Available1127Open in IMG/M
3300031770|Ga0318521_10258200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1018Open in IMG/M
3300031780|Ga0318508_1151875All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031782|Ga0318552_10191673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1033Open in IMG/M
3300031782|Ga0318552_10250210All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300031794|Ga0318503_10108251All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300031833|Ga0310917_10009241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae5320Open in IMG/M
3300031846|Ga0318512_10749127All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031859|Ga0318527_10236265All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes776Open in IMG/M
3300031860|Ga0318495_10083140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1434Open in IMG/M
3300031879|Ga0306919_10410521All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300031890|Ga0306925_12075082All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031893|Ga0318536_10090159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1528Open in IMG/M
3300031897|Ga0318520_10130410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1440Open in IMG/M
3300031910|Ga0306923_11370740All Organisms → cellular organisms → Bacteria → Proteobacteria746Open in IMG/M
3300031912|Ga0306921_10184421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2446Open in IMG/M
3300031912|Ga0306921_10390333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1625Open in IMG/M
3300031912|Ga0306921_11443497All Organisms → cellular organisms → Bacteria → Proteobacteria755Open in IMG/M
3300031912|Ga0306921_12030321All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031941|Ga0310912_11108625All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300031946|Ga0310910_10571755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria896Open in IMG/M
3300032001|Ga0306922_10865820All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300032001|Ga0306922_11022458All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300032060|Ga0318505_10208106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria916Open in IMG/M
3300032064|Ga0318510_10035342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1699Open in IMG/M
3300032064|Ga0318510_10132322Not Available973Open in IMG/M
3300032094|Ga0318540_10209864All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300032261|Ga0306920_102821056Not Available661Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.59%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.72%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.86%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.86%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10309098523300004092Bog Forest SoilVSAANGFVIPAGGGKQIDSPTPGRFFALKLLGRETGESIMMFEETLPAGAV*
Ga0062389_10455405013300004092Bog Forest SoilMSVANGFVIPADGGKRFDSPTPGRSFALKLLGRETDESIMM
Ga0066395_1092727323300004633Tropical Forest SoilMSKVQGFVVPAGGGQHLDGLTPGGRFDLKLFGRDTGDSIMLFEEIAPAGRKSLY
Ga0066690_1047242213300005177SoilMTVAKGFVVPAGGGKHFASPTPGRSLAMKLLGRETGESIMM
Ga0066684_1098640323300005179SoilMIAVKGFVVPAGDGKHFASATPDRFFAMKLLGRETGESIMMFEETLPAGT
Ga0070733_1033101333300005541Surface SoilMTAAKGFVIPAGGGKHFDAPTPGRSFALKLLGRETGESIM
Ga0068864_10224056013300005618Switchgrass RhizosphereMTKGIVVPAGGGKRYQETPGRFFDLKLLTDQTGQSIMLFEETVPAGT
Ga0066903_10500439913300005764Tropical Forest SoilMSTAEGFVVPAGGGKHFNSPTPGRSFTMKLLGRETNESIMMFEESLP
Ga0066651_1083919823300006031SoilMIAAKGFVVPAGDGKHFASATPGRFFAMKLLGRETGESIMMFEET
Ga0075026_10032609223300006057WatershedsMTATKGFIIPPGGGKHLDSPTPGRFFDLKLLGRDTGESIMMFEETLP
Ga0075424_10076081913300006904Populus RhizosphereMSAAQGFVVPADGGKRFDSPTPGRSFALKLLGRETN
Ga0099793_1026834233300007258Vadose Zone SoilMTATKGFVVPAGGGKRLDSPTQGRFFSLKLLGHETDQSIMMFE
Ga0066710_10299302823300009012Grasslands SoilMSAAEGFVIPAGGGKRFDSPTPGRSFAVKLLGRET
Ga0099827_1183764713300009090Vadose Zone SoilMTAAKGFVVPAGGGKRFDSPTPGRFFALKLLGRETNESIMMFEETLP
Ga0105247_1080744413300009101Switchgrass RhizosphereMSIEGFVVPAGAGRHFNSPTPGRSFAMKLLGHETNESIMMFEETLP
Ga0105247_1173059523300009101Switchgrass RhizosphereMNAAKGFVIPAGGGKHIDSPTPGRSFHLKLLGRETNESI
Ga0105242_1162540523300009176Miscanthus RhizosphereMSTAEGFVVPPGGGKHFTSPTPGRSFAMKLLGRETNESIMMFEE
Ga0123355_1183287813300009826Termite GutMEVAMNETKGFVVPAGGGKRHASATPGRFFDLKLLGCETAD
Ga0126373_1026917543300010048Tropical Forest SoilMTATRGFVVPAGGGKRLDSPTPGRSFSLKLLGHETDE
Ga0126377_1224272413300010362Tropical Forest SoilMTAKGFVVPPGGGKHHASPAPGRFFDLKLLAAQTGDSIMLFEETLPAGTASLY
Ga0134125_1098163713300010371Terrestrial SoilMTTAAKGFVVPAGGGKHFPSPTPGRSFAMKLLGRETGESVMMFEETL
Ga0126383_1361096313300010398Tropical Forest SoilVVPAGCGKHFNSPTPGRFFALKLLGRETGESIMMFEETLPAGT
Ga0137363_1125378513300012202Vadose Zone SoilMTATKGFVVPAGGGKHFDSPTPDRSFALKLLGRETDESIMMFEET
Ga0137387_1068132223300012349Vadose Zone SoilMTAAKGFVVPSGGGKHLDSPTPGRSFAMKLLGRETGESIMLFEETLPA
Ga0137384_1099776223300012357Vadose Zone SoilMTATKGFVVPAGGGKHHEMTSPGRSASLKLLGHETTESIM
Ga0137394_1068113433300012922Vadose Zone SoilMTATKGFVVPAGGGKRLDSPTQGRFFSLKLLGHETDQSIMLF
Ga0137359_1147344013300012923Vadose Zone SoilMTATKGFVVPAGGGKHFDSPTPDRSFALKLLGRETDESIM
Ga0181525_1076493013300014654BogMSAVKGFVVPADGGTHLASPTPGRWFDLKLLGRETGESIIMFE
Ga0182036_1108804313300016270SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTRSL
Ga0182036_1134142113300016270SoilMTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFE
Ga0182041_1118090423300016294SoilMTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIMLFEETL
Ga0182033_1155012913300016319SoilMGAAKGFVVPAGGGKHLNSPTPGRSFAMKLLGRETGESIMMFEETLP
Ga0182033_1172580913300016319SoilMTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSI
Ga0182035_1203006313300016341SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPP
Ga0182034_1006687033300016371SoilMTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEE
Ga0182034_1186591513300016371SoilMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETS
Ga0182040_1007772333300016387SoilMTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGD
Ga0182037_1006301313300016404SoilMTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIM
Ga0182037_1211815323300016404SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLP
Ga0182039_1185101313300016422SoilMTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIM
Ga0187805_1017265213300018007Freshwater SedimentMTAARGFVVAAGGGKHFNSPTPGRHFALKLLGRETNESIML
Ga0187859_1079428513300018047PeatlandMSTAEGFVIPPGGGKHFKSPTPGRSFALKLLGRETN
Ga0066662_1170646813300018468Grasslands SoilMTVAKGFVVPAGGGKHFASPTPGRSFAMKLLGRETGESI
Ga0184642_126466523300019279Groundwater SedimentMSTTDGSTAEGFVVPAGGGKHISSPTPGRFFDLKLLGRETNESIMMFEET
Ga0210407_1005355213300020579SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETD
Ga0210407_1056518033300020579SoilMTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNE
Ga0210401_1023319213300020583SoilMTGAKGFVVPTGGGKHFASPTPGRSFAMKLLGRETGE
Ga0210404_1084110913300021088SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETDDSTIL
Ga0210400_1147640913300021170SoilMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETSESIML
Ga0210408_1064447723300021178SoilMSAAEGFVVPAGGGKRFDSPTPGRSFAMKLLGRETNEGIMMF
Ga0210396_1038848413300021180SoilMSAAKGFVIPAGGGEHIESPTPGRFFDLKLLGCETDESIMMFEETLPA
Ga0213877_1012715323300021372Bulk SoilMTPAKGFVVPAGRGKHFNSPTPGRSFALKLLGRETG
Ga0210393_1103609313300021401SoilMTAAKGFIVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML
Ga0210397_1020943423300021403SoilMTPAKGFIVPAGGGTHFASATPGRFFDLKLLGRETGQSIMIFEESLPAGTTS
Ga0210387_1079935613300021405SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETDDSIILFEETLPPGTRS
Ga0210386_1077619323300021406SoilMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETKESIMLFEE
Ga0210394_1177217423300021420SoilMTTAKGFVVPTGGGKRLGSPTPGRFFDLKLLGHETNQ
Ga0210392_1054202523300021475SoilMSAAEGFVVPAGGGKRFDSPTPGRSFAMKLLGRETNQ
Ga0210402_1007990613300021478SoilMTVAKGFVVPTGGGKHFASPTPGRSFAMKLLGRET
Ga0210402_1109216723300021478SoilMTAPKGFVVTPGGGKHFASPTPGRSFALKLLGRETGESIMMFEETLP
Ga0126371_1057779413300021560Tropical Forest SoilMTKVKGFVVPAGGGKRLDSPTPGRSFALKLLGHET
Ga0126371_1091632113300021560Tropical Forest SoilMTPAKGFVVPTGGGKHFASPTPGRSFAMKLLGRETGESIMMFEETLPAG
Ga0126371_1160317313300021560Tropical Forest SoilMDATTGFVVPAGGGRHFSSPTPGRSFYLKLLGRETKESIMMFEE
Ga0126371_1182114323300021560Tropical Forest SoilMSAAAGFVVPAGGGRHFDSPTPGRCFAMKVLGCET
Ga0242642_105758123300022504SoilMTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESIMMFEET
Ga0207663_1074227033300025916Corn, Switchgrass And Miscanthus RhizosphereMTATKGFVVPAGGGKHFHSPTPGRSFALKLLGRETNESIMLFE
Ga0207663_1123634513300025916Corn, Switchgrass And Miscanthus RhizosphereMSQRILKEDSDMTATKGFVVPPGGGKRLDSPTPGRFFDLKLLGRETGETIMMFEE
Ga0209590_1026889313300027882Vadose Zone SoilMTAAKGFVVPAGGGKRFDSPTPGRFFALKLLGRETNESILMFEETLP
Ga0268266_1203114613300028379Switchgrass RhizosphereMTETNGFVIPAGGGKHFDSPTPGRSFALKLLGRDTGD
Ga0170824_10204895733300031231Forest SoilMTATKGFVIPPGGGKRFASPTPGRSFALKLLGRETGESIMMFEETLPA
Ga0302325_1073785813300031234PalsaMTPAKGFVVQAGGGKHFDSPTPGRFFDLKLLGHKTNESIMLFEE
Ga0302324_10333122313300031236PalsaMTPAKGFVVQAGGGKHFDSPTPGRFFDLKLLGHKTNE
Ga0170819_1805636523300031469Forest SoilMEDTNMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETKESIM
Ga0302320_1005430283300031524BogMSAANGAVVPAGGGTHFASPTPGRSFALKLLGRDTDESIMM
Ga0318534_1079570923300031544SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIML
Ga0318538_1027466733300031546SoilMTAAKGFVVPAGGGKQHASPTPGRFFDLKLFGRETGDSIM
Ga0318528_1005760413300031561SoilMTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIMLFEETLPPGTRS
Ga0318542_1062580713300031668SoilMGAAKGFVVPAGGGKHFNSPTPGRSFAMKLFGRETGESIMMFE
Ga0318574_1053838313300031680SoilMGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGESI
Ga0306917_1005346813300031719SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIIL
Ga0306917_1131761713300031719SoilMGAAKGFVVPAGGGKHFNSPTPGRSFAKKLLGRETGESI
Ga0306918_1015423813300031744SoilMGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGES
Ga0306918_1028614413300031744SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETQPLG
Ga0318492_1041571713300031748SoilMTAAKGFVVPAGGGKHHASPTPGRFFELKLFGRETGDSIM
Ga0318494_1057462013300031751SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEET
Ga0307477_1032393933300031753Hardwood Forest SoilMTAPKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESIMMFEETLAAGT
Ga0307475_1035890343300031754Hardwood Forest SoilMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETNESI
Ga0318509_1053413623300031768SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLP
Ga0318521_1020973133300031770SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGD
Ga0318521_1025820023300031770SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSII
Ga0318508_115187523300031780SoilMTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIM
Ga0318552_1019167323300031782SoilMTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTRSLYH
Ga0318552_1025021023300031782SoilMTAAKGFVVLAGGGKHHASATPGRFFDLKLFGRETGDSIMLFEETLPPGTRSLYH
Ga0318503_1010825123300031794SoilMTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDS
Ga0310917_1000924113300031833SoilMTAAKGFVAPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETL
Ga0318512_1074912713300031846SoilMTATTGFVVPTGGGKHFASPTPGRSFAMKLLGRETGESIMMFEETLPAG
Ga0318527_1023626513300031859SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIM
Ga0318495_1008314023300031860SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIILFEETLPPGTR
Ga0306919_1041052113300031879SoilMTAAKGFVVPAGGGKHHASPTPGRFFEFKLFGRETGDSIMLFE
Ga0306925_1207508223300031890SoilMTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFEETLPPG
Ga0318536_1009015913300031893SoilMTATRGFVVPAGGGKRLDSPTPGRSFSLKLLGHETDESIM
Ga0318520_1013041023300031897SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRET
Ga0306923_1137074013300031910SoilMSTAKGFVIPAGGGKHFDSPAPGRSFALKLLGHETGESIMMFEE
Ga0306921_1018442113300031912SoilMTAAKGFVVPAGGGKRHASPTPGRFFDLKLFGRETGDSIMLFEETLPPGTR
Ga0306921_1039033313300031912SoilMGAAKGFVVPAGGGKHFNSPTPGRSFAMKLLGRETGESIMMFEETLP
Ga0306921_1144349713300031912SoilMSTAKGFVIPAGGGKHFDSPAPGRSFALKLLGPETGESIM
Ga0306921_1203032123300031912SoilMTAAKGFVVPAGGGKHHASPSPGRFFDLKLFGRETGDSIMLF
Ga0310912_1110862513300031941SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPLGTRS
Ga0310910_1057175513300031946SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPPG
Ga0306922_1086582013300032001SoilMTATKGFVVPAGGGKHFDSPTPGRSFALKLLGRETSESIMM
Ga0306922_1102245823300032001SoilMTAAKGFVVPAGGGKHHASPTPGRFFELKLFGRETRDSIML
Ga0318505_1020810613300032060SoilMTAAKGFVAPAGGGKHHASPTPGRLFDLKLFGRETGDSIMLFE
Ga0318510_1003534213300032064SoilMTAAKGFVVPAGGGKHHASPTPGRFFDLKLFGRETGDSIILFEET
Ga0318510_1013232233300032064SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETLPLGTRSLYH
Ga0318540_1020986423300032094SoilMTAAKGFVVPAGGAKHHASPTPGRFFDLKLFGRETGDSIMLFEETL
Ga0306920_10282105623300032261SoilMTASKGFVIPAGGGKRFESDTPGRFFDLTLLCDQTGQSIMMFEETL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.