| Basic Information | |
|---|---|
| Family ID | F078153 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.66 % |
| % of genes near scaffold ends (potentially truncated) | 14.66 % |
| % of genes from short scaffolds (< 2000 bps) | 62.07 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.448 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (10.345 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.069 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF04379 | DUF525 | 37.93 |
| PF00834 | Ribul_P_3_epim | 18.97 |
| PF03562 | MltA | 8.62 |
| PF06725 | 3D | 8.62 |
| PF12867 | DinB_2 | 4.31 |
| PF10017 | Methyltransf_33 | 3.45 |
| PF00117 | GATase | 2.59 |
| PF08818 | DUF1801 | 2.59 |
| PF00990 | GGDEF | 1.72 |
| PF12697 | Abhydrolase_6 | 0.86 |
| PF02913 | FAD-oxidase_C | 0.86 |
| PF05016 | ParE_toxin | 0.86 |
| PF01565 | FAD_binding_4 | 0.86 |
| PF00295 | Glyco_hydro_28 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2967 | Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport | Inorganic ion transport and metabolism [P] | 37.93 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 18.97 |
| COG2821 | Membrane-bound lytic murein transglycosylase | Cell wall/membrane/envelope biogenesis [M] | 8.62 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.59 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.59 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.59 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.86 |
| COG5434 | Polygalacturonase | Carbohydrate transport and metabolism [G] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.45 % |
| Unclassified | root | N/A | 21.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002705|JGI25156J39149_1000063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 84312 | Open in IMG/M |
| 3300002705|JGI25156J39149_1017165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1380 | Open in IMG/M |
| 3300002705|JGI25156J39149_1046562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 581 | Open in IMG/M |
| 3300003316|rootH1_10017775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5967 | Open in IMG/M |
| 3300003316|rootH1_10017776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1634 | Open in IMG/M |
| 3300003320|rootH2_10007281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5399 | Open in IMG/M |
| 3300003752|Ga0055539_1000303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 26405 | Open in IMG/M |
| 3300003761|Ga0055535_1007601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2048 | Open in IMG/M |
| 3300005327|Ga0070658_10035774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4000 | Open in IMG/M |
| 3300005327|Ga0070658_10042701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3663 | Open in IMG/M |
| 3300005327|Ga0070658_10618082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 939 | Open in IMG/M |
| 3300005330|Ga0070690_100001384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 12638 | Open in IMG/M |
| 3300005337|Ga0070682_100635302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 848 | Open in IMG/M |
| 3300005339|Ga0070660_100042187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3481 | Open in IMG/M |
| 3300005339|Ga0070660_100390421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1150 | Open in IMG/M |
| 3300005339|Ga0070660_100913025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 741 | Open in IMG/M |
| 3300005364|Ga0070673_100024442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4431 | Open in IMG/M |
| 3300005455|Ga0070663_101254437 | Not Available | 653 | Open in IMG/M |
| 3300005456|Ga0070678_101937369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 557 | Open in IMG/M |
| 3300005513|Ga0077120_1033510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3408 | Open in IMG/M |
| 3300005513|Ga0077120_1057104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2116 | Open in IMG/M |
| 3300005519|Ga0077119_10047516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2996 | Open in IMG/M |
| 3300005519|Ga0077119_10106416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1511 | Open in IMG/M |
| 3300005538|Ga0070731_10824780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 615 | Open in IMG/M |
| 3300005563|Ga0068855_100002610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 22210 | Open in IMG/M |
| 3300005577|Ga0068857_100615335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1027 | Open in IMG/M |
| 3300005616|Ga0068852_101689736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 656 | Open in IMG/M |
| 3300009093|Ga0105240_10048660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5356 | Open in IMG/M |
| 3300009093|Ga0105240_10054818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4994 | Open in IMG/M |
| 3300009093|Ga0105240_11074505 | Not Available | 857 | Open in IMG/M |
| 3300009101|Ga0105247_11633170 | Not Available | 530 | Open in IMG/M |
| 3300009551|Ga0105238_11502939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 702 | Open in IMG/M |
| 3300009660|Ga0105854_1053559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1234 | Open in IMG/M |
| 3300009709|Ga0116227_10324148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1178 | Open in IMG/M |
| 3300009787|Ga0116226_10159550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2346 | Open in IMG/M |
| 3300010331|Ga0123336_10547323 | Not Available | 573 | Open in IMG/M |
| 3300010371|Ga0134125_12162455 | Not Available | 605 | Open in IMG/M |
| 3300010375|Ga0105239_11004250 | Not Available | 959 | Open in IMG/M |
| 3300010375|Ga0105239_12125110 | Not Available | 652 | Open in IMG/M |
| 3300010877|Ga0126356_10765505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 746 | Open in IMG/M |
| 3300012469|Ga0150984_117292753 | Not Available | 666 | Open in IMG/M |
| 3300013105|Ga0157369_11359797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 723 | Open in IMG/M |
| 3300013296|Ga0157374_10626410 | Not Available | 1087 | Open in IMG/M |
| 3300013296|Ga0157374_11954371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 613 | Open in IMG/M |
| 3300014168|Ga0181534_10654043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 610 | Open in IMG/M |
| 3300014968|Ga0157379_10481339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1149 | Open in IMG/M |
| 3300015262|Ga0182007_10078797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1080 | Open in IMG/M |
| 3300015371|Ga0132258_10615078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2729 | Open in IMG/M |
| 3300016341|Ga0182035_10000633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 16682 | Open in IMG/M |
| 3300018037|Ga0187883_10709461 | Not Available | 525 | Open in IMG/M |
| 3300021178|Ga0210408_10474715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 995 | Open in IMG/M |
| 3300021403|Ga0210397_10019721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4134 | Open in IMG/M |
| 3300021478|Ga0210402_10515117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1111 | Open in IMG/M |
| 3300021860|Ga0213851_1067922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 768 | Open in IMG/M |
| 3300022870|Ga0247782_1002476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2634 | Open in IMG/M |
| 3300025226|Ga0209674_100067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 253824 | Open in IMG/M |
| 3300025228|Ga0209672_106752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1832 | Open in IMG/M |
| 3300025230|Ga0209563_110888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1306 | Open in IMG/M |
| 3300025231|Ga0207427_100959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 12286 | Open in IMG/M |
| 3300025242|Ga0209258_100459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 44386 | Open in IMG/M |
| 3300025246|Ga0209646_1000244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 55661 | Open in IMG/M |
| 3300025250|Ga0209026_1064262 | Not Available | 514 | Open in IMG/M |
| 3300025253|Ga0209677_101817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 8730 | Open in IMG/M |
| 3300025256|Ga0209759_1001872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 10432 | Open in IMG/M |
| 3300025909|Ga0207705_10229040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1413 | Open in IMG/M |
| 3300025909|Ga0207705_10423543 | Not Available | 1031 | Open in IMG/M |
| 3300025909|Ga0207705_10990104 | Not Available | 650 | Open in IMG/M |
| 3300025911|Ga0207654_10172385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1406 | Open in IMG/M |
| 3300025913|Ga0207695_10020855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7488 | Open in IMG/M |
| 3300025913|Ga0207695_10433107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1199 | Open in IMG/M |
| 3300025927|Ga0207687_10352162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1200 | Open in IMG/M |
| 3300025932|Ga0207690_10116964 | Not Available | 1929 | Open in IMG/M |
| 3300025932|Ga0207690_11008916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 692 | Open in IMG/M |
| 3300025942|Ga0207689_10021600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5411 | Open in IMG/M |
| 3300025949|Ga0207667_10026339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6356 | Open in IMG/M |
| 3300025949|Ga0207667_10102002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2960 | Open in IMG/M |
| 3300025960|Ga0207651_11055216 | Not Available | 727 | Open in IMG/M |
| 3300026023|Ga0207677_10795664 | Not Available | 846 | Open in IMG/M |
| 3300026116|Ga0207674_10177484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2082 | Open in IMG/M |
| 3300026116|Ga0207674_10310870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1525 | Open in IMG/M |
| 3300026118|Ga0207675_100052915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3788 | Open in IMG/M |
| 3300026121|Ga0207683_11509465 | Not Available | 620 | Open in IMG/M |
| 3300027504|Ga0209114_1091336 | Not Available | 561 | Open in IMG/M |
| 3300027817|Ga0209112_10017928 | Not Available | 2029 | Open in IMG/M |
| 3300027860|Ga0209611_10187083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1277 | Open in IMG/M |
| 3300028562|Ga0302151_10000148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 43475 | Open in IMG/M |
| 3300028562|Ga0302151_10312645 | Not Available | 520 | Open in IMG/M |
| 3300028565|Ga0302145_10152086 | Not Available | 780 | Open in IMG/M |
| 3300028666|Ga0265336_10000087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 72636 | Open in IMG/M |
| 3300028783|Ga0302279_10002894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 22032 | Open in IMG/M |
| 3300028789|Ga0302232_10514706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. | 588 | Open in IMG/M |
| 3300028813|Ga0302157_10079770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2134 | Open in IMG/M |
| 3300028813|Ga0302157_10298883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii | 881 | Open in IMG/M |
| 3300028870|Ga0302254_10028114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1979 | Open in IMG/M |
| 3300029896|Ga0247044_1083542 | Not Available | 558 | Open in IMG/M |
| 3300029945|Ga0311330_10414945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1111 | Open in IMG/M |
| 3300029987|Ga0311334_10524434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 955 | Open in IMG/M |
| 3300030000|Ga0311337_10525955 | Not Available | 1013 | Open in IMG/M |
| 3300030010|Ga0302299_10066813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2006 | Open in IMG/M |
| 3300030114|Ga0311333_10778122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 802 | Open in IMG/M |
| 3300030294|Ga0311349_10993414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 787 | Open in IMG/M |
| 3300030521|Ga0307511_10043501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3752 | Open in IMG/M |
| 3300030524|Ga0311357_10247782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1725 | Open in IMG/M |
| 3300030838|Ga0311335_11151674 | Not Available | 556 | Open in IMG/M |
| 3300031716|Ga0310813_10016940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4887 | Open in IMG/M |
| 3300031730|Ga0307516_10004805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 16463 | Open in IMG/M |
| 3300031747|Ga0318502_10000845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. B508-1 | 10440 | Open in IMG/M |
| 3300031902|Ga0302322_101705320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 771 | Open in IMG/M |
| 3300031918|Ga0311367_10252789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1835 | Open in IMG/M |
| 3300031918|Ga0311367_11559505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. | 647 | Open in IMG/M |
| 3300031939|Ga0308174_11051639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 692 | Open in IMG/M |
| 3300032090|Ga0318518_10124534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1300 | Open in IMG/M |
| 3300032261|Ga0306920_103318598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 600 | Open in IMG/M |
| 3300032954|Ga0335083_10469743 | Not Available | 1059 | Open in IMG/M |
| 3300034170|Ga0370487_0001647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5203 | Open in IMG/M |
| 3300034170|Ga0370487_0263621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 10.34% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.76% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 6.90% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.03% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 2.59% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.86% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Host-Associated | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Host-Associated | Open in IMG/M |
| 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005519 | Combined assembly of arab plate scrape CL_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010331 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022870 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5 | Environmental | Open in IMG/M |
| 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029896 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3b | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25156J39149_100006321 | 3300002705 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPDRPQ* |
| JGI25156J39149_10171651 | 3300002705 | Arabidopsis Root | MGWIVFEAMLALAAALVVVWWTFRGRADSVDDEADAEER* |
| JGI25156J39149_10465622 | 3300002705 | Arabidopsis Root | MGWIVFEALLALGVMLALVWWTFRGRAETATDEDDVDAP* |
| rootH1_100177752 | 3300003316 | Sugarcane Root And Bulk Soil | MGWMLFEAMLALGVMLAVVWWTFRGRAEREDDAAEDSADRPQ* |
| rootH1_100177762 | 3300003316 | Sugarcane Root And Bulk Soil | MGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDTGTPPGRQ* |
| rootH2_100072816 | 3300003320 | Sugarcane Root And Bulk Soil | MGWMLFEAMLALAALVAAVWWTFRGRVEDDDDPESADRPQ* |
| Ga0055539_10003037 | 3300003752 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAERDEDEAEDSADRSQ* |
| Ga0055535_10076014 | 3300003761 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ* |
| Ga0070658_100357743 | 3300005327 | Corn Rhizosphere | MGWIVFEALLALGAMLALVWWTFRGRADTADDETDADRPQ* |
| Ga0070658_100427015 | 3300005327 | Corn Rhizosphere | MGWMLFEAMLALGVVLAVVWWTFRGRAERVEDESDAEETP* |
| Ga0070658_106180822 | 3300005327 | Corn Rhizosphere | MGWIVFEALLALGAMLALVWWTFRGRADTAEDESDPEPPQ* |
| Ga0070690_1000013847 | 3300005330 | Switchgrass Rhizosphere | MGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ* |
| Ga0070682_1006353022 | 3300005337 | Corn Rhizosphere | MGWMLFEAMLALGVVLAVVWWTFHGRAENDDDAGDAEGPADGRQ* |
| Ga0070660_1000421873 | 3300005339 | Corn Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTTVEEDDADAS* |
| Ga0070660_1003904212 | 3300005339 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ* |
| Ga0070660_1009130253 | 3300005339 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ* |
| Ga0070673_1000244423 | 3300005364 | Switchgrass Rhizosphere | MGWIVFEALLALGVLLALVWWTFRGRADSAADEDDADPS* |
| Ga0070663_1012544371 | 3300005455 | Corn Rhizosphere | WMLFEAMLALGVMLAVVWWTFRGRAENDDDAEVDEPEGPQ* |
| Ga0070678_1019373692 | 3300005456 | Miscanthus Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAERVDDEADAEDQ* |
| Ga0077120_10335102 | 3300005513 | Arabidopsis Rhizosphere | MGWMVFEAMLALAAVLAIVWWTFRGRSDGDDGEEDA* |
| Ga0077120_10571043 | 3300005513 | Arabidopsis Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADPSQSRH* |
| Ga0077119_100475164 | 3300005519 | Arabidopsis Root | MGWIVFEAMLALAAMLVAVWWTFRGRAESVDDEAEAEERVER* |
| Ga0077119_101064164 | 3300005519 | Arabidopsis Root | MGWMAFEALLALFVMLAVVWWTFRGRAGQDDDEPDSEHPADKPQ* |
| Ga0070731_108247802 | 3300005538 | Surface Soil | MGWIVFEAMLALCVMLAVVWWTFRGRAKPDADEADSEADKPQ* |
| Ga0068855_1000026106 | 3300005563 | Corn Rhizosphere | MLFEAMLALGVMLAVVWWTFRGRAENDDDAGDADEPADGRQ* |
| Ga0068857_1006153353 | 3300005577 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPQ* |
| Ga0068852_1016897362 | 3300005616 | Corn Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADAS* |
| Ga0105240_100486604 | 3300009093 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDDSTQ* |
| Ga0105240_100548184 | 3300009093 | Corn Rhizosphere | MGWMLFEAMLALGVVLAVVWWTFRGRADNDDDADADADAPQ* |
| Ga0105240_110745052 | 3300009093 | Corn Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDVDAS* |
| Ga0105247_116331701 | 3300009101 | Switchgrass Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPVDGRQ* |
| Ga0105238_115029393 | 3300009551 | Corn Rhizosphere | FEAMLALGVMLAVVWWTFRGRAENDGDAGDADEPADGRQ* |
| Ga0105854_10535593 | 3300009660 | Permafrost Soil | MGWIVFEAMLALVVMLAVVWWTFRGRADIEADDAEPPADKP* |
| Ga0116227_103241482 | 3300009709 | Host-Associated | MGWILFEAMLALTVAMVVVWWTFRGRAEPDPVDTDDEADS* |
| Ga0116226_101595503 | 3300009787 | Host-Associated | MGWIVFEAMLALAVMLALVWWTFRGRADTDADEPDNDKP* |
| Ga0123336_105473231 | 3300010331 | Glacier Valley | MGWIVFEALLALAVMLAVVWWTFRGRADVAEADADAPGDER* |
| Ga0134125_121624552 | 3300010371 | Terrestrial Soil | MGWIVFEALLALGAMLALVWWTFRGRADTADDESDPDRPQ* |
| Ga0105239_110042503 | 3300010375 | Corn Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADSAVDEDDADAS* |
| Ga0105239_121251102 | 3300010375 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDGDAGDADEPADGRQ* |
| Ga0126356_107655052 | 3300010877 | Boreal Forest Soil | MTAKRDLMGWIVFEAMLALAVMLAVVWWTFRGRADTEADDAEPPADKP* |
| Ga0150984_1172927531 | 3300012469 | Avena Fatua Rhizosphere | RDLMGWMLFEAMLALAVMLAVVWWTFRGRTDKDDADADEPDR* |
| Ga0157369_113597971 | 3300013105 | Corn Rhizosphere | ADRDLMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ* |
| Ga0157374_106264103 | 3300013296 | Miscanthus Rhizosphere | MGWMVFEALLALAVMLALVWWTFRGRAETAADEDDADKS* |
| Ga0157374_119543712 | 3300013296 | Miscanthus Rhizosphere | MGWIVFEALLALVVMLALVWWTFRGRAETATDEDDVDPS* |
| Ga0181534_106540432 | 3300014168 | Bog | MGWILFEAMLALAAMLLAVWWTFRGRADGVDDEADADER* |
| Ga0157379_104813392 | 3300014968 | Switchgrass Rhizosphere | MGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDADETPGGRQ* |
| Ga0182007_100787971 | 3300015262 | Rhizosphere | MGWMLFEAKLALAVMLAAVWWTFRGRSERSDEAADAEDGPGEGQ* |
| Ga0132258_106150782 | 3300015371 | Arabidopsis Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTDDAEGPADGRQ* |
| Ga0182035_1000063315 | 3300016341 | Soil | MLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ |
| Ga0187883_107094611 | 3300018037 | Peatland | KRDLMGWILFEAMLALAVMLVWVWWTFRGRADDIGSDDAEAEPPADKP |
| Ga0210408_104747151 | 3300021178 | Soil | MGWIVFEAMLALAALLVAVWWTFRGRADSGDDESDAGEG |
| Ga0210397_100197214 | 3300021403 | Soil | MGWIVFEAMLALCVMLAVVWWTFRGRADDASSPDEPDQDPPADKP |
| Ga0210402_105151172 | 3300021478 | Soil | MGWIVFEAMLALCVMLAVVWWTFRGRADPDADEPDKDADKP |
| Ga0213851_10679222 | 3300021860 | Watersheds | MGWIVFEALLALTVLLVAVWWTFRGRAESVDADDET |
| Ga0247782_10024764 | 3300022870 | Plant Litter | MGWIVFEALLALAVMLAVVWWTFRGRADVADADADAPDDEGSR |
| Ga0209674_100067140 | 3300025226 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAERDEDEAEDSADRSQ |
| Ga0209672_1067522 | 3300025228 | Arabidopsis Root | MGWIVFEAMLALAAALVVVWWTFRGRADSVDDEADAEER |
| Ga0209563_1108882 | 3300025230 | Arabidopsis Root | MGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADPSQSRH |
| Ga0207427_10095910 | 3300025231 | Arabidopsis Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDDSTQ |
| Ga0209258_10045931 | 3300025242 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ |
| Ga0209646_100024421 | 3300025246 | Arabidopsis Root | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPDRPQ |
| Ga0209026_10642622 | 3300025250 | Arabidopsis Root | MGWIVFEAMLALAAMLVAVWWTFRGRAESVDDEAEAEERVER |
| Ga0209677_1018175 | 3300025253 | Arabidopsis Root | MGWMVFEAMLALAAVLAIVWWTFRGRSDGDDGEEDA |
| Ga0209759_10018727 | 3300025256 | Arabidopsis Root | MGWIVFEALLALGVMLALVWWTFRGRAETATDEDDVDAP |
| Ga0207705_102290402 | 3300025909 | Corn Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTTVEEDDADAS |
| Ga0207705_104235432 | 3300025909 | Corn Rhizosphere | MGWMVFEAMLALAAVLAIVWWTFRGRSDGGDDGEEDA |
| Ga0207705_109901042 | 3300025909 | Corn Rhizosphere | MGWMLFEAMLALGVVLAVVWWTFRGRAERVEDESDAEETP |
| Ga0207654_101723852 | 3300025911 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ |
| Ga0207695_100208554 | 3300025913 | Corn Rhizosphere | MGWMLFEAMLALGVVLAVVWWTFRGRADNDDDADADADAPQ |
| Ga0207695_104331072 | 3300025913 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEEEVDEPEG |
| Ga0207687_103521622 | 3300025927 | Miscanthus Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDAGDAEGPVDGRQ |
| Ga0207690_101169642 | 3300025932 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ |
| Ga0207690_110089161 | 3300025932 | Corn Rhizosphere | MGWMVFEAMLALAAVLAIVWWTFRGRSDDAEDDETQ |
| Ga0207689_100216002 | 3300025942 | Miscanthus Rhizosphere | MLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ |
| Ga0207667_100263394 | 3300025949 | Corn Rhizosphere | MLFEAMLALGVMLAVVWWTFRGRAENDDDAGDADEPADGRQ |
| Ga0207667_101020022 | 3300025949 | Corn Rhizosphere | MLFEAMLALGVMLAVVWWTFRGRAENDDGADADEPDRPQ |
| Ga0207651_110552162 | 3300025960 | Switchgrass Rhizosphere | MGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADAS |
| Ga0207677_107956643 | 3300026023 | Miscanthus Rhizosphere | DLMGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ |
| Ga0207674_101774843 | 3300026116 | Corn Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPQ |
| Ga0207674_103108702 | 3300026116 | Corn Rhizosphere | MLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ |
| Ga0207675_1000529154 | 3300026118 | Switchgrass Rhizosphere | MGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ |
| Ga0207683_115094652 | 3300026121 | Miscanthus Rhizosphere | MGWMLFEAMLALGVMLAVVWWTFRGRAERVDDEADAEDQ |
| Ga0209114_10913362 | 3300027504 | Forest Soil | MGWIVFEAMLALCVMLAVVWWTFRGRADDDSPDEPEKDVPADKP |
| Ga0209112_100179284 | 3300027817 | Forest Soil | KRDLMGWIAFEAMLALCVMLAVVWWTFRGRAKPDADEAEQDVDSPQ |
| Ga0209611_101870832 | 3300027860 | Host-Associated | MGWIVFEAMLALAVMLALVWWTFRGRADTGADESDNDKP |
| Ga0302151_100001488 | 3300028562 | Bog | MGWILFEAMLALTVAMVAVWWTFRGRADPDAVDTDADAPGE |
| Ga0302151_103126452 | 3300028562 | Bog | DLMGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP |
| Ga0302145_101520863 | 3300028565 | Bog | LMGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP |
| Ga0265336_1000008740 | 3300028666 | Rhizosphere | MGWIVFEALLALAVMLALVWWTFRGRAEVGADAPDSERADDS |
| Ga0302279_1000289419 | 3300028783 | Bog | MGWIVFEAMLALTVMLAVVWWTFRGRTTDTADEPPADESPVDKA |
| Ga0302232_105147062 | 3300028789 | Palsa | MGWIVFEAMLALCVMLAVVWWTFRGRADPDPDADERDNEADKPQ |
| Ga0302157_100797702 | 3300028813 | Bog | MGWIVFEAMLALAVMLALVWWTFRGRAETGADDGDNDKS |
| Ga0302157_102988833 | 3300028813 | Bog | FEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPVDKP |
| Ga0302254_100281141 | 3300028870 | Fen | MGWILFEALLALAVMVAAAWWTFRGRREPAVTEPGAGP |
| Ga0247044_10835422 | 3300029896 | Cryconite | MGWIVFEALLALAVMLAVVWWTFRGRADVAEEDADAPGDER |
| Ga0311330_104149453 | 3300029945 | Bog | MGWIVFEAMLALAAMLVAVWWTFRGRADSVDEESDTEER |
| Ga0311334_105244342 | 3300029987 | Fen | MGWIVFEAMLALAVMLAVVWWTFRGRADDEPDEPDADER |
| Ga0311337_105259552 | 3300030000 | Fen | MGWIVFEALLALAVMLAVVWWTFRGRADDEPDEPDEPGADAS |
| Ga0302299_100668132 | 3300030010 | Fen | MGWIVFEAMLALAVMLAVVWWTFRGRADDEPDEPDTDER |
| Ga0311333_107781222 | 3300030114 | Fen | MGWIVFEALLALGVMLALVWWTVRGRSDAQAEDAQPPGDEP |
| Ga0311349_109934142 | 3300030294 | Fen | MGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRR |
| Ga0307511_100435013 | 3300030521 | Ectomycorrhiza | MGWMAFEALLALLVMLAVVWWTFRGRAGQDDDEPDSEHPADKPQ |
| Ga0311357_102477821 | 3300030524 | Palsa | MGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP |
| Ga0311335_111516742 | 3300030838 | Fen | MGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRG |
| Ga0310813_100169402 | 3300031716 | Soil | MGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTDDAEGPADGRQ |
| Ga0307516_100048059 | 3300031730 | Ectomycorrhiza | MGWIVFEALLALAVMLALVWWTFRGRADRDGDEPDTESPTDKR |
| Ga0318502_100008452 | 3300031747 | Soil | MGWMLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ |
| Ga0302322_1017053201 | 3300031902 | Fen | RDLMGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRR |
| Ga0311367_102527892 | 3300031918 | Fen | MGWIVFEALLALAVMLAVVWWTFRGRADAAGDDEDDVDTP |
| Ga0311367_115595052 | 3300031918 | Fen | MGWIVFEAMLALAVLLVAVWWTLRGRADSVDDEADAGEN |
| Ga0308174_110516392 | 3300031939 | Soil | MGWIVFEALLALGVLLALVWWTFRGRADSAVEEDDADRS |
| Ga0318518_101245341 | 3300032090 | Soil | GWMLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ |
| Ga0306920_1033185981 | 3300032261 | Soil | MGWMLFEAMVALVAMLAVVWWTFRGRAEGGEDDADDRADGRQ |
| Ga0335083_104697432 | 3300032954 | Soil | MGWIVFEAMLALCVMLAVVWWTFRGRAKSDADEADNEADRPQ |
| Ga0370487_0001647_1222_1353 | 3300034170 | Untreated Peat Soil | MGWIVFEAMLALVVMLALVWWTIRGRADNGSEDADSELPADER |
| Ga0370487_0263621_2_118 | 3300034170 | Untreated Peat Soil | MGWIVFEALLALSVLLVAVWWTFRGRADGVDDEADAEGR |
| ⦗Top⦘ |