Basic Information | |
---|---|
Family ID | F078110 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 47 residues |
Representative Sequence | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLPDSA |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 93.10 % |
% of genes from short scaffolds (< 2000 bps) | 96.55 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.138 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (61.207 % of family members) |
Environment Ontology (ENVO) | Unclassified (89.655 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.034 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.99% β-sheet: 0.00% Coil/Unstructured: 87.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF12796 | Ank_2 | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.14 % |
All Organisms | root | All Organisms | 0.86 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 61.21% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 19.83% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300030772 | Coassembly of Cow X Switchgrass | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1006819991 | 3300005330 | Switchgrass Rhizosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQ |
Ga0068859_1013887412 | 3300005617 | Switchgrass Rhizosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGK |
Ga0068859_1024997082 | 3300005617 | Switchgrass Rhizosphere | LHIDAVNLADGDYELFPADSLATQEVNLNCTNLAQDLGQAPE |
Ga0068861_1021585621 | 3300005719 | Switchgrass Rhizosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQE |
Ga0068863_1024294541 | 3300005841 | Switchgrass Rhizosphere | MVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPE |
Ga0068858_1024143672 | 3300005842 | Switchgrass Rhizosphere | LSMNNHNLALHIETVNLADGDYELVPADSRVDQEVILNCANLSQDLGQAP* |
Ga0068860_1026267361 | 3300005843 | Switchgrass Rhizosphere | LHIEAVNLADGEYELVPADSRVDQELNLNCASIAQDLGQAPEVFLPDSAQEGK |
Ga0068862_1015999491 | 3300005844 | Switchgrass Rhizosphere | LHIETVNLADGDYELVPADSRAEQEINLNCANLSQDLGQAPEAFLPDSAQEGKPR |
Ga0105249_130293741 | 3300009553 | Switchgrass Rhizosphere | LHIETVNLADGDYELVPADSRAEQEITLNCTNLSQDLGQAPE |
Ga0105137_1106301 | 3300009972 | Switchgrass Associated | LHIETVNLADGDYELVPADSRVDQEVNLNCANLPQDLG |
Ga0105129_1174631 | 3300009975 | Switchgrass Associated | LHIETVNLADGDYELVPADSRVDQEVNLNCANLPQDLGQAPEAFLPDSAQ |
Ga0105133_1136881 | 3300009981 | Switchgrass Associated | MLQQYHFCMHIEMVNLLDGDYEFVPVDSRVDQEINLNCAN |
Ga0105131_1035552 | 3300009989 | Switchgrass Associated | LHIETVNLADGDYDMVPADSRVDQEVSLNCANLSQDLGQAP |
Ga0105131_1274221 | 3300009989 | Switchgrass Associated | LHIETVNLADGEYELVPADSRVDQEVNLNCANLSQGLGQAPE |
Ga0105120_10523601 | 3300009992 | Switchgrass Associated | LHIETVNLADGDYELVAADSRVDQEVNLNCANLSQD |
Ga0105126_10557171 | 3300009994 | Switchgrass Associated | LHIETVNLADGEYELVPVDSCGVQEANLNCTNLAQDLGQAPEVSL |
Ga0105139_10525632 | 3300009995 | Switchgrass Associated | LHIETVNLADGDYELVPSDSITAESVDLNCGNLKQGLGQALEDY |
Ga0105139_11241861 | 3300009995 | Switchgrass Associated | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAP |
Ga0134126_118792851 | 3300010396 | Terrestrial Soil | MVNLADGEYKLVHADSRVDQEVILSCTNLAQDLDQA |
Ga0157379_123902201 | 3300014968 | Switchgrass Rhizosphere | LHIEAINLADGDYELVPADSRAEQEVNLNYANLSQDLGQAP |
Ga0182101_10157151 | 3300015284 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCTNLSQDLGQAPEAFLPDSA |
Ga0182101_10483631 | 3300015284 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCTNLSQDLGQAPEAFL |
Ga0182105_10301811 | 3300015290 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKPR |
Ga0182103_10509471 | 3300015293 | Switchgrass Phyllosphere | LHIETVNLADGDYEFVPSDSITAESVDLNCANLKQDLG |
Ga0182098_10489272 | 3300015309 | Switchgrass Phyllosphere | MVNLADGEYELVPADSHFDQEVNLNCANLSQDLGQDPEVFLPDSAQE |
Ga0182098_10489301 | 3300015309 | Switchgrass Phyllosphere | LHIEAVNLADGEYELVPADSRVDQEVNLNCANLSQGLGQAPDVFLPDS |
Ga0182098_10867661 | 3300015309 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVPADSRVDQEVDLNCANLSQDLGQTPEAL |
Ga0182162_10780792 | 3300015310 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLPDSAQ |
Ga0182162_11277671 | 3300015310 | Switchgrass Phyllosphere | LRIETVNLADGDYELVPADSRMDQEVNLNCAILSQDLGQAPETFLPDS |
Ga0182182_10849051 | 3300015311 | Switchgrass Phyllosphere | LADGDYELVPADSRVDQEVNLNCANSSQDLGQAP* |
Ga0182182_10892991 | 3300015311 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQDINLNCANLSQDLGQAPEAFLPD |
Ga0182164_10864421 | 3300015313 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCANLSQDLGQAPEAFLPDS |
Ga0182120_10424961 | 3300015315 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVEQEVNLNCANLSQDLGQAPEAFLADS |
Ga0182130_10886231 | 3300015319 | Switchgrass Phyllosphere | IDAVNLADGDYELVPADSLATQEVNLNCTNLAQDLGQAPKDT* |
Ga0182165_10659412 | 3300015320 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSRVEKEVNLNYTNLAQDLGQAPEASLPDSAQEGKL* |
Ga0182134_11406491 | 3300015324 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSCVDQEVNLNCTNLSKDLGQAPEVCLL |
Ga0182148_10406122 | 3300015325 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRAEREVNLNCANLPQDLGQAPEAFLPDSAQ |
Ga0182148_10557312 | 3300015325 | Switchgrass Phyllosphere | LHIETVNLADGDSELVPADSHVDQEINLNCANLSQDLGQAPEAFLPDSAQEGK |
Ga0182148_11344131 | 3300015325 | Switchgrass Phyllosphere | LHIETVNLADGNYELVPADSRVDQEVNLNCANLSQDLGQ |
Ga0182114_11430331 | 3300015327 | Switchgrass Phyllosphere | LHLETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQALEAFLP |
Ga0182152_10948711 | 3300015330 | Switchgrass Phyllosphere | LHIEAINLADGDYELVPTDSRAEQEVNLNCANLSQDLGQAPEAFLPDSAQE |
Ga0182132_11214811 | 3300015334 | Switchgrass Phyllosphere | IFALHIESVNLANGDYELVPSDSLTAMDVNLNYANLKQDLGQAL* |
Ga0182116_10503692 | 3300015335 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSCVVQEANLNFTNLAQDPGQAPEVSLPDSAQEG |
Ga0182116_10765501 | 3300015335 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPAGSLAQEVNLNCTNLAQDLGQAPEVSLPDSAQE |
Ga0182150_10696961 | 3300015336 | Switchgrass Phyllosphere | MVNLADGEYELVTADSRVDQEANLNFTNLVQDLGQAPEVSLPDSA |
Ga0182150_10851772 | 3300015336 | Switchgrass Phyllosphere | LHIETVNLADGEYELMPADSCVVQEANLNCTNLAQDLGQAPEVSLPDSAQEGK |
Ga0182151_11518731 | 3300015337 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSRVDQEVNLNCTNLTQDLGQAPEVSLPES |
Ga0182151_11599171 | 3300015337 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLPDSA |
Ga0182149_10867441 | 3300015339 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSA |
Ga0182149_11027181 | 3300015339 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPTDSRVDHEVSLNCANLSQNLGQAPEAFLPD |
Ga0182149_11425041 | 3300015339 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRMDQEVNLNCANLSQDLGQAPEAFLPDSAQEG |
Ga0182115_12797751 | 3300015348 | Switchgrass Phyllosphere | MHIEAVNLADGDYELVPADSCVTLEVNLNCTNLAQGLGQAPEVPLPDSAQEG |
Ga0182185_11147232 | 3300015349 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQ |
Ga0182185_11811651 | 3300015349 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSCVDQEVNLNCANLSQDLGQAPEAFLPDSAQEGKPR |
Ga0182163_11799251 | 3300015350 | Switchgrass Phyllosphere | MVNLADGDYELVPADSLTQEINLNCTNVAQDLGQAPEASLHDSTQE |
Ga0182169_10780461 | 3300015352 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVEQEVNLNCANLSQDLGQAPEA |
Ga0182169_12291231 | 3300015352 | Switchgrass Phyllosphere | LHIEAVNLADGEYELVPADSHVDQEVNLNCASVAQDLGQVPEV |
Ga0182169_12771011 | 3300015352 | Switchgrass Phyllosphere | EMVNLADGDYELVPSDAITAESVDLNCANLKQDLGQAL* |
Ga0182169_13154631 | 3300015352 | Switchgrass Phyllosphere | MVNLADGDYELVPADSRVDQEVNLNCTNLSQDLGQAPEAF |
Ga0182179_11251232 | 3300015353 | Switchgrass Phyllosphere | MINLADGEYELVPADSRIDQEVNLNCANLSQDLSQAPEVFLPDSA |
Ga0182179_11988601 | 3300015353 | Switchgrass Phyllosphere | LHIETINLADGDYELVPADSRADQEVNLNCANLSQGLGQAPEVFLPNSAQEG |
Ga0182179_11989411 | 3300015353 | Switchgrass Phyllosphere | LHIEAVNLADGDYELMHADSRVDQEANLNCANLSQDLGQAPEVFLPDSAQEGKP |
Ga0182179_13161181 | 3300015353 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVHADSRVDQEVNLNCANLSQDLGQAPEAFLPD |
Ga0182167_11840711 | 3300015354 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSCVVQEANLNCTNLAQDLGQAPE |
Ga0182167_12260141 | 3300015354 | Switchgrass Phyllosphere | LHIEAVNLADGDYELEPADSRVDQEVNLNCANLSQDLGQAPEAFLPDSAQEGK |
Ga0182199_11675441 | 3300017412 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKPR |
Ga0182199_11753011 | 3300017412 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPAGSLAEEVNLNCTNLAQDL |
Ga0182195_10968911 | 3300017414 | Switchgrass Phyllosphere | MHIETANLANGEYELVSADSRVDPEVNLNCANLSQGLGQAPEVFLPDSAQEG |
Ga0182195_12075811 | 3300017414 | Switchgrass Phyllosphere | MTHNLALHIETVNLADGDYELVPADSRAEQEINLNCANLSQ |
Ga0182213_10841571 | 3300017421 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRAEQEINLNCTNLSQDLGQAPEAFLPDSAQE |
Ga0182213_11894871 | 3300017421 | Switchgrass Phyllosphere | LHIETVNLVDGDYELVPADSRIDEEVNLNCANSSQGLGQAPEVFLPDSA |
Ga0182201_10937251 | 3300017422 | Switchgrass Phyllosphere | LHLETANLADGDYELVSADSRVEQEVNLNCANSSQDLGQAPEAFLPDSAQEG |
Ga0182201_11300581 | 3300017422 | Switchgrass Phyllosphere | MVNLADGEYELVPADSRFNQEVNLNYANLSQGLGQAPEVYLPDSA |
Ga0182196_10164661 | 3300017432 | Switchgrass Phyllosphere | MVNLADDEYELVPVDSLAQEVNLNFTNFAQDLGQAPEA |
Ga0182196_10626012 | 3300017432 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKPRSI |
Ga0182196_11150631 | 3300017432 | Switchgrass Phyllosphere | LHIETVNVADGDYELVPADSRVDQEANLNCANLSQGLGQAP |
Ga0182200_10631541 | 3300017439 | Switchgrass Phyllosphere | LHIKTINLADGDYELVPSDSIPAESANLNCANLNQDL |
Ga0182214_11046191 | 3300017440 | Switchgrass Phyllosphere | LHKEAINLADGDYELVPADSRAEQEVNLNCVNLSQDLGQAPEAFLPDSA |
Ga0182215_10772592 | 3300017447 | Switchgrass Phyllosphere | LHIERVNLADGDYELVPADSCVDQEVYLNCANLSQDLGQAPEAFLPDNAQEGKPRS |
Ga0182215_11373781 | 3300017447 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSRVDQEGNLNCTSLSQDLGQAPEVVLTDS |
Ga0182215_11757821 | 3300017447 | Switchgrass Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAQEAFLPDS |
Ga0182216_10999621 | 3300017693 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSHIDQEANLNCTNLAQDLGQAPEVFLPDSAQE |
Ga0207696_11238831 | 3300025711 | Switchgrass Rhizosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQGL |
Ga0268328_10161881 | 3300028050 | Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLPD |
Ga0268306_10232041 | 3300028054 | Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLP |
Ga0268338_10205491 | 3300028055 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEG |
Ga0268332_10682002 | 3300028058 | Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFLPDSAQE |
Ga0268314_10315552 | 3300028061 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQALEAFLP |
Ga0268350_10511611 | 3300028063 | Phyllosphere | LHIETVNLADGDYELVPADSHAEQEINLNCTNLSQDLGQAPEAFLPDSAQEGKPR |
Ga0268350_10513582 | 3300028063 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDS |
Ga0268340_10193351 | 3300028064 | Phyllosphere | MALHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGV |
Ga0268340_10554961 | 3300028064 | Phyllosphere | VVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKPRSII |
Ga0268347_10302091 | 3300028142 | Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVSLNCANLSQDLGQAPE |
Ga0268345_10274111 | 3300028144 | Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKPRSII |
Ga0268336_10265571 | 3300028152 | Phyllosphere | MINLADGDYELVPADSRVDQEVNLNCANLSQDMGQAPEAFLPDSAQEGK |
Ga0268320_10081351 | 3300028153 | Phyllosphere | LHSHIESVNLADGEYELVPADSRIDQEVNLNCANVAQDLG |
Ga0268321_1089431 | 3300028466 | Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQ |
Ga0268333_10068411 | 3300028467 | Phyllosphere | LHIETVNLADGDYELVPADSRAEQEINLNCTNLSQDLGQAPEAFLPDSA |
Ga0268317_10088111 | 3300028468 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFMPDSAQEGKPR |
Ga0268307_10157592 | 3300028470 | Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVTLNCTNLSQDLGQAPEA |
Ga0268307_10178521 | 3300028470 | Phyllosphere | LHIETVNLADGDYELVPADSRMDQEVNLNCANLSQDLGQAPEAFLPDSA |
Ga0268315_10139062 | 3300028472 | Phyllosphere | LHIEAINLADGDYELVPTDSRAEQEVNLNCANLSQDLGQAPEAFLPDSAQEGNPRSI |
Ga0268329_10277811 | 3300028476 | Phyllosphere | LHIETVNLADGDYELVPAYSRAEQEVNLNCTNLSQDLGQA |
Ga0268313_10095041 | 3300028523 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPNSAQEGKP |
Ga0268313_10110942 | 3300028523 | Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLSDSAQEGK |
Ga0268339_10081811 | 3300028526 | Phyllosphere | LHIEAVNLADGDYELVPADSRAEQEVNLNCTNLSQDLGQAPEAFLPDSAQEGV |
Ga0061013_128302661 | 3300030772 | Fungi-Associated Bovine Rumen | LHIETVNLADGEYELVPADSRVDQEVNLNCANLSQGLGQ |
Ga0214493_10195921 | 3300032465 | Switchgrass Phyllosphere | LHIETVNLADGEYKLVPADSRVDQEVDLNCANFSQDLGQAP |
Ga0214490_11274221 | 3300032502 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRAEQEVNLNCANLSQDLGQAPEALLPDSA |
Ga0214484_10198782 | 3300032591 | Switchgrass Phyllosphere | MLYETVNLADGDYELVPADSRVDQEVNLNCANLSQGLGQAPEVYLLDSA |
Ga0214497_11379241 | 3300032689 | Switchgrass Phyllosphere | LHIEAVNLADGDYKLVPADSRVDQEVNLNCANLPLDLGQAPEAFLPNSAQEGKPRSII |
Ga0214499_11369431 | 3300032697 | Switchgrass Phyllosphere | LHIETVNLADGDYDLVPADSRVDQEVNLNCTNLSQDLGQAPEAFLPDSAQEGKP |
Ga0214499_12838051 | 3300032697 | Switchgrass Phyllosphere | MVNLADGDYELVPADSRAEQEVNLNCANLSQDLGQAPEAFLPDSAQEGK |
Ga0314741_10200931 | 3300032934 | Switchgrass Phyllosphere | LHIETVNLADGEYELVPADSRFDQEVNLSCANLSQGLGQAPEVFLPDSAQKGKPR |
Ga0314738_10276501 | 3300032959 | Switchgrass Phyllosphere | LHIETVNLADGDYELVPADSRVDQEVNLNCANLSQDLGQAPEAFL |
Ga0314760_10969331 | 3300033530 | Switchgrass Phyllosphere | LHIETVNVADGDYELVSADSRVDQEVNLNCANLSQDLGQAPEAFLPDSAQEGKPRS |
⦗Top⦘ |