Metagenome Family F078303

Overview

Basic Information

• Family ID: F078303
• Family Type: Metagenome
• Number of Sequences: 116
• Average Sequence Length: 43 residues
• Representative Sequence: TIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
• Number of Associated Samples: 6
• Number of Associated Scaffolds: 116

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 20.69 %
• % of genes near scaffold ends (potentially truncated): 94.83 %
• % of genes from short scaffolds (< 2000 bps): 77.59 %
• Associated GOLD sequencing projects: 4
• AlphaFold2 3D model prediction: No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (88.793 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (75.862 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 43.59%
  β-sheet: 0.00%
  Coil/Unstructured: 56.41%

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF00092	VWA	2.59
PF15006	DUF4517	0.86
PF00011	HSP20	0.86
PF00025	Arf	0.86
PF00078	RVT_1	0.86
PF00211	Guanylate_cyc	0.86
PF13353	Fer4_12	0.86
PF00653	BIR	0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.86
COG1100	GTPase SAR1 family domain	General function prediction only [R]	0.86
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.86

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
All Organisms	root	All Organisms	11.21 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
cellular organisms	root	All Organisms → cellular organisms	10.34 %
Viruses	superkingdom	All Organisms → Viruses	0.86 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	10.34 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9.48 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.17 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	4.31 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	4.31 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	4.31 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	3.45 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.86 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	3.45 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.86 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	3.45 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.86 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	3.45 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	3.45 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	3.45 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	3.45 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	3.45 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	3.45 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3.45 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	3.45 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Phasmatodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea	1.72 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	1.72 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Timematodea	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea	1.72 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	1.72 %
Heliantheae alliance	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Timematoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea	1.72 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1.72 %
Heliantheae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Timematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae	1.72 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	1.72 %
Echinacea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.72 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	1.72 %
Echinacea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	1.72 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.72 %
Echinacea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	1.72 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.72 %
Echinacea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	88.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1.72 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.72 %
Echinacea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	0.86 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.86 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004626|Ga0066188_1002661	Not Available	3019
3300004626|Ga0066188_1006367	Not Available	2427
3300004626|Ga0066188_1019015	Not Available	1830
3300004626|Ga0066188_1040566	Not Available	1444
3300004626|Ga0066188_1067676	Not Available	1200
3300004626|Ga0066188_1072216	Not Available	1169
3300004626|Ga0066188_1081859	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1111
3300004626|Ga0066188_1084003	Not Available	1099
3300004626|Ga0066188_1086280	Not Available	1087
3300004626|Ga0066188_1086289	Not Available	1087
3300004626|Ga0066188_1093720	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1049
3300004626|Ga0066188_1117341	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	946
3300004626|Ga0066188_1129388	Not Available	902
3300004626|Ga0066188_1142466	Not Available	859
3300004626|Ga0066188_1155140	Not Available	821
3300004626|Ga0066188_1171636	Not Available	776
3300004626|Ga0066188_1187964	Not Available	736
3300004626|Ga0066188_1200504	Not Available	708
3300004626|Ga0066188_1203818	Not Available	701
3300004626|Ga0066188_1210714	Not Available	687
3300004626|Ga0066188_1234764	Not Available	641
3300004626|Ga0066188_1236450	Not Available	638
3300004626|Ga0066188_1241448	Not Available	629
3300004626|Ga0066188_1259443	Not Available	599
3300004626|Ga0066188_1277869	Not Available	571
3300004626|Ga0066188_1278973	Not Available	570
3300004626|Ga0066188_1305184	Not Available	533
3300004626|Ga0066188_1311993	Not Available	524
3300005968|Ga0056130_1005810	Not Available	4026
3300005968|Ga0056130_1023647	Not Available	2648
3300005968|Ga0056130_1025302	Not Available	2585
3300005968|Ga0056130_1030388	Not Available	2417
3300005968|Ga0056130_1061797	Not Available	1789
3300005968|Ga0056130_1061938	Not Available	1787
3300005968|Ga0056130_1067744	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1712
3300005968|Ga0056130_1070408	Not Available	1678
3300005968|Ga0056130_1114844	Not Available	1276
3300005968|Ga0056130_1147096	Not Available	1084
3300005968|Ga0056130_1192206	Not Available	882
3300005968|Ga0056130_1229799	Not Available	755
3300005978|Ga0056129_1005590	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5725
3300005978|Ga0056129_1032384	Not Available	3097
3300005978|Ga0056129_1061909	Not Available	2243
3300005978|Ga0056129_1130913	Not Available	1347
3300005978|Ga0056129_1204286	Not Available	886
3300005978|Ga0056129_1208247	Not Available	868
3300005978|Ga0056129_1222833	Not Available	806
3300005978|Ga0056129_1287178	Not Available	595
3300006912|Ga0056114_1011232	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	6007
3300006912|Ga0056114_1014696	Not Available	5445
3300006912|Ga0056114_1015219	Not Available	5371
3300006912|Ga0056114_1018124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Heliantheae alliance → Heliantheae → Echinacea	5010
3300006912|Ga0056114_1026644	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4219
3300006912|Ga0056114_1037479	Not Available	3550
3300006912|Ga0056114_1054276	Not Available	2860
3300006912|Ga0056114_1055003	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2835
3300006912|Ga0056114_1069557	Not Available	2413
3300006912|Ga0056114_1070054	Not Available	2401
3300006912|Ga0056114_1086670	Not Available	2038
3300006912|Ga0056114_1087453	Not Available	2022
3300006912|Ga0056114_1087492	Not Available	2022
3300006912|Ga0056114_1087911	Not Available	2014
3300006912|Ga0056114_1090139	Not Available	1973
3300006912|Ga0056114_1092642	Not Available	1927
3300006912|Ga0056114_1094687	Not Available	1891
3300006912|Ga0056114_1094737	Not Available	1890
3300006912|Ga0056114_1104520	Not Available	1729
3300006912|Ga0056114_1108766	Not Available	1666
3300006912|Ga0056114_1110733	Not Available	1639
3300006912|Ga0056114_1116679	Not Available	1557
3300006912|Ga0056114_1139535	Not Available	1291
3300006912|Ga0056114_1140420	All Organisms → Viruses → Predicted Viral	1282
3300006912|Ga0056114_1144071	Not Available	1247
3300006912|Ga0056114_1146435	Not Available	1224
3300006912|Ga0056114_1148874	Not Available	1201
3300006912|Ga0056114_1152993	Not Available	1163
3300006912|Ga0056114_1155316	Not Available	1143
3300006912|Ga0056114_1156569	Not Available	1131
3300006912|Ga0056114_1165375	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1059
3300006912|Ga0056114_1182264	Not Available	937
3300006912|Ga0056114_1186217	Not Available	911
3300006912|Ga0056114_1203998	All Organisms → cellular organisms → Eukaryota → Opisthokonta	807
3300006912|Ga0056114_1209293	Not Available	780
3300006912|Ga0056114_1212272	Not Available	765
3300006912|Ga0056114_1214560	Not Available	754
3300006912|Ga0056114_1217961	Not Available	738
3300006912|Ga0056114_1224658	Not Available	708
3300006912|Ga0056114_1226875	Not Available	698
3300006912|Ga0056114_1229130	Not Available	689
3300006912|Ga0056114_1230946	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	681
3300006912|Ga0056114_1232726	Not Available	674
3300006912|Ga0056114_1240494	Not Available	645
3300006912|Ga0056114_1242794	Not Available	636
3300006912|Ga0056114_1243782	Not Available	633
3300006912|Ga0056114_1244299	Not Available	631
3300006912|Ga0056114_1248934	Not Available	615
3300006912|Ga0056114_1250274	Not Available	611
3300006912|Ga0056114_1255858	Not Available	593
3300006912|Ga0056114_1258645	Not Available	585
3300006912|Ga0056114_1265019	Not Available	567
3300006912|Ga0056114_1268869	Not Available	557
3300006912|Ga0056114_1272210	Not Available	548
3300006912|Ga0056114_1272273	Not Available	548
3300006912|Ga0056114_1272629	Not Available	547
3300006912|Ga0056114_1277222	Not Available	536
3300006912|Ga0056114_1289254	Not Available	509
3300027289|Ga0209787_1091770	Not Available	1231
3300027289|Ga0209787_1093963	Not Available	1215
3300027289|Ga0209787_1123909	Not Available	1034
3300027289|Ga0209787_1235164	Not Available	623
3300027289|Ga0209787_1269877	Not Available	538
3300027392|Ga0209680_1027832	Not Available	3094
3300027392|Ga0209680_1031803	Not Available	2918
3300027392|Ga0209680_1063032	Not Available	2079
3300027392|Ga0209680_1157694	Not Available	1059
3300027392|Ga0209680_1237891	Not Available	650

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	75.86%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	24.14%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	75.86%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	24.14%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	75.86%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	24.14%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066188_10026611	3300004626	Marine Gutless Worms Symbiont	VCGTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL
Ga0066188_10063671	3300004626	Marine Gutless Worms Symbiont	MIFGTGSNIQNTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_10190154	3300004626	Marine Gutless Worms Symbiont	MFGVTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_10405661	3300004626	Marine Gutless Worms Symbiont	MDDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_10676762	3300004626	Marine Gutless Worms Symbiont	DTIRYDTIGEFNVHWKAEYSALSSTRSQKKKLKQPTPVPQRYVLR*
Ga0066188_10722162	3300004626	Marine Gutless Worms Symbiont	DIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQATPVPL*
Ga0066188_10818591	3300004626	Marine Gutless Worms Symbiont	MFIEYDTIGEFNVDWKAEYSALSSTGSQKKKLKQPTPVPL*
Ga0066188_10840032	3300004626	Marine Gutless Worms Symbiont	MHHGVYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_10862801	3300004626	Marine Gutless Worms Symbiont	MNTVQMHIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0066188_10862891	3300004626	Marine Gutless Worms Symbiont	MSSARKPIDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVP
Ga0066188_10937201	3300004626	Marine Gutless Worms Symbiont	MTTIRYDTTGEFNVDWKAEYSALSSTRSQKKKLKQTTPVP
Ga0066188_11173413	3300004626	Marine Gutless Worms Symbiont	MLTSSALDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_11293881	3300004626	Marine Gutless Worms Symbiont	MHPEEFVHITIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_11424661	3300004626	Marine Gutless Worms Symbiont	MDFHKIRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPT
Ga0066188_11551401	3300004626	Marine Gutless Worms Symbiont	MKFNEQIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0066188_11716361	3300004626	Marine Gutless Worms Symbiont	MKLYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_11879641	3300004626	Marine Gutless Worms Symbiont	MLWIAVHTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_12005041	3300004626	Marine Gutless Worms Symbiont	MLYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVP
Ga0066188_12038181	3300004626	Marine Gutless Worms Symbiont	VVGVQLRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPT
Ga0066188_12107141	3300004626	Marine Gutless Worms Symbiont	MNSQINTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_12347641	3300004626	Marine Gutless Worms Symbiont	MYICPLTVNDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0066188_12364502	3300004626	Marine Gutless Worms Symbiont	VGYNSVAANTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_12414482	3300004626	Marine Gutless Worms Symbiont	QYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLQQPTPVPL*
Ga0066188_12594431	3300004626	Marine Gutless Worms Symbiont	MVDLRYSMILLIDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0066188_12778692	3300004626	Marine Gutless Worms Symbiont	MPSCKAITIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0066188_12789731	3300004626	Marine Gutless Worms Symbiont	HTIRYDTIGEFNVDSKAEYSALSSTRSQKKKLQTPPVPI*
Ga0066188_13051842	3300004626	Marine Gutless Worms Symbiont	MFLSPDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0066188_13119931	3300004626	Marine Gutless Worms Symbiont	MPVPHTNIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056130_10058101	3300005968	Marine Gutless Worms Symbiont	MNLRNTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056130_10236471	3300005968	Marine Gutless Worms Symbiont	IRYDTIEEFNVDWKAEYSALYNIRSQKKKLKQTAPLPL*
Ga0056130_10253025	3300005968	Marine Gutless Worms Symbiont	MDNRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056130_10303883	3300005968	Marine Gutless Worms Symbiont	LVPCEGLHAKYDTIRYDTIVEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056130_10617973	3300005968	Marine Gutless Worms Symbiont	MPYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056130_10619385	3300005968	Marine Gutless Worms Symbiont	YDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056130_10677441	3300005968	Marine Gutless Worms Symbiont	YDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056130_10704081	3300005968	Marine Gutless Worms Symbiont	VQFAANVEYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056130_11148441	3300005968	Marine Gutless Worms Symbiont	MKEIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQ
Ga0056130_11470961	3300005968	Marine Gutless Worms Symbiont	DTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056130_11922061	3300005968	Marine Gutless Worms Symbiont	MQSTNKYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056130_12297993	3300005968	Marine Gutless Worms Symbiont	TIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTQVPL*
Ga0056129_10055901	3300005978	Marine Gutless Worms Symbiont	VDLLKYDTIGEFNVDWKAEYSALSSTRSQKKKLKQ
Ga0056129_10323846	3300005978	Marine Gutless Worms Symbiont	MVNVDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056129_10619091	3300005978	Marine Gutless Worms Symbiont	MQSTNKYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056129_11309133	3300005978	Marine Gutless Worms Symbiont	MRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTP
Ga0056129_12042861	3300005978	Marine Gutless Worms Symbiont	MTSVIRYDTIRYDTIGEFNVDSKAEYSALSSTRSKKKKLKQTTPVPL
Ga0056129_12082471	3300005978	Marine Gutless Worms Symbiont	MGDLGGLRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056129_12228332	3300005978	Marine Gutless Worms Symbiont	MIAGVLVAMLYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056129_12871782	3300005978	Marine Gutless Worms Symbiont	MSKEYDTIDTIGEFNVDWKAEYSALSSTRSQKKKLKQT
Ga0056114_10112321	3300006912	Marine Gutless Worms Symbiont	IRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056114_101469611	3300006912	Marine Gutless Worms Symbiont	MSYSSNYLRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_10152197	3300006912	Marine Gutless Worms Symbiont	MNTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_10181241	3300006912	Marine Gutless Worms Symbiont	MARLMTLVKISYDTNDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_10266441	3300006912	Marine Gutless Worms Symbiont	MLYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056114_10374797	3300006912	Marine Gutless Worms Symbiont	MTADYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_10542761	3300006912	Marine Gutless Worms Symbiont	LSALLRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056114_105500310	3300006912	Marine Gutless Worms Symbiont	LRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056114_10695571	3300006912	Marine Gutless Worms Symbiont	VRSTGGTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_10700541	3300006912	Marine Gutless Worms Symbiont	MLWIAVHTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_10866704	3300006912	Marine Gutless Worms Symbiont	MAPLYFPYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLK
Ga0056114_10874531	3300006912	Marine Gutless Worms Symbiont	MYICPLTVNDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_10874921	3300006912	Marine Gutless Worms Symbiont	MHPEEFVHITIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_10879114	3300006912	Marine Gutless Worms Symbiont	MDRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_10901394	3300006912	Marine Gutless Worms Symbiont	MFQIVTYDTIRYDTIGEFNVDWKAELSALSSTRSQKKKLKQTTPVPL*
Ga0056114_10926421	3300006912	Marine Gutless Worms Symbiont	MNVLYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056114_10946874	3300006912	Marine Gutless Worms Symbiont	MSDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_10947374	3300006912	Marine Gutless Worms Symbiont	MAIETNDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_11045201	3300006912	Marine Gutless Worms Symbiont	RYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_11087661	3300006912	Marine Gutless Worms Symbiont	MIIGLLDMLTRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_11107333	3300006912	Marine Gutless Worms Symbiont	MFVVHTIRYDTIEEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_11166792	3300006912	Marine Gutless Worms Symbiont	VYKYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_11395351	3300006912	Marine Gutless Worms Symbiont	NTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056114_11404201	3300006912	Marine Gutless Worms Symbiont	MINTETSYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPKPVP
Ga0056114_11440712	3300006912	Marine Gutless Worms Symbiont	TIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL*
Ga0056114_11464351	3300006912	Marine Gutless Worms Symbiont	YDTIGELNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_11488741	3300006912	Marine Gutless Worms Symbiont	NDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPLDLIFDY*
Ga0056114_11529931	3300006912	Marine Gutless Worms Symbiont	YDTIGEFNVDWKAEYSALSSTRSQKKKLKQPKPVPL*
Ga0056114_11553161	3300006912	Marine Gutless Worms Symbiont	MNRLRPKTVTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_11565693	3300006912	Marine Gutless Worms Symbiont	MCKYGHTYVYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPV
Ga0056114_11653751	3300006912	Marine Gutless Worms Symbiont	TIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_11822641	3300006912	Marine Gutless Worms Symbiont	MYTYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPKPVP
Ga0056114_11862172	3300006912	Marine Gutless Worms Symbiont	YDTIGEFNVHWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12039983	3300006912	Marine Gutless Worms Symbiont	DTIGEFNVDSKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12092931	3300006912	Marine Gutless Worms Symbiont	DTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12122721	3300006912	Marine Gutless Worms Symbiont	MLAQPIIMIVIRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTP
Ga0056114_12145601	3300006912	Marine Gutless Worms Symbiont	MTNFTASNTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12179611	3300006912	Marine Gutless Worms Symbiont	MQIDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12246581	3300006912	Marine Gutless Worms Symbiont	TIRYDTIGEFNVHWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12268751	3300006912	Marine Gutless Worms Symbiont	MTLYRYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12291301	3300006912	Marine Gutless Worms Symbiont	VACGLVTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12309461	3300006912	Marine Gutless Worms Symbiont	MLTSSALDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12327261	3300006912	Marine Gutless Worms Symbiont	MNNFYIYIDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKL
Ga0056114_12404941	3300006912	Marine Gutless Worms Symbiont	GKYRRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPRN*
Ga0056114_12427941	3300006912	Marine Gutless Worms Symbiont	MWLSDTDVVTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPV
Ga0056114_12437821	3300006912	Marine Gutless Worms Symbiont	MIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12442991	3300006912	Marine Gutless Worms Symbiont	MKLYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12489341	3300006912	Marine Gutless Worms Symbiont	LFKLSKIRYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTP
Ga0056114_12502741	3300006912	Marine Gutless Worms Symbiont	MCHTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12558581	3300006912	Marine Gutless Worms Symbiont	DTIGEFNVHWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12586451	3300006912	Marine Gutless Worms Symbiont	MFGVTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12650192	3300006912	Marine Gutless Worms Symbiont	MTPITIDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL*
Ga0056114_12688691	3300006912	Marine Gutless Worms Symbiont	MNYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_12722101	3300006912	Marine Gutless Worms Symbiont	VVSINLGQQMRINTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTRVP
Ga0056114_12722731	3300006912	Marine Gutless Worms Symbiont	MFTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0056114_12726291	3300006912	Marine Gutless Worms Symbiont	MLLNTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL
Ga0056114_12772221	3300006912	Marine Gutless Worms Symbiont	VQAVAIYTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVP
Ga0056114_12892541	3300006912	Marine Gutless Worms Symbiont	TIGEFNVDWKAEYSALSSTRSQKKKLKQPKPVPQ*
Ga0209787_10917701	3300027289	Marine Gutless Worms Symbiont	LMTSVIRYDTIRYDTIGEFNVDSKAEYSALSSTRSKKKKLKQTTPVPL
Ga0209787_10939631	3300027289	Marine Gutless Worms Symbiont	IYFFAHTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQATPVPL
Ga0209787_11239091	3300027289	Marine Gutless Worms Symbiont	TIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQLYSKPQVV
Ga0209787_12351642	3300027289	Marine Gutless Worms Symbiont	MQSTNKYDTIRYDTIAEFNVDWKAEYSALSSTRSQKKKLKQPT
Ga0209787_12698771	3300027289	Marine Gutless Worms Symbiont	GLNTSDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQTTPVPL
Ga0209680_10278321	3300027392	Marine Gutless Worms Symbiont	MSHVIRNHSHTIRYDTIGEFNVNSKAEYSALSSTRSQKKKLNQTTPVPL
Ga0209680_10318031	3300027392	Marine Gutless Worms Symbiont	MPYDTIRYDTIGEFNVDWKAEYSALSSTRSQKKKLKQ
Ga0209680_10630322	3300027392	Marine Gutless Worms Symbiont	RYDTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL
Ga0209680_11576941	3300027392	Marine Gutless Worms Symbiont	THALIRYDTIRYDTIGEFNVDWKAEYSALSSIRSQKKKLKQPTPVPL
Ga0209680_12378911	3300027392	Marine Gutless Worms Symbiont	VEYYTIGEFNVDWKAEYSALSSTRSQKKKLKQPTPVPL