NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078154

Metagenome / Metatranscriptome Family F078154

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078154
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 47 residues
Representative Sequence VTVRREITVKLPVAVCRDEIRAQLAAAIAEIRGDYRAEIALKPLVQ
Number of Associated Samples 84
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.90 %
% of genes near scaffold ends (potentially truncated) 91.38 %
% of genes from short scaffolds (< 2000 bps) 81.90 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.759 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(66.379 % of family members)
Environment Ontology (ENVO) Unclassified
(80.172 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(61.207 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.97%    β-sheet: 5.41%    Coil/Unstructured: 71.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13561adh_short_C2 19.83
PF00561Abhydrolase_1 17.24
PF12697Abhydrolase_6 14.66
PF00903Glyoxalase 3.45
PF01904DUF72 2.59
PF08028Acyl-CoA_dh_2 1.72
PF00171Aldedh 1.72
PF07883Cupin_2 0.86
PF05050Methyltransf_21 0.86
PF08264Anticodon_1 0.86
PF11845DUF3365 0.86
PF00583Acetyltransf_1 0.86
PF01841Transglut_core 0.86
PF12969DUF3857 0.86
PF13450NAD_binding_8 0.86
PF01252Peptidase_A8 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 2.59
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.72
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.72
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.72
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.72
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.76 %
UnclassifiedrootN/A17.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10316598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae901Open in IMG/M
3300004082|Ga0062384_100071358All Organisms → cellular organisms → Bacteria → Proteobacteria1764Open in IMG/M
3300009090|Ga0099827_11117892All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300010162|Ga0131853_10879545Not Available708Open in IMG/M
3300010376|Ga0126381_100871146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 33591295Open in IMG/M
3300016294|Ga0182041_10755162Not Available866Open in IMG/M
3300016294|Ga0182041_11554607All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300016319|Ga0182033_11399931All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300016341|Ga0182035_10039655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3119Open in IMG/M
3300016341|Ga0182035_10050579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2818Open in IMG/M
3300016341|Ga0182035_10766186Not Available845Open in IMG/M
3300016341|Ga0182035_11651378Not Available578Open in IMG/M
3300016357|Ga0182032_10639710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359888Open in IMG/M
3300016357|Ga0182032_10808162All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300016371|Ga0182034_11116515All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300016371|Ga0182034_11631183All Organisms → cellular organisms → Bacteria → Proteobacteria566Open in IMG/M
3300016387|Ga0182040_11465651All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300016387|Ga0182040_11892787All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3511Open in IMG/M
3300016404|Ga0182037_10710182Not Available861Open in IMG/M
3300018058|Ga0187766_11386199All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300020580|Ga0210403_11188635All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300020581|Ga0210399_10726266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359815Open in IMG/M
3300020581|Ga0210399_10767587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales789Open in IMG/M
3300020583|Ga0210401_10613354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria949Open in IMG/M
3300021170|Ga0210400_10060157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2961Open in IMG/M
3300021178|Ga0210408_10753234All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300021358|Ga0213873_10306131Not Available514Open in IMG/M
3300021406|Ga0210386_10606405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria945Open in IMG/M
3300021441|Ga0213871_10190539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300021444|Ga0213878_10373158Not Available619Open in IMG/M
3300022532|Ga0242655_10103041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300025915|Ga0207693_10495811Not Available953Open in IMG/M
3300027605|Ga0209329_1000536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4628Open in IMG/M
3300027703|Ga0207862_1234178Not Available540Open in IMG/M
3300027729|Ga0209248_10050093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae1282Open in IMG/M
3300031231|Ga0170824_121880341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359810Open in IMG/M
3300031544|Ga0318534_10826250All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031545|Ga0318541_10148516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1285Open in IMG/M
3300031545|Ga0318541_10305167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359887Open in IMG/M
3300031545|Ga0318541_10347454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359828Open in IMG/M
3300031564|Ga0318573_10008973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00884149Open in IMG/M
3300031573|Ga0310915_11060785All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031640|Ga0318555_10333947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359821Open in IMG/M
3300031668|Ga0318542_10022660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2611Open in IMG/M
3300031668|Ga0318542_10553514All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031681|Ga0318572_10077818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1838Open in IMG/M
3300031713|Ga0318496_10012323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4074Open in IMG/M
3300031713|Ga0318496_10017782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883473Open in IMG/M
3300031724|Ga0318500_10660843Not Available531Open in IMG/M
3300031736|Ga0318501_10013194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3270Open in IMG/M
3300031736|Ga0318501_10186198All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300031736|Ga0318501_10763093All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031744|Ga0306918_10699175All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031747|Ga0318502_10245063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 33591045Open in IMG/M
3300031747|Ga0318502_10341298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359885Open in IMG/M
3300031763|Ga0318537_10270111Not Available630Open in IMG/M
3300031764|Ga0318535_10172060Not Available968Open in IMG/M
3300031765|Ga0318554_10382135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359800Open in IMG/M
3300031769|Ga0318526_10054840All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300031770|Ga0318521_10693845Not Available618Open in IMG/M
3300031771|Ga0318546_10697144Not Available714Open in IMG/M
3300031777|Ga0318543_10202603Not Available881Open in IMG/M
3300031778|Ga0318498_10066500All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300031779|Ga0318566_10373168All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031799|Ga0318565_10039031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2174Open in IMG/M
3300031805|Ga0318497_10683913All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031819|Ga0318568_10607013All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300031821|Ga0318567_10529864All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031835|Ga0318517_10024355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2372Open in IMG/M
3300031859|Ga0318527_10007718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883410Open in IMG/M
3300031859|Ga0318527_10033317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila1931Open in IMG/M
3300031860|Ga0318495_10073518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881525Open in IMG/M
3300031860|Ga0318495_10120143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1184Open in IMG/M
3300031879|Ga0306919_10624560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359831Open in IMG/M
3300031880|Ga0318544_10245153All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031890|Ga0306925_10579284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1187Open in IMG/M
3300031890|Ga0306925_11873011All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031897|Ga0318520_10001813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7509Open in IMG/M
3300031897|Ga0318520_10229592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1102Open in IMG/M
3300031910|Ga0306923_10010944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00889216Open in IMG/M
3300031910|Ga0306923_10633333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 33591197Open in IMG/M
3300031912|Ga0306921_10008769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD008810692Open in IMG/M
3300031912|Ga0306921_12275329All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031942|Ga0310916_10204305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1654Open in IMG/M
3300031942|Ga0310916_10321864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1312Open in IMG/M
3300031942|Ga0310916_10996882All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031945|Ga0310913_10600061Not Available781Open in IMG/M
3300031946|Ga0310910_10276689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1317Open in IMG/M
3300031959|Ga0318530_10108549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1108Open in IMG/M
3300032009|Ga0318563_10060274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1958Open in IMG/M
3300032025|Ga0318507_10063505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1482Open in IMG/M
3300032025|Ga0318507_10179056Not Available912Open in IMG/M
3300032025|Ga0318507_10200242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359862Open in IMG/M
3300032042|Ga0318545_10330931All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300032043|Ga0318556_10219105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359991Open in IMG/M
3300032051|Ga0318532_10024503All Organisms → cellular organisms → Bacteria → Proteobacteria1972Open in IMG/M
3300032054|Ga0318570_10022968All Organisms → cellular organisms → Bacteria2388Open in IMG/M
3300032054|Ga0318570_10082395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1385Open in IMG/M
3300032054|Ga0318570_10248551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359806Open in IMG/M
3300032054|Ga0318570_10376302Not Available647Open in IMG/M
3300032055|Ga0318575_10033050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae2281Open in IMG/M
3300032059|Ga0318533_10061056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2533Open in IMG/M
3300032060|Ga0318505_10026844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2309Open in IMG/M
3300032063|Ga0318504_10041236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila1895Open in IMG/M
3300032063|Ga0318504_10536271Not Available561Open in IMG/M
3300032064|Ga0318510_10009324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2808Open in IMG/M
3300032064|Ga0318510_10288495All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300032067|Ga0318524_10149398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1181Open in IMG/M
3300032090|Ga0318518_10163292Not Available1134Open in IMG/M
3300032091|Ga0318577_10289960All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300032094|Ga0318540_10049893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1876Open in IMG/M
3300032174|Ga0307470_11069567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3359647Open in IMG/M
3300032261|Ga0306920_100230686All Organisms → cellular organisms → Bacteria → Proteobacteria2762Open in IMG/M
3300032261|Ga0306920_103432495All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300033289|Ga0310914_10161037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1986Open in IMG/M
3300033289|Ga0310914_11393344All Organisms → cellular organisms → Bacteria604Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil66.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.69%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.86%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1031659823300004080Bog Forest SoilVTVRREITVKLPVAVCRDEIRSQLAEAIAEIRGDYRAEIALKPLA
Ga0062384_10007135833300004082Bog Forest SoilVTVRREITVKLPVAVCRDEIRSQLAEAIAEIRGDYRAEIALKPLAQ*
Ga0099827_1111789223300009090Vadose Zone SoilSVRRELTVKLPVAVCRDEIRLKLAEAIAEIRGDYRSVIALKPLAE*
Ga0131853_1087954513300010162Termite GutLHYRSEWNREGQTVTVRREITVRVPVAVCRDEIRAKLAEAIAEIRGDYRSAIALEPLVH*
Ga0126381_10087114613300010376Tropical Forest SoilVRREFTVKLPVAVCRDEICVKPAEAIAEIRGDYCAEITIKPLIR*
Ga0182041_1075516223300016294SoilLPVAVCREEIRAQLADAVALIRGDYRDEITLKPLVH
Ga0182041_1155460713300016294SoilARREITVKLPVVVCRDEIRAQLAAAIAEIRGDYRAEIALKPLVH
Ga0182033_1139993123300016319SoilVRREITVKLPVAVCRDEIRAQLAAAIAEIRGDYRAEIALKPLVQ
Ga0182035_1003965553300016341SoilYQSDWSRDGQVLTVRREITVKLPVAVCRDEIREQLTKAIAEIRGDYRAEIALKPLVH
Ga0182035_1005057913300016341SoilTVRREITVRLPIAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVQ
Ga0182035_1076618623300016341SoilWTREGQIVTVHREMTTKLPVAVCRDEIRAQLADAVTLIRGDYRDEIALKPLVH
Ga0182035_1165137813300016341SoilRLPVAVCRDEIRAQLADAVALIRGDYRDEITLKPLVH
Ga0182032_1063971023300016357SoilRREITVKLPVAVCHDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0182032_1080816213300016357SoilRDGQIVTVRREITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEIALKPLFQ
Ga0182034_1111651513300016371SoilVSVRREITVKLPVAVCRDEIRTQLAEAIAEIRGDYRAEIALKPLVH
Ga0182034_1163118313300016371SoilYQSEWKREGQTVEVRREITVTVPVAVCRDEIRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0182040_1146565123300016387SoilRDGQVVTVRREITVKLPVAVCRAEIRAQLAEAIAQIRGDYRAEITLKPLVQ
Ga0182040_1189278723300016387SoilRVTSPVAVCRDEIRSQLAEAIAEIRGDYRAEIALKPLAH
Ga0182037_1071018213300016404SoilGQVVTVHREMTATLPVAVCREEIRAQLADAVALIRGDYRDEIALKPLVH
Ga0187766_1138619913300018058Tropical PeatlandGQVVTVRREITVKLSVAVCRDEIRLQLAEAIAAIRGDYRAEIALKPLVH
Ga0210403_1118863513300020580SoilERRHDGQVVTVRREVTVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEITLKPLVH
Ga0210399_1072626613300020581SoilQVVTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEITLKPLVH
Ga0210399_1076758713300020581SoilRYESNWQHDGQSVTVRREITVKLPVAVCRGEIRSQLAEAIAEIRGDYRAEIALKPLVH
Ga0210401_1061335413300020583SoilDWNRDGQVVTVRREITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEITLKPPAH
Ga0210400_1006015723300021170SoilVTVRREITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEITLKPPAH
Ga0210408_1075323423300021178SoilHYQSERRHDGQVVTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEITLKPLVH
Ga0213873_1030613123300021358RhizosphereVRREIIVKLPVAVCRDEIRARLVEAIAEIRADYRSPLELKPLVE
Ga0210386_1060640533300021406SoilSDWNRDGQVVTVRREITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEITLKPPAH
Ga0213871_1019053923300021441RhizosphereYLRYHSEWTRNGQVVTVHREMTARLSVAVCRDEIRAQLADAVAQIRGDYRDEITLKPLVH
Ga0213878_1037315823300021444Bulk SoilSEWTRDGQVVTVHREMTATLPVAVCRDEIRAQLADAVALIRGDYRDEITLKPLVH
Ga0242655_1010304133300022532SoilTVRREITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEITLKPPAH
Ga0207693_1049581123300025915Corn, Switchgrass And Miscanthus RhizosphereVRVRREITVSLPVAVCRDEIRAKLVESIAEIRGDYRSTIALEPLVH
Ga0209329_100053683300027605Forest SoilVTVRREIIVRLPDAVCRDEIGIKIAEAIAQIRGDYRSEIALKPLVQ
Ga0207862_123417813300027703Tropical Forest SoilRYRSDWSREGQTVKVRREITVKLPVAVCRDEIRTKLAEAIAEIRGDYRSTIALEPLVH
Ga0209248_1005009323300027729Bog Forest SoilVTVRREITVKLPVAVCRDEIRSQLAEAIAEIRGDYRAEIALKPLAQ
Ga0170824_12188034123300031231Forest SoilRYDSKWQRDGQFVTVRREITVKLPVSVCREEIRIELAEAIAEIRGDYRAEIALKPLVQ
Ga0318534_1082625013300031544SoilQVLTVRREITVKLPVAVCRDEIREQLTKAIAEIRGDYRAEIALKPLVQ
Ga0318541_1014851623300031545SoilGQIVTVRREITVSLPVAVCRDEIRAQLAQAIAEIRGDYRAEIALKPLVQ
Ga0318541_1030516723300031545SoilVVTVRREIMVKLPVAVCRDEIRTQLAKAIAEIRGDYRAEIALKPLVH
Ga0318541_1034745423300031545SoilGQVVTVRREITVKLAVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318573_1000897313300031564SoilREITVRLPTAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVH
Ga0310915_1106078513300031573SoilVSVRREITVKLPVAVCRDEIRAQLVDAIADIRGDYRTQIALKPLVH
Ga0318555_1033394723300031640SoilREMTVKLPVAVCHDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318542_1002266013300031668SoilRRDGQVVTVRREMTVKLPVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318542_1055351423300031668SoilITVELPVAVCRDEIRAQLAEAIAEIRGDYRAEIALKPLVH
Ga0318572_1007781813300031681SoilLPVAVCRDEIRSQLAAAISEIRGDYRAEIALKPLVH
Ga0318496_1001232353300031713SoilVKLPVAVCRDEIRSQLAAAISEIRGDYRAEIALKPLVH
Ga0318496_1001778263300031713SoilVRLPDAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVH
Ga0318500_1066084313300031724SoilSEWTRNGQIVTVHREMTARLPVAVCRDEIRAQLADAVALIRGDYRDEIALKPLVH
Ga0318501_1001319453300031736SoilLHYQSEWNRESQTITVRREITVRLPDAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVH
Ga0318501_1018619813300031736SoilVKLAVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318501_1076309323300031736SoilQSEWKRDGQVVTVRREIMVKLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0306918_1069917523300031744SoilNPYLRYQSDWKRDGQVVTVRREIMVKLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0318502_1024506313300031747SoilPYLHYQSEWRHDGQVVTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEIILKPLV
Ga0318502_1034129823300031747SoilDWKRDGQVVTVRREIMVKLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0318537_1027011113300031763SoilYLRYRSEWTRNGQVVTVHREMTARLPVAVCRDEIRAQLADAVALIRGDYRDEIALKPLVH
Ga0318535_1017206013300031764SoilITVKLPVAVCRDEIRTKLAEAIAEIRGDYRSTIALEPLVH
Ga0318554_1038213513300031765SoilPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0318526_1005484013300031769SoilQVVTARREITVKLPIAVCRGEIRSQLAAAIAEIRGDYRAEIALKPLVH
Ga0318521_1069384513300031770SoilVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0318546_1069714423300031771SoilLPTAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVHQ
Ga0318543_1020260313300031777SoilPYLRYRSDWSREGQTVKVRREITVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLV
Ga0318498_1006650033300031778SoilPDLRYQSQWTRDGQVVTARREITVKLPVAVCRDEIRSQLAAAIAEIRGDYRAEIALKPLV
Ga0318566_1037316823300031779SoilPYLRYQSEWKRDGQVVTVRREIMVKLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLV
Ga0318565_1003903143300031799SoilGQVVTARREITVKLPVAVCRDEIRSQLAAAISEIRGDYRAEIALKPLVH
Ga0318497_1068391323300031805SoilSRDGQVVTVRREITVKLAVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318568_1060701323300031819SoilLVTVRREITVELPVAVCRDEIRAQLAEAIAEIRGDYRAEIALKPLVH
Ga0318567_1052986423300031821SoilSYQSGWKRDGQVVSVRREITVKLPVAVCRDEIRTQLAEAIAEIRGDYRAEIALKPLVH
Ga0318517_1002435523300031835SoilVTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEIILKPLVR
Ga0318527_1000771813300031859SoilPAAVCCDEIRAKLAEAIAEIRGDYSSTIALEPLVH
Ga0318527_1003331713300031859SoilSVRREITVKLPVAVCRDEIRTQLAEAIAEIRGDYRAEIALKPLVH
Ga0318495_1007351833300031860SoilVRREITVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0318495_1012014313300031860SoilTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEIILKPLVR
Ga0306919_1062456023300031879SoilVTVRREITVKLPVAVCRDEIRAQLAAAIAEIRGDYRAEIALKPLVQ
Ga0318544_1024515313300031880SoilEWRHDGQVVTVRREITVNLPVAVCRDEIRAQLVEAIAEIRGDYRAEIILKPLVR
Ga0306925_1057928423300031890SoilVRRELTVRLPVAVCRNDIRRALADAIGQIRGDYRSEIALKPMVQ
Ga0306925_1187301113300031890SoilKLPVAVCRDEIRAQPVDAIADIRGDYRTQIALKPLVH
Ga0318520_1000181313300031897SoilYLRYQSQWTRDGQVVTARREITVKLPVAVCRDEIRSQLAAAISEIRGDYRAEIALKPLVH
Ga0318520_1022959223300031897SoilITVKLPVAVCRDEIRAQLADAIAEIRGDYRAEIALKPLVH
Ga0306923_10010944103300031910SoilLEPQGQTVKVRREITVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0306923_1063333313300031910SoilEITVSLPVAVCRDEIRAQLAQAIAEIRGDYRAEIALKPLVQ
Ga0306921_10008769103300031912SoilKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0306921_1227532923300031912SoilDGQVVSVRREITVKLPVAVCRDEIRAQLVDAIADIRGDYRTQIALKPLVH
Ga0310916_1020430543300031942SoilEITVRLPTAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVHQ
Ga0310916_1032186433300031942SoilYLRYQSDWSRDAQVVIVRREITVKLPVAVCRDEIREQLAKAIAEIRGDYRAEITLKPLVQ
Ga0310916_1099688223300031942SoilGQVVSVRREITVKLPVAVCRDEIRAQLADAIADIRGDYRTQIALKPLVH
Ga0310913_1060006113300031945SoilKLPVVVCRDEIRAQLAAAIAEIRGDYRAEIALKPLVH
Ga0310910_1027668913300031946SoilDWSRDAQVVIVRREITVKLPVAVCRDEIREQLAKAIAEIRGDYRAEIALKPLVQ
Ga0318530_1010854923300031959SoilMTTKLPVAVCRDEIRAQLADAVTLIRGDYRDEIALKPLVH
Ga0318563_1006027413300032009SoilREITVRLPDAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVHQ
Ga0318507_1006350533300032025SoilWKHDGQVVSVRREITVKLPVAVCRDEIRAQLADAIADIRGDYRTQIALKPLVH
Ga0318507_1017905623300032025SoilQVVIVRREITVKLPVAVCRDEIREQLAKAIAEIRGDYRAEITLKPLVQ
Ga0318507_1020024213300032025SoilVKLPVAVCRDEIRAQLAEAIAEIRGDYRAEIALKPLVH
Ga0318545_1033093123300032042SoilYLRYQSDWKRDGQVVTVRREIMVKLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0318556_1021910513300032043SoilKLPVAVCHDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318532_1002450313300032051SoilITVKLPVAVCRDEIRAKLAEAIAEIRGDYRAEIALKPLFQ
Ga0318570_1002296813300032054SoilGQLVTVRREITVELPVAVCRDEIRAQLAEAIAEIRGDYRAEIALKPLVH
Ga0318570_1008239513300032054SoilLHYQSEWNRESQTITVRREITVRLPDAVCRDEIRAKLAEAIAKIRGDYSSTIALEPLVH
Ga0318570_1024855113300032054SoilKLAVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318570_1037630213300032054SoilDWSREGQTVKVRREITVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0318575_1003305043300032055SoilWKRDGQVVAVRREITVKLPVAVCRDEIRAQLAEAIAEIRGDYRAEIALKPLVH
Ga0318533_1006105613300032059SoilTAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVHQ
Ga0318505_1002684413300032060SoilLAVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318504_1004123613300032063SoilVKLPVAVCRDEIREQLAKVIAEIRGDYRAEIALKPLVQ
Ga0318504_1053627113300032063SoilEMTTKLPVAVCRDEIRAQLADAVTLIRGDYRDEIALKPLVH
Ga0318510_1000932413300032064SoilPYLHYQSEWNRESQTITVRREITVRLPDAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLV
Ga0318510_1028849513300032064SoilYQSDWSRDAQVVIVRREITVKLPVAVCRDEIREQLAKAIAEIRGDYRAEITLKPLVQ
Ga0318524_1014939813300032067SoilWNREGQTITVRREITVRLPIAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVQ
Ga0318518_1016329233300032090SoilSREGQTVKVRREITVKLPVAVCRDEVRAKLAEAIAEIRGDYRSTIALEPLVH
Ga0318577_1028996013300032091SoilLPVAVCRDEIRAQLAQAIVEIRGDYRAEIALKPLVQ
Ga0318540_1004989313300032094SoilVVIVRREITVKLPVAVCRDEIREQLAKAIAEIRGDYRAEITLKPLVQ
Ga0307470_1106956713300032174Hardwood Forest SoilVITVKLPVAVCRFEIRADLAKAIAEIRGDYRAEIALKPLVQ
Ga0306920_10023068623300032261SoilVTVRRELTVRLPVAVCRNDIRRALADAIGQIRGDYRSEIALKPMVQ
Ga0306920_10343249513300032261SoilLPVAVCREEIRAQLAAVIAEIRGDYRAEIALKPLVH
Ga0310914_1016103743300033289SoilQSEWNREGQTITVRREITVRLPTAVCRDEIRAKLAEAIAEIRGDYSSTIALEPLVHQ
Ga0310914_1139334413300033289SoilPVAVCRDEIRAQLAQTIAEIRGDYRAEIALKPLVQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.