| Basic Information | |
|---|---|
| Family ID | F078015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | HKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Number of Associated Samples | 50 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 18.80 % |
| % of genes near scaffold ends (potentially truncated) | 81.20 % |
| % of genes from short scaffolds (< 2000 bps) | 78.63 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.085 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (64.103 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.162 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 64.10% β-sheet: 0.00% Coil/Unstructured: 35.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF09827 | CRISPR_Cas2 | 5.13 |
| PF01867 | Cas_Cas1 | 1.71 |
| PF13340 | DUF4096 | 0.85 |
| PF13560 | HTH_31 | 0.85 |
| PF03949 | Malic_M | 0.85 |
| PF12323 | HTH_OrfB_IS605 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 1.71 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.85 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.09 % |
| All Organisms | root | All Organisms | 29.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 64.10% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 17.95% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 9.40% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 3.42% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 1.71% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 1.71% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.85% |
| Hotspring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hotspring | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2022920016 | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP15 Mushroom Spring | Environmental | Open in IMG/M |
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300004826 | Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods - Norris Mammoth Corridor Bijah Roadside hotspring 3 | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005490 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005638 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005839 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG | Environmental | Open in IMG/M |
| 3300010184 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010186 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010187 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010191 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010255 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010257 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010289 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer C metaG | Environmental | Open in IMG/M |
| 3300020153 | Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG | Environmental | Open in IMG/M |
| 3300022548 | Cone Pool_combined assembly | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026280 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026293 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028735 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-006-1 | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031515 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031958 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YNPsite15_CeleraDRAFT_361910 | 2022920016 | Hot Spring | HAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| JGI24185J35167_10487901 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | HAALSQREAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR* |
| JGI24185J35167_10545401 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | ALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR* |
| JGI24185J35167_10604782 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | HAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR* |
| Ga0061020_10737231 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | LSHKEAMKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV* |
| Ga0071354_1007571 | 3300004826 | Hotspring | VAHRARSANRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR* |
| Ga0068706_10170061 | 3300005452 | Anoxygenic And Chlorotrophic | RSANRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR* |
| Ga0068706_10393941 | 3300005452 | Anoxygenic And Chlorotrophic | NRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR* |
| Ga0068706_10473743 | 3300005452 | Anoxygenic And Chlorotrophic | ASRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV* |
| Ga0068705_100581911 | 3300005453 | Anoxygenic And Chlorotrophic | SHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ* |
| Ga0068705_101028701 | 3300005453 | Anoxygenic And Chlorotrophic | TQPDARAASHTAPDACDRSHAALPHKEAMKGVYITVIAAETLYTFRLKSGDRARRLACAVLMR* |
| Ga0068662_1725672 | 3300005490 | Anoxygenic And Chlorotrophic Microbial Mat | MKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR* |
| Ga0068669_10072091 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | MNTACITVITAEMLYTFRLKSGDRARRLACAVLMR* |
| Ga0068707_10453491 | 3300005839 | Anoxygenic And Chlorotrophic | MKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR* |
| Ga0124920_11191793 | 3300010184 | Anoxygenic And Chlorotrophic Microbial Mat | MKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR* |
| Ga0124916_10895642 | 3300010186 | Anoxygenic And Chlorotrophic Microbial Mat | MKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV* |
| Ga0124918_10709411 | 3300010187 | Anoxygenic And Chlorotrophic Microbial Mat | DACDRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR* |
| Ga0124914_11166671 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | LSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR* |
| Ga0124910_11048751 | 3300010255 | Anoxygenic And Chlorotrophic Microbial Mat | AALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR* |
| Ga0124913_12224691 | 3300010257 | Anoxygenic And Chlorotrophic Microbial Mat | PASRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR* |
| Ga0129299_11018551 | 3300010289 | Hot Spring Microbial Mat | MNVVCITVIAAETLSTFRLKSGDRAQRLACAVLKR* |
| Ga0197142_100313311 | 3300020153 | Sediment | MKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0197142_10059031 | 3300020153 | Sediment | MKGVGITVIAAETLSTFRLKSGDRAQRLACAVLMQ |
| Ga0197142_10110301 | 3300020153 | Sediment | KEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0197142_10420771 | 3300020153 | Sediment | TPASRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ |
| Ga0212092_11604061 | 3300022548 | Hot Spring Microbial Mat | MNVVCIPVIAAETLSTFRLKSGDRAQRLACAVLKR |
| Ga0209750_10272871 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | TPASRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0209750_10289371 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0209750_10692762 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV |
| Ga0209750_10738371 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | NRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0209017_100628011 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | LSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0209017_100742502 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | LSHKEAMKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV |
| Ga0209017_100962501 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | AALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0209227_10300541 | 3300026293 | Anoxygenic And Chlorotrophic Microbial Mat | RRTPASRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0209227_10946821 | 3300026293 | Anoxygenic And Chlorotrophic Microbial Mat | RRTPASRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0209809_10247401 | 3300026509 | Anoxygenic And Chlorotrophic | HKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0209809_10276731 | 3300026509 | Anoxygenic And Chlorotrophic | TQPDARAASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0209809_10412941 | 3300026509 | Anoxygenic And Chlorotrophic | TQPDARAASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0209809_10603651 | 3300026509 | Anoxygenic And Chlorotrophic | HKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0209809_10681801 | 3300026509 | Anoxygenic And Chlorotrophic | HTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0272446_10141631 | 3300028735 | Microbial Mat | RSANRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0272446_11516651 | 3300028735 | Microbial Mat | HKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308395_10070411 | 3300031245 | Hot Spring Phototrophic Mat | MNTACITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308395_10108195 | 3300031245 | Hot Spring Phototrophic Mat | MNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308395_10136981 | 3300031245 | Hot Spring Phototrophic Mat | REAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308395_10142131 | 3300031245 | Hot Spring Phototrophic Mat | AASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308395_10325323 | 3300031245 | Hot Spring Phototrophic Mat | MKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ |
| Ga0308395_10687851 | 3300031245 | Hot Spring Phototrophic Mat | EAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308395_11034371 | 3300031245 | Hot Spring Phototrophic Mat | AMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308394_10231761 | 3300031508 | Hot Spring Phototrophic Mat | ALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ |
| Ga0308394_10263321 | 3300031508 | Hot Spring Phototrophic Mat | EAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308394_10270341 | 3300031508 | Hot Spring Phototrophic Mat | SHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSDDRARRLACAVLMR |
| Ga0308394_10329172 | 3300031508 | Hot Spring Phototrophic Mat | MPRYRITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308394_10447391 | 3300031508 | Hot Spring Phototrophic Mat | APDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308394_10871161 | 3300031508 | Hot Spring Phototrophic Mat | EAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308399_10406901 | 3300031509 | Hot Spring Phototrophic Mat | MKGVCITVITAEMLSTFRLKSGDRARRLACAVLMR |
| Ga0308397_10268601 | 3300031512 | Hot Spring Phototrophic Mat | AALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308397_10364591 | 3300031512 | Hot Spring Phototrophic Mat | TSASRSHAALSHKEAMKGVCITVITAEMLSTFRLKSGDRARRLACAVLMR |
| Ga0308397_10542381 | 3300031512 | Hot Spring Phototrophic Mat | EAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308412_10111111 | 3300031513 | Hot Spring Phototrophic Mat | MKGVCITVITAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308412_10224681 | 3300031513 | Hot Spring Phototrophic Mat | REAMNTACITVITAEMLYTFRLKSSDRARRLACAVLMR |
| Ga0308412_10421301 | 3300031513 | Hot Spring Phototrophic Mat | APDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308412_10662341 | 3300031513 | Hot Spring Phototrophic Mat | RAASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308412_10705512 | 3300031513 | Hot Spring Phototrophic Mat | KEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308412_10784651 | 3300031513 | Hot Spring Phototrophic Mat | EAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308412_10846941 | 3300031513 | Hot Spring Phototrophic Mat | AMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308390_10299841 | 3300031514 | Hot Spring Phototrophic Mat | AALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ |
| Ga0308390_10597051 | 3300031514 | Hot Spring Phototrophic Mat | PDARAASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYAFRLKSGDRARRLACAVLM |
| Ga0308390_10904671 | 3300031514 | Hot Spring Phototrophic Mat | PHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308396_10125411 | 3300031515 | Hot Spring Phototrophic Mat | SHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308396_10350711 | 3300031515 | Hot Spring Phototrophic Mat | RAHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRAQRLACAVLMR |
| Ga0308396_10660921 | 3300031515 | Hot Spring Phototrophic Mat | RSANRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308398_10434021 | 3300031516 | Hot Spring Phototrophic Mat | CDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308392_10342671 | 3300031517 | Hot Spring Phototrophic Mat | AMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308392_10517411 | 3300031517 | Hot Spring Phototrophic Mat | PDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308392_10564361 | 3300031517 | Hot Spring Phototrophic Mat | SHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308389_10311911 | 3300031518 | Hot Spring Phototrophic Mat | RSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMQ |
| Ga0308389_10806712 | 3300031518 | Hot Spring Phototrophic Mat | TPASRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV |
| Ga0308391_10066271 | 3300031567 | Hot Spring Phototrophic Mat | MKGVYITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308391_10092301 | 3300031567 | Hot Spring Phototrophic Mat | ASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308401_10203432 | 3300031767 | Hot Spring Phototrophic Mat | MKGVCITVIAAETLSTFRLKSGDRARRLACAALMR |
| Ga0308401_10556001 | 3300031767 | Hot Spring Phototrophic Mat | ARAASHTAPDACDRSHAALSHKEALKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308415_10069451 | 3300031776 | Hot Spring Phototrophic Mat | ALSQREAMNTACITVITAEMLYTFRLKSKSGDRARRLACAVLMR |
| Ga0308415_10237851 | 3300031776 | Hot Spring Phototrophic Mat | MKGVCITVIAAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308415_10479541 | 3300031776 | Hot Spring Phototrophic Mat | KEAMKGVCITVIAAETLSTFRLKSGDRARRLARAVLMR |
| Ga0308415_10690611 | 3300031776 | Hot Spring Phototrophic Mat | RSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308418_10075342 | 3300031783 | Hot Spring Phototrophic Mat | MKGVCITVIAAETLSTFRLKSGDRARRLACTVLMR |
| Ga0308418_10211971 | 3300031783 | Hot Spring Phototrophic Mat | SHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308418_11136091 | 3300031783 | Hot Spring Phototrophic Mat | TAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSDDRARRLACAVLMR |
| Ga0308411_100498611 | 3300031812 | Hot Spring Phototrophic Mat | MNTACITVITAEMLYTFRLKSSDRARRLACAVLMR |
| Ga0308411_100623911 | 3300031812 | Hot Spring Phototrophic Mat | ANRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLARAVLMR |
| Ga0308411_101079431 | 3300031812 | Hot Spring Phototrophic Mat | HAALSQREAMNTACITVITAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308411_101413201 | 3300031812 | Hot Spring Phototrophic Mat | RSANRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLARAVLMR |
| Ga0308408_10107751 | 3300031865 | Hot Spring Phototrophic Mat | KEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308408_11003812 | 3300031865 | Hot Spring Phototrophic Mat | SHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308405_10169161 | 3300031875 | Hot Spring Phototrophic Mat | ASRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| Ga0308404_10132511 | 3300031878 | Hot Spring Phototrophic Mat | PHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308404_10192381 | 3300031878 | Hot Spring Phototrophic Mat | AMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308404_10314381 | 3300031878 | Hot Spring Phototrophic Mat | APDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSDDRARRLACAVLMR |
| Ga0308417_10572661 | 3300031950 | Hot Spring Phototrophic Mat | ASHTAPDACDRSHAALPHKEAMKGVCITVITAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308417_10718971 | 3300031950 | Hot Spring Phototrophic Mat | AALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308417_11247311 | 3300031950 | Hot Spring Phototrophic Mat | ASRSHAALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRGAVLMRQNWIGV |
| Ga0308417_11390911 | 3300031950 | Hot Spring Phototrophic Mat | QREAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308410_10091951 | 3300031958 | Hot Spring Phototrophic Mat | MKGVCITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308410_10263251 | 3300031958 | Hot Spring Phototrophic Mat | REAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308410_10497981 | 3300031958 | Hot Spring Phototrophic Mat | MKGVCITLIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308420_10279031 | 3300031966 | Hot Spring Phototrophic Mat | MNTACITVITAEMLYTFRLKSSDRARRLARAVLMR |
| Ga0308420_10482381 | 3300031966 | Hot Spring Phototrophic Mat | LSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLARAVLMR |
| Ga0308403_10537931 | 3300031980 | Hot Spring Phototrophic Mat | RARSANRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308402_10617301 | 3300032033 | Hot Spring Phototrophic Mat | HKEAMKGVCITVITAEMLYTFRLKSGDRARRLACAVLMR |
| Ga0308400_10100921 | 3300032045 | Hot Spring Phototrophic Mat | APDACDRSHAALSHKEAMKGVCITVIAAETLYTFRLKSGDRAQRLACAVLMR |
| Ga0308400_10357191 | 3300032045 | Hot Spring Phototrophic Mat | AMKGVCITVIAAETLSTFRLKSGDRARRLACAALMR |
| Ga0308310_10918081 | 3300032056 | Hot Spring Phototrophic Mat | RSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR |
| Ga0308419_10633761 | 3300032058 | Hot Spring Phototrophic Mat | AALSHKEAMKGVCITVIAAETLSTFRLKSGDRARRLACAVLMR |
| Ga0308419_11829701 | 3300032058 | Hot Spring Phototrophic Mat | DRSHAALPHKEAMKGVCITVIAAETLYAFRLKSGDRARRLACAVLMR |
| Ga0308414_10548781 | 3300032356 | Hot Spring Phototrophic Mat | RAASHTAPDACDRSHAALPHKEAMKGVCITVIAAETLYTFRLKSDDRARRLACAVLMR |
| Ga0308414_10748421 | 3300032356 | Hot Spring Phototrophic Mat | LPHKEAMKGVCITVIAAETLYTFRLKSGDRARRLACAVLMR |
| ⦗Top⦘ |