| Basic Information | |
|---|---|
| Family ID | F078124 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AAEQTKADVLVIGHNPLRGHLGDNGNGYGIIRESHIPVLSV |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.45 % |
| % of genes near scaffold ends (potentially truncated) | 94.83 % |
| % of genes from short scaffolds (< 2000 bps) | 86.21 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.207 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (20.690 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (39.655 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.29% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13453 | zf-TFIIB | 8.62 |
| PF00072 | Response_reg | 7.76 |
| PF09851 | SHOCT | 6.90 |
| PF00690 | Cation_ATPase_N | 3.45 |
| PF02781 | G6PD_C | 3.45 |
| PF00231 | ATP-synt | 2.59 |
| PF10091 | Glycoamylase | 2.59 |
| PF00121 | TIM | 2.59 |
| PF04972 | BON | 1.72 |
| PF02321 | OEP | 1.72 |
| PF01339 | CheB_methylest | 1.72 |
| PF00582 | Usp | 1.72 |
| PF02585 | PIG-L | 1.72 |
| PF00403 | HMA | 0.86 |
| PF00342 | PGI | 0.86 |
| PF13460 | NAD_binding_10 | 0.86 |
| PF01904 | DUF72 | 0.86 |
| PF11964 | SpoIIAA-like | 0.86 |
| PF00871 | Acetate_kinase | 0.86 |
| PF08282 | Hydrolase_3 | 0.86 |
| PF02518 | HATPase_c | 0.86 |
| PF00487 | FA_desaturase | 0.86 |
| PF08240 | ADH_N | 0.86 |
| PF01988 | VIT1 | 0.86 |
| PF02790 | COX2_TM | 0.86 |
| PF00346 | Complex1_49kDa | 0.86 |
| PF00702 | Hydrolase | 0.86 |
| PF00005 | ABC_tran | 0.86 |
| PF00589 | Phage_integrase | 0.86 |
| PF08327 | AHSA1 | 0.86 |
| PF09209 | CecR_C | 0.86 |
| PF01262 | AlaDh_PNT_C | 0.86 |
| PF11154 | DUF2934 | 0.86 |
| PF11737 | DUF3300 | 0.86 |
| PF03572 | Peptidase_S41 | 0.86 |
| PF01739 | CheR | 0.86 |
| PF13592 | HTH_33 | 0.86 |
| PF05239 | PRC | 0.86 |
| PF01292 | Ni_hydr_CYTB | 0.86 |
| PF00923 | TAL_FSA | 0.86 |
| PF03976 | PPK2 | 0.86 |
| PF04041 | Glyco_hydro_130 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 3.45 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 3.45 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 3.45 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 3.45 |
| COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 2.59 |
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 2.59 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.72 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.72 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.72 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.86 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.86 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.86 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.86 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.86 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.86 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.86 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.86 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.86 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.86 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.86 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.86 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.86 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.86 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.86 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.86 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.86 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.86 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.86 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.86 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.21 % |
| Unclassified | root | N/A | 38.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005541|Ga0070733_10008527 | All Organisms → cellular organisms → Bacteria | 6537 | Open in IMG/M |
| 3300005541|Ga0070733_10854578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 611 | Open in IMG/M |
| 3300005563|Ga0068855_100780750 | Not Available | 1016 | Open in IMG/M |
| 3300009518|Ga0116128_1222264 | Not Available | 528 | Open in IMG/M |
| 3300009621|Ga0116116_1045874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300009623|Ga0116133_1022744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Silvimonas → Silvimonas terrae | 1550 | Open in IMG/M |
| 3300009623|Ga0116133_1023808 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300009632|Ga0116102_1062741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300009637|Ga0116118_1150942 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300009640|Ga0116126_1109409 | Not Available | 971 | Open in IMG/M |
| 3300009643|Ga0116110_1056270 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300009645|Ga0116106_1294682 | Not Available | 516 | Open in IMG/M |
| 3300009665|Ga0116135_1160328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 844 | Open in IMG/M |
| 3300009764|Ga0116134_1354586 | Not Available | 503 | Open in IMG/M |
| 3300010379|Ga0136449_100067151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7755 | Open in IMG/M |
| 3300014151|Ga0181539_1030402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2802 | Open in IMG/M |
| 3300014153|Ga0181527_1040940 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300014155|Ga0181524_10298721 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014156|Ga0181518_10090215 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300014156|Ga0181518_10190303 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300014160|Ga0181517_10599981 | Not Available | 551 | Open in IMG/M |
| 3300014161|Ga0181529_10179485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300014165|Ga0181523_10062061 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300014167|Ga0181528_10261787 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300014200|Ga0181526_10127775 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300014489|Ga0182018_10106916 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300014490|Ga0182010_10444581 | Not Available | 711 | Open in IMG/M |
| 3300014491|Ga0182014_10496102 | Not Available | 599 | Open in IMG/M |
| 3300014493|Ga0182016_10020356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5946 | Open in IMG/M |
| 3300014493|Ga0182016_10137972 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300014493|Ga0182016_10843862 | Not Available | 508 | Open in IMG/M |
| 3300014495|Ga0182015_10195588 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300014495|Ga0182015_10944586 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 538 | Open in IMG/M |
| 3300014501|Ga0182024_10695801 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300014501|Ga0182024_11723170 | Not Available | 705 | Open in IMG/M |
| 3300014501|Ga0182024_12099846 | Not Available | 621 | Open in IMG/M |
| 3300014658|Ga0181519_10882305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 554 | Open in IMG/M |
| 3300014838|Ga0182030_10343599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1602 | Open in IMG/M |
| 3300014838|Ga0182030_10753038 | Not Available | 901 | Open in IMG/M |
| 3300016702|Ga0181511_1319870 | Not Available | 758 | Open in IMG/M |
| 3300016750|Ga0181505_10606724 | Not Available | 571 | Open in IMG/M |
| 3300017929|Ga0187849_1321924 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017988|Ga0181520_11091494 | Not Available | 525 | Open in IMG/M |
| 3300017996|Ga0187891_1175246 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300017998|Ga0187870_1244604 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300018003|Ga0187876_1104314 | Not Available | 1047 | Open in IMG/M |
| 3300018008|Ga0187888_1356852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018009|Ga0187884_10460104 | Not Available | 511 | Open in IMG/M |
| 3300018014|Ga0187860_1113688 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300018030|Ga0187869_10177869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300018033|Ga0187867_10443705 | Not Available | 717 | Open in IMG/M |
| 3300018033|Ga0187867_10710606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales | 547 | Open in IMG/M |
| 3300018034|Ga0187863_10877354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300018043|Ga0187887_10208939 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300018044|Ga0187890_10054592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2372 | Open in IMG/M |
| 3300019082|Ga0187852_1407420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300019787|Ga0182031_1339694 | Not Available | 1148 | Open in IMG/M |
| 3300019788|Ga0182028_1534116 | Not Available | 1412 | Open in IMG/M |
| 3300020583|Ga0210401_10568933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 995 | Open in IMG/M |
| 3300022733|Ga0224562_1014230 | Not Available | 641 | Open in IMG/M |
| 3300023101|Ga0224557_1110635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1088 | Open in IMG/M |
| 3300025312|Ga0209321_10264298 | Not Available | 858 | Open in IMG/M |
| 3300025442|Ga0208034_1073274 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300025444|Ga0208189_1042183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 887 | Open in IMG/M |
| 3300025446|Ga0208038_1071367 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025453|Ga0208455_1017716 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300025453|Ga0208455_1064337 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300025498|Ga0208819_1050740 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300025506|Ga0208937_1101194 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300025911|Ga0207654_10157579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1463 | Open in IMG/M |
| 3300025981|Ga0207640_11866525 | Not Available | 544 | Open in IMG/M |
| 3300026222|Ga0209862_1050484 | Not Available | 750 | Open in IMG/M |
| 3300026456|Ga0255351_1006122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3744 | Open in IMG/M |
| 3300027908|Ga0209006_11022010 | Not Available | 656 | Open in IMG/M |
| 3300028090|Ga0255349_1009214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2664 | Open in IMG/M |
| 3300028748|Ga0302156_10338688 | Not Available | 666 | Open in IMG/M |
| 3300028759|Ga0302224_10203716 | Not Available | 784 | Open in IMG/M |
| 3300028795|Ga0302227_10378788 | Not Available | 537 | Open in IMG/M |
| 3300028798|Ga0302222_10089691 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300028798|Ga0302222_10370092 | Not Available | 559 | Open in IMG/M |
| 3300028800|Ga0265338_10395056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium GWF2_62_7 | 987 | Open in IMG/M |
| 3300028866|Ga0302278_10107735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1534 | Open in IMG/M |
| 3300028874|Ga0302155_10110026 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300028882|Ga0302154_10071117 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300029939|Ga0311328_10957159 | Not Available | 561 | Open in IMG/M |
| 3300029943|Ga0311340_10094796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3310 | Open in IMG/M |
| 3300029952|Ga0311346_10148647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2787 | Open in IMG/M |
| 3300029953|Ga0311343_10018985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9718 | Open in IMG/M |
| 3300029999|Ga0311339_10376973 | Not Available | 1489 | Open in IMG/M |
| 3300030007|Ga0311338_10198505 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300030020|Ga0311344_10228544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1872 | Open in IMG/M |
| 3300030044|Ga0302281_10127492 | Not Available | 1139 | Open in IMG/M |
| 3300030054|Ga0302182_10225552 | Not Available | 798 | Open in IMG/M |
| 3300030057|Ga0302176_10165886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
| 3300030058|Ga0302179_10509554 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300030520|Ga0311372_10373214 | Not Available | 2185 | Open in IMG/M |
| 3300030520|Ga0311372_13047732 | Not Available | 505 | Open in IMG/M |
| 3300030524|Ga0311357_10433939 | Not Available | 1234 | Open in IMG/M |
| 3300030524|Ga0311357_11491220 | Not Available | 573 | Open in IMG/M |
| 3300030580|Ga0311355_10754761 | Not Available | 898 | Open in IMG/M |
| 3300030580|Ga0311355_11023617 | Not Available | 741 | Open in IMG/M |
| 3300030580|Ga0311355_11772932 | Not Available | 525 | Open in IMG/M |
| 3300030617|Ga0311356_12013273 | Not Available | 510 | Open in IMG/M |
| 3300030688|Ga0311345_10172003 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300031233|Ga0302307_10111024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Silvimonas → Silvimonas terrae | 1432 | Open in IMG/M |
| 3300031236|Ga0302324_102306062 | Not Available | 664 | Open in IMG/M |
| 3300031236|Ga0302324_103204605 | Not Available | 538 | Open in IMG/M |
| 3300031240|Ga0265320_10499726 | Not Available | 537 | Open in IMG/M |
| 3300031525|Ga0302326_10547285 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300031525|Ga0302326_11720808 | Not Available | 826 | Open in IMG/M |
| 3300031525|Ga0302326_12870473 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031708|Ga0310686_115756553 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
| 3300031708|Ga0310686_116056293 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300033824|Ga0334840_088638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300034091|Ga0326724_0368039 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300034124|Ga0370483_0340975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas ginsenosidivorax | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 20.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 15.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 10.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 6.03% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
| 3300026456 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2 | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028090 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070733_100085271 | 3300005541 | Surface Soil | EQTKGDLLVIGHMPSGGHLGENGSGYAIIRESHIPVLSVLGPMQRGS* |
| Ga0070733_108545783 | 3300005541 | Surface Soil | AAEQTNADVLVIGHSPGRSHLGDNREGYGIIPESRIPVLSI* |
| Ga0068855_1007807501 | 3300005563 | Corn Rhizosphere | EADVLVIGHIPGRGHLGDNGKGYTIIRASQIPVLSV* |
| Ga0116128_12222641 | 3300009518 | Peatland | EQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0116116_10458741 | 3300009621 | Peatland | DVLVIGHSPVRGHLGDNGNGYGIIRESHIPVLSV* |
| Ga0116133_10227442 | 3300009623 | Peatland | RAAEEAKADLLIIGHMPSGGHLGENGSGYAIIRESHIPVLSV* |
| Ga0116133_10238081 | 3300009623 | Peatland | ADLLVIGHMPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0116102_10627411 | 3300009632 | Peatland | QTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0116118_11509421 | 3300009637 | Peatland | AAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0116126_11094093 | 3300009640 | Peatland | NRAAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0116110_10562704 | 3300009643 | Peatland | LNRTAEQTKADVLVIGHIPSGGHLGANGSGYAIIRKSRVPVLLISA* |
| Ga0116106_12946821 | 3300009645 | Peatland | GNVPELLNRAAEETKADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLSV* |
| Ga0116135_11603283 | 3300009665 | Peatland | DVLVIGRGPGRHHLGDNGEGYGIIRESRIPVLSV* |
| Ga0116134_13545861 | 3300009764 | Peatland | SGNVPELLNRAAEQTKADVLVIGHLPSDGHLGANGGGYAIIRESHIPVLSV* |
| Ga0136449_1000671518 | 3300010379 | Peatlands Soil | AAEQTKADVLVIGHNPLRGHLGDNGNGYGIIRESHIPVLSV* |
| Ga0181539_10304021 | 3300014151 | Bog | RAAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0181527_10409401 | 3300014153 | Bog | TKADVLVIGHSPGRSHLGDNGEGYGIIRESHIPVLSVCFP* |
| Ga0181524_102987212 | 3300014155 | Bog | PELLNRAAEQTKADVLVIGHSPGRSHLGDNGEGYGIIRESQIPVLSVCFS* |
| Ga0181518_100902153 | 3300014156 | Bog | TKADLLVIGHMPSGGHLGANGGGYAIIRESHIPVLSV* |
| Ga0181518_101903032 | 3300014156 | Bog | LNRAAEQTKADVLVIGHSPGRSHLGDNGEGYGIIRESQIPVLSVCFS* |
| Ga0181517_105999811 | 3300014160 | Bog | ADVLVIGHSSVYEHLGANGNGYGIIRASRIPVLSV* |
| Ga0181529_101794851 | 3300014161 | Bog | DLLVIGHSPGRSHLGDNGEGYGIIRESRIPVLSV* |
| Ga0181523_100620611 | 3300014165 | Bog | EQTKADVLVIGHSPGRSHLGDNGEGYGIIRESHIPVLSVCFP* |
| Ga0181528_102617871 | 3300014167 | Bog | AETTSADLLVVGRIPGRSHMGDNGDGYGIIRESRIPVLSV* |
| Ga0181526_101277751 | 3300014200 | Bog | NVHNLLQRAAEQTQSDLLVIGHMPAGGHLGANGSGYAIIRDSHVPVLST* |
| Ga0182018_101069162 | 3300014489 | Palsa | MSGLLNRAAEEANADLLMIGHMPSGGHLGENGSGYVIIRESHIPVLSV* |
| Ga0182010_104445811 | 3300014490 | Fen | QTKADVLVIGHSPGRSHLGDNGEGYGIIRESQIPVLSVCFS* |
| Ga0182014_104961022 | 3300014491 | Bog | ELLNRAAEQARADVMVVGRSPGRNHLGDNGEGYGIIRESHIPVLSA* |
| Ga0182016_100203561 | 3300014493 | Bog | KADVLIIGHIPGRSHLGDNGEGYGIIRESRIPVLSV* |
| Ga0182016_101379721 | 3300014493 | Bog | PELLNRAADHTNADVLVIGHSSVYEHLGANGNGYGIIRASRIPVLSV* |
| Ga0182016_108438621 | 3300014493 | Bog | DVLVIGHRTVYGHLGENGNGYGIIRSSRIPVLSV* |
| Ga0182015_101955882 | 3300014495 | Palsa | MSGLLNRAAEEANADLLIIGHMPYGGHLGENGSGYVIIRESHIPVLSV* |
| Ga0182015_109445861 | 3300014495 | Palsa | LNRAAEQTKADVLVIGHIPGRSHLGDNGNGYGIIRASRIPVLSV* |
| Ga0182024_106958011 | 3300014501 | Permafrost | NVPELLNRAAEETKADLLVIGHMPSGGHLGANGSGYAIIREAHIPVLSV* |
| Ga0182024_117231702 | 3300014501 | Permafrost | AAEQTKADVLVIGHIPGRSHFHLGDNGNCYGIIRESHIQVLSV* |
| Ga0182024_120998461 | 3300014501 | Permafrost | NVPELLNRAAEETKADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLSV* |
| Ga0181519_108823052 | 3300014658 | Bog | LPALNRAVEHAKSDLLVIGHLPSGGHLGANGAGYAVIRDSHIPVLSL* |
| Ga0182030_103435993 | 3300014838 | Bog | AAERTKADVLVIGHIPGRSHLGDNGEGYGIIRKSRIPVLSI* |
| Ga0182030_107530383 | 3300014838 | Bog | AKQTKADVLIIGYIPGRSHLGDNGEGYGIIRESRIPVLSV* |
| Ga0181511_13198701 | 3300016702 | Peatland | RAAEEAKADLLIIGHMPSGGHLGENGSGYAIIRESHIPVLSV |
| Ga0181505_106067242 | 3300016750 | Peatland | LNRAAEEAKADLLIIGHMPSGGHLGENGSGYAIIRESHIPVLSV |
| Ga0187849_13219241 | 3300017929 | Peatland | ADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLSV |
| Ga0181520_110914943 | 3300017988 | Bog | PELLNRAAEQTKADVLVIGHSPGRSHLGDNGEGYGIIRESHIPVLSVYFS |
| Ga0187891_11752461 | 3300017996 | Peatland | EQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0187870_12446041 | 3300017998 | Peatland | AAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0187876_11043141 | 3300018003 | Peatland | NRAAEQTEADVLVIGHSPGQSHLGDNGEGYGIIRESHIPVLSVCFS |
| Ga0187888_13568521 | 3300018008 | Peatland | VPELLNRAAEQTKADVLVTGHSPGRSHLGDNGEGYGIIRESHIPVLSV |
| Ga0187884_104601041 | 3300018009 | Peatland | KADLLIIGHMPSGGHLGENGSGYAIIRESHIPVLSV |
| Ga0187860_11136881 | 3300018014 | Peatland | KADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLNV |
| Ga0187869_101778692 | 3300018030 | Peatland | EQTEADALVIGHIPGRSHLGDNGNGYGIIRESHIPVLSV |
| Ga0187867_104437051 | 3300018033 | Peatland | TKADVLVIGHVPAGGHLGANGSGYAIIRESRVPVLSV |
| Ga0187867_107106061 | 3300018033 | Peatland | QTSADVLVIGHSPGRGHLGDNGNGYGIIRESLIPVLSV |
| Ga0187863_108773541 | 3300018034 | Peatland | NRAVDQAKGDVLVIGHMPSGGHLGENGSGYAIIRESHIPVMSV |
| Ga0187887_102089391 | 3300018043 | Peatland | KADVLVIGHSPVRGHLGDNGNGYGIIRESHIPVLSV |
| Ga0187890_100545921 | 3300018044 | Peatland | AAEQTKADVLVIGHSPGRSHLGDNGEGYGIIRESHIPVLNV |
| Ga0187852_14074202 | 3300019082 | Peatland | PELLNRAAEQTKADVLVTGHSPGRSHLGDNGEGYGIIRESHIPVLSV |
| Ga0182031_13396942 | 3300019787 | Bog | DHTKSDLLVIGHMPPGGHLGENASGYSIIRGSHIPVLSL |
| Ga0182028_15341161 | 3300019788 | Fen | WAAEQTKADVLVTGTAWAKPSGDNGEGYGIIRESHIPVLSV |
| Ga0210401_105689331 | 3300020583 | Soil | NVPELLNRVAERTKVDVPVIGHIPGRSHLGDSGNGYGIIRESHIPVLSV |
| Ga0224562_10142301 | 3300022733 | Soil | NQAAERAKADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLSV |
| Ga0224557_11106353 | 3300023101 | Soil | VDQTKGDVLVIGHMPSGGHLGENGSGYAIIRESHIPVLSV |
| Ga0209321_102642982 | 3300025312 | Soil | ADLLVVGRNPSTGHLRGTGYGIIRESHIPVVSVCRPQVEEL |
| Ga0208034_10732741 | 3300025442 | Peatland | VPELLNRAAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0208189_10421832 | 3300025444 | Peatland | ELLNRAAEQTKADVLVIGYSPLRGHLGDNGNGYGIIRESHLPVLSV |
| Ga0208038_10713671 | 3300025446 | Peatland | NRAAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0208455_10177163 | 3300025453 | Peatland | ETKADLLVIGHMPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0208455_10643372 | 3300025453 | Peatland | AEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0208819_10507402 | 3300025498 | Peatland | TKADLLVIGHMPSGGHLGANGSGYAIIRESHIPVLSV |
| Ga0208937_11011941 | 3300025506 | Peatland | RAAEQTKADVLVIGHLPSGGHLGANGGGYAIIRESHIPVLSV |
| Ga0207654_101575793 | 3300025911 | Corn Rhizosphere | EADVLVIGHIPGRSHLGDNGNGYTIIRASQIPVLSV |
| Ga0207640_118665251 | 3300025981 | Corn Rhizosphere | TEADVLVIGHIPGRSHLGDNGNGYTIIRASQIPVLSV |
| Ga0209862_10504842 | 3300026222 | Permafrost Soil | EQLNRAAERTNADVLVIGHSPQRGHLGDNGNGYGLIRESRIPVLSV |
| Ga0255351_10061225 | 3300026456 | Soil | DSGNVCKLLNRAVDQAKGDVLVIGHMPSGGHLGENGSGYAIIRESHIPVMSV |
| Ga0209006_110220102 | 3300027908 | Forest Soil | NRATAKTKADVLIIGHLPSGGHLGENGSGYGIIRQSHIPVLSVLGPAK |
| Ga0255349_10092144 | 3300028090 | Soil | IDSGNVCKRLNRAVDQAKGDVLVIGHMPSGGHLGENGSGYAIIRESHIPVMSV |
| Ga0302156_103386881 | 3300028748 | Bog | LLSAAAERTGADVLVIGHRPGRSHLGDNGNGYGIIRESRIPVLSV |
| Ga0302224_102037161 | 3300028759 | Palsa | DNVPELLNRVAEQTEADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0302227_103787882 | 3300028795 | Palsa | LLVIGHLPSGGHLGENGSGYGIIRQSHIPVLSVLGPQNRV |
| Ga0302222_100896912 | 3300028798 | Palsa | DLLNRAAEQTKADVLVIGHIPGRSHLGDNGNGYGIIRASRIPVLSV |
| Ga0302222_103700922 | 3300028798 | Palsa | RAAEQTEADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0265338_103950561 | 3300028800 | Rhizosphere | AEQTKADLLVIGHIPGRSHLGDNGNGYGLIVRSQIPVLSV |
| Ga0302278_101077354 | 3300028866 | Bog | LLIRAAEQTKADLLIIGHIPGRSHLGDNGEGYGIIRESRIPVLSV |
| Ga0302155_101100261 | 3300028874 | Bog | VLHLLNQAAEQTKADLLVIGHSPVRGHLGDNGNGYAIIRESRIPVLSV |
| Ga0302154_100711171 | 3300028882 | Bog | AGQTKADVLIIGHIPGRSHLGDNGEGYGIIRESRIPVLSV |
| Ga0311328_109571591 | 3300029939 | Bog | SGDVHQLLNRAAEQSKGDLLVIGHFPPGGHLGANHSGYGIIRESHIPVLSV |
| Ga0311340_100947962 | 3300029943 | Palsa | LNRAAEQTKADVLVIGHIPGRSHLGDNGNGYGIIRASRIPVLSV |
| Ga0311346_101486471 | 3300029952 | Bog | HLDSIIRETQADVLVLGHNPGRGHLGDNGEGYEIIRTSPVPVLSV |
| Ga0311343_1001898511 | 3300029953 | Bog | KAKGDVLVLGHMPCGGHLGENGSGYGIIRESHIPVLSV |
| Ga0311339_103769732 | 3300029999 | Palsa | LKRAAEKIMADVLVIGHKLGRSHLGDNGNGYGIIRESSIPVLSV |
| Ga0311338_101985053 | 3300030007 | Palsa | MAPAAEQTKADVLVVGHTPGRSHLGDNGNGYGIIRESRIPVLSV |
| Ga0311344_102285441 | 3300030020 | Bog | KADVLVIGHIPGRSHLGDNGNGYGIIRASRIPVLSV |
| Ga0302281_101274923 | 3300030044 | Fen | SAAAERTGADVLVIGHRPGRSHLGDNGNGYGIIRESRIPVLSV |
| Ga0302182_102255522 | 3300030054 | Palsa | AAEQTKADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0302176_101658861 | 3300030057 | Palsa | LLVIGHLPSGGHLGENGSGYGIIRQSRIPVLSVLGPQNRV |
| Ga0302179_105095541 | 3300030058 | Palsa | VIGHFVIGHFPSGGHLGTTHCGYGIIRESHIPVLSV |
| Ga0311372_103732144 | 3300030520 | Palsa | GELLNRAAEQTEADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0311372_130477322 | 3300030520 | Palsa | TKADVLVIGHIPGRSHLGDNSNGYGIIRESHIPVLSI |
| Ga0311357_104339391 | 3300030524 | Palsa | EQTKADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0311357_114912202 | 3300030524 | Palsa | QAAEQVKADLLIIGHMPSGGHLGENGSGYAMIRQSHIPVLSV |
| Ga0311355_107547611 | 3300030580 | Palsa | TKADVLVIGHIPGRSHLGDNGNGYGIIRASQIPVLSV |
| Ga0311355_110236171 | 3300030580 | Palsa | HKLLNQAAEQVKTDLLIIGHLPSGGHLGENGSGYAMIRQSHIPVLSV |
| Ga0311355_117729321 | 3300030580 | Palsa | VPELLRRAAEQTKADVLVIGHIPGRSHLGDNSNGYGIIRESHIPVLSI |
| Ga0311356_120132731 | 3300030617 | Palsa | HEMLNRAAERAKGDLLVIGHLPPTGHLGANGGGYSIIRDSHIPVLSV |
| Ga0311345_101720034 | 3300030688 | Bog | PEALNRAAVQTKADVLMIGHIPSGGHLGANGSGYSIIRDSQVPVLSV |
| Ga0302307_101110241 | 3300031233 | Palsa | RAAAQTKADLLVIGHLPSGGHLGENGSGYGIIRQSHIPVLSVLGPQNRV |
| Ga0302324_1023060621 | 3300031236 | Palsa | AAQTKADVLIIGHTPGRSHLGDNGEGYGIIRESRIPVLSV |
| Ga0302324_1032046051 | 3300031236 | Palsa | HLPSGGHLGENGSGYGIIRQSHIPVLSVLGPQNRV |
| Ga0265320_104997262 | 3300031240 | Rhizosphere | KADLLVIGHLPSGGHLGENGSGYGIIRQSHIPVLSVLGPQNRV |
| Ga0302326_105472853 | 3300031525 | Palsa | NRAAEQTKADVLIIGHTPGRSHLGDNGEGYGIIRESRIPVLSV |
| Ga0302326_117208081 | 3300031525 | Palsa | LNRAAELAGSDLLVIGHLPSNGHLGANGAGYAIARESCIPVLRV |
| Ga0302326_128704732 | 3300031525 | Palsa | SGDVHKLLNHAAEQSKSDVLVVGHLPPGGHLGENGSGYGIIRESHIPVLSL |
| Ga0310686_1157565531 | 3300031708 | Soil | SGDVHKMLNQAAEQTKGDLLVIGHLPPGGHLGANGNGYGIIRESRIPVLSV |
| Ga0310686_1160562932 | 3300031708 | Soil | NVPELLKRAAEQTGADVLIIGHIPGRSHLGDNGNGYGIIRVSQIPVLSV |
| Ga0334840_088638_1_123 | 3300033824 | Soil | AERIKADVLVIGRSPGRHHLGDNGEGYGIIRESRIPVLSV |
| Ga0326724_0368039_657_773 | 3300034091 | Peat Soil | HTKADVLVIGHSPIRGHLGDNGNGYGIIRESHIPVLSV |
| Ga0370483_0340975_168_320 | 3300034124 | Untreated Peat Soil | LKVHELLNRAAEQANGDLLGIGHMPSGGHLGANGSGYAIIRESHIPVLSV |
| ⦗Top⦘ |