| Basic Information | |
|---|---|
| Family ID | F077957 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTEPLVVYGSR |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.49 % |
| % of genes near scaffold ends (potentially truncated) | 25.64 % |
| % of genes from short scaffolds (< 2000 bps) | 81.20 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.556 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.45% β-sheet: 2.13% Coil/Unstructured: 40.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 44.44 |
| PF13439 | Glyco_transf_4 | 8.55 |
| PF13524 | Glyco_trans_1_2 | 5.98 |
| PF11271 | PorA | 3.42 |
| PF00160 | Pro_isomerase | 2.56 |
| PF02803 | Thiolase_C | 0.85 |
| PF00117 | GATase | 0.85 |
| PF00665 | rve | 0.85 |
| PF09723 | Zn-ribbon_8 | 0.85 |
| PF06781 | CrgA | 0.85 |
| PF13649 | Methyltransf_25 | 0.85 |
| PF01872 | RibD_C | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.85 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.85 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.85 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.85 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.56 % |
| Unclassified | root | N/A | 44.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_103122484 | Not Available | 537 | Open in IMG/M |
| 3300001431|F14TB_100652595 | Not Available | 529 | Open in IMG/M |
| 3300003203|JGI25406J46586_10001652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10526 | Open in IMG/M |
| 3300003373|JGI25407J50210_10014742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2016 | Open in IMG/M |
| 3300003373|JGI25407J50210_10028533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1447 | Open in IMG/M |
| 3300003373|JGI25407J50210_10041786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1173 | Open in IMG/M |
| 3300003373|JGI25407J50210_10050111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1060 | Open in IMG/M |
| 3300003373|JGI25407J50210_10077700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300003373|JGI25407J50210_10078748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 820 | Open in IMG/M |
| 3300003373|JGI25407J50210_10084401 | Not Available | 788 | Open in IMG/M |
| 3300003373|JGI25407J50210_10099675 | Not Available | 718 | Open in IMG/M |
| 3300004016|Ga0058689_10042482 | Not Available | 820 | Open in IMG/M |
| 3300004463|Ga0063356_100966559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1211 | Open in IMG/M |
| 3300005562|Ga0058697_10168192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300005562|Ga0058697_10246441 | Not Available | 830 | Open in IMG/M |
| 3300005562|Ga0058697_10302139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 764 | Open in IMG/M |
| 3300005562|Ga0058697_10361472 | Not Available | 710 | Open in IMG/M |
| 3300005562|Ga0058697_10484277 | Not Available | 629 | Open in IMG/M |
| 3300005937|Ga0081455_10031291 | All Organisms → cellular organisms → Bacteria | 4817 | Open in IMG/M |
| 3300005981|Ga0081538_10002697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 17076 | Open in IMG/M |
| 3300005981|Ga0081538_10005256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11693 | Open in IMG/M |
| 3300005981|Ga0081538_10046493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2676 | Open in IMG/M |
| 3300005981|Ga0081538_10166302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 970 | Open in IMG/M |
| 3300005985|Ga0081539_10089036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1600 | Open in IMG/M |
| 3300006845|Ga0075421_100047580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5435 | Open in IMG/M |
| 3300006847|Ga0075431_100661804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1024 | Open in IMG/M |
| 3300007004|Ga0079218_10701952 | Not Available | 949 | Open in IMG/M |
| 3300009094|Ga0111539_11756359 | Not Available | 719 | Open in IMG/M |
| 3300009147|Ga0114129_10382772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1858 | Open in IMG/M |
| 3300009157|Ga0105092_10862545 | Not Available | 533 | Open in IMG/M |
| 3300009789|Ga0126307_11230708 | Not Available | 606 | Open in IMG/M |
| 3300009789|Ga0126307_11787187 | Not Available | 500 | Open in IMG/M |
| 3300009797|Ga0105080_1048284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300009798|Ga0105060_101508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1053 | Open in IMG/M |
| 3300009805|Ga0105079_1045230 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 513 | Open in IMG/M |
| 3300009807|Ga0105061_1033006 | Not Available | 738 | Open in IMG/M |
| 3300009809|Ga0105089_1100130 | Not Available | 514 | Open in IMG/M |
| 3300009815|Ga0105070_1075772 | Not Available | 644 | Open in IMG/M |
| 3300009816|Ga0105076_1027953 | Not Available | 990 | Open in IMG/M |
| 3300009840|Ga0126313_10009817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5987 | Open in IMG/M |
| 3300009840|Ga0126313_10011991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5520 | Open in IMG/M |
| 3300010029|Ga0105074_1019554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300010038|Ga0126315_11198805 | Not Available | 516 | Open in IMG/M |
| 3300010041|Ga0126312_11119511 | Not Available | 579 | Open in IMG/M |
| 3300010041|Ga0126312_11431316 | Not Available | 512 | Open in IMG/M |
| 3300010044|Ga0126310_10286707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
| 3300010362|Ga0126377_11965710 | Not Available | 661 | Open in IMG/M |
| 3300012021|Ga0120192_10152360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012355|Ga0137369_10042795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4034 | Open in IMG/M |
| 3300012355|Ga0137369_10179698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1655 | Open in IMG/M |
| 3300012938|Ga0162651_100028861 | Not Available | 802 | Open in IMG/M |
| 3300014487|Ga0182000_10005250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2902 | Open in IMG/M |
| 3300014487|Ga0182000_10375893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300014487|Ga0182000_10644726 | Not Available | 517 | Open in IMG/M |
| 3300017965|Ga0190266_10192940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 965 | Open in IMG/M |
| 3300017965|Ga0190266_10511296 | Not Available | 703 | Open in IMG/M |
| 3300017965|Ga0190266_10913195 | Not Available | 578 | Open in IMG/M |
| 3300018028|Ga0184608_10447815 | Not Available | 556 | Open in IMG/M |
| 3300018031|Ga0184634_10047993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1756 | Open in IMG/M |
| 3300018052|Ga0184638_1098443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1073 | Open in IMG/M |
| 3300018052|Ga0184638_1258945 | Not Available | 597 | Open in IMG/M |
| 3300018075|Ga0184632_10314871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
| 3300018076|Ga0184609_10001479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7429 | Open in IMG/M |
| 3300018076|Ga0184609_10018009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2756 | Open in IMG/M |
| 3300018081|Ga0184625_10268887 | Not Available | 892 | Open in IMG/M |
| 3300018465|Ga0190269_10044096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2046 | Open in IMG/M |
| 3300018465|Ga0190269_11319758 | Not Available | 578 | Open in IMG/M |
| 3300018465|Ga0190269_11358856 | Not Available | 573 | Open in IMG/M |
| 3300018466|Ga0190268_10021801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2099 | Open in IMG/M |
| 3300018466|Ga0190268_11724352 | Not Available | 560 | Open in IMG/M |
| 3300018469|Ga0190270_12358413 | Not Available | 593 | Open in IMG/M |
| 3300018476|Ga0190274_13496870 | Not Available | 530 | Open in IMG/M |
| 3300019377|Ga0190264_10142517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
| 3300019377|Ga0190264_10855177 | Not Available | 702 | Open in IMG/M |
| 3300019767|Ga0190267_10295739 | Not Available | 835 | Open in IMG/M |
| 3300019767|Ga0190267_11004459 | Not Available | 586 | Open in IMG/M |
| 3300021073|Ga0210378_10003345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7803 | Open in IMG/M |
| 3300021078|Ga0210381_10274253 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300021972|Ga0193737_1061322 | Not Available | 532 | Open in IMG/M |
| 3300027006|Ga0209896_1026395 | Not Available | 660 | Open in IMG/M |
| 3300027324|Ga0209845_1001940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3607 | Open in IMG/M |
| 3300027379|Ga0209842_1044838 | Not Available | 809 | Open in IMG/M |
| 3300027561|Ga0209887_1022106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300027718|Ga0209795_10037119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1554 | Open in IMG/M |
| 3300027718|Ga0209795_10095452 | Not Available | 854 | Open in IMG/M |
| 3300027750|Ga0209461_10053069 | Not Available | 830 | Open in IMG/M |
| 3300027750|Ga0209461_10087766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300027750|Ga0209461_10106876 | Not Available | 641 | Open in IMG/M |
| 3300027809|Ga0209574_10095893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300027809|Ga0209574_10307999 | Not Available | 542 | Open in IMG/M |
| 3300027957|Ga0209857_1083432 | Not Available | 539 | Open in IMG/M |
| 3300028712|Ga0307285_10179608 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028722|Ga0307319_10093866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
| 3300028787|Ga0307323_10314714 | Not Available | 562 | Open in IMG/M |
| 3300028807|Ga0307305_10085520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1458 | Open in IMG/M |
| 3300028878|Ga0307278_10009363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4611 | Open in IMG/M |
| 3300030496|Ga0268240_10015650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1370 | Open in IMG/M |
| 3300031114|Ga0308187_10190374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
| 3300031548|Ga0307408_100248643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1465 | Open in IMG/M |
| 3300031548|Ga0307408_101535275 | Not Available | 631 | Open in IMG/M |
| 3300031548|Ga0307408_101710212 | Not Available | 600 | Open in IMG/M |
| 3300031548|Ga0307408_101900809 | Not Available | 571 | Open in IMG/M |
| 3300031731|Ga0307405_10004985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6346 | Open in IMG/M |
| 3300031731|Ga0307405_10658633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300031731|Ga0307405_11528568 | Not Available | 587 | Open in IMG/M |
| 3300031731|Ga0307405_11767183 | Not Available | 549 | Open in IMG/M |
| 3300031824|Ga0307413_10551463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 935 | Open in IMG/M |
| 3300031852|Ga0307410_10227225 | Not Available | 1439 | Open in IMG/M |
| 3300031852|Ga0307410_11013803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300031852|Ga0307410_11563475 | Not Available | 582 | Open in IMG/M |
| 3300032004|Ga0307414_10012270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5060 | Open in IMG/M |
| 3300032126|Ga0307415_100216812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
| 3300032159|Ga0268251_10075891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300032159|Ga0268251_10166999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300034026|Ga0334946_026422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
| 3300034172|Ga0334913_003510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4751 | Open in IMG/M |
| 3300034172|Ga0334913_007646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2742 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 11.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 11.11% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 10.26% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 9.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 3.42% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 2.56% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.56% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009798 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1031224841 | 3300000559 | Soil | MSGLTLRVLVGLAAGALVLAFVASLALISSQGASSVSGEPLIVYG |
| F14TB_1006525952 | 3300001431 | Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTEPLVVYGSR* |
| JGI25406J46586_1000165211 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MSGLTVRALAAMAAGALVLAFIASLILVSSQNASSVSTRPLVVYGSR* |
| JGI25407J50210_100147422 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLFIVSSQNASSVSTEPLVVYGSR* |
| JGI25407J50210_100285332 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLALVSSQNASSVSTKPLVVYGSR* |
| JGI25407J50210_100417862 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR* |
| JGI25407J50210_100501112 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR* |
| JGI25407J50210_100777002 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRVLAALAAGALVLAFVSSLVLVSSQSASSVSTKPLVVYGSR* |
| JGI25407J50210_100787481 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSGLTLRVLAALAAGALVLAFVASLVLVSSQSASSVPTRPLVQYGSR* |
| JGI25407J50210_100844012 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTGLTLRLLAAIAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR* |
| JGI25407J50210_100996752 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTGLTLRVLAALAAGALVLAFVTSLVLVSSQSASSVSTTPLVQYGSR* |
| Ga0058689_100424822 | 3300004016 | Agave | MTGLTLRVLAALAAGALVLAFVSSLVLVSSQSGSSVSTRPLVQYGSR* |
| Ga0063356_1009665591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTGLTLRLLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSRQP* |
| Ga0058697_101681921 | 3300005562 | Agave | MTGLTLRLLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR* |
| Ga0058697_102464412 | 3300005562 | Agave | MSGLTLRLLVAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR* |
| Ga0058697_103021392 | 3300005562 | Agave | MTGLTLRVLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR* |
| Ga0058697_103614722 | 3300005562 | Agave | MTGLTLRLLAAIAAGALVLAFVASLVLISSQGASSVSGEPLVVYGSR* |
| Ga0058697_104842771 | 3300005562 | Agave | MSGLTLRALAALAAGALVLAFVASLALVSSQNASSVSTRPLVVYGSR* |
| Ga0081455_100312915 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLFIVSSQNASSVSTKPLVVYGSR* |
| Ga0081538_100026973 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLVLVSSQNATSVSSKPLVVYGSR* |
| Ga0081538_100052564 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFIASLVLVSSQNASSVSTKPLVVYGSR* |
| Ga0081538_100464932 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSGLTLRALAALAAGALVLAFVASLFIVSSQNASSVSTRPLVVYGSR* |
| Ga0081538_101663022 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSGLTLRLLVALAGGALVLAFVASLVLVASQDASSVSSEPLIVYGSR* |
| Ga0081539_100890362 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTGLTLRFLVAIAVGALVLAFVASLALISSQSASSVSGEPLVVYGSR* |
| Ga0075421_1000475803 | 3300006845 | Populus Rhizosphere | MSGLTLRALAALAAGALVLAFVASLFLVSSQNASSVSTEPLVVYGSR* |
| Ga0075431_1006618042 | 3300006847 | Populus Rhizosphere | MSGLTLRALAALAAGALVLAFVASLFLVSSQNASSVSTKPLVVYGSR* |
| Ga0079218_107019522 | 3300007004 | Agricultural Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASTVSSKPLVVYGSR* |
| Ga0111539_117563592 | 3300009094 | Populus Rhizosphere | MSGLTLRALAAMAAGALVLAFVASLILVSSQNASSVSTRPLVVYGSR* |
| Ga0114129_103827722 | 3300009147 | Populus Rhizosphere | MSGLTMRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR* |
| Ga0105092_108625452 | 3300009157 | Freshwater Sediment | MRALAALAAGALVLAFVASLVLVSSQNASSVSTEPLVVYGSR* |
| Ga0126307_112307082 | 3300009789 | Serpentine Soil | MSGLTLRALAALAAGALVLAFVASLAIVSSQNASSVSTRPLVVYGSR* |
| Ga0126307_117871872 | 3300009789 | Serpentine Soil | MTGLTLRLLAAIAAGALVLAFVASLVLISSQGASSVSGEPLIVYGSR* |
| Ga0105080_10482842 | 3300009797 | Groundwater Sand | MSGLTLRVLAALAAGALVLAFVASLVLVSSQSASSVSTRPLVQYGSR* |
| Ga0105060_1015082 | 3300009798 | Groundwater Sand | MSGLTLRVLAALAAGALVLAFVTSLVLVSSQSASSVSTRPLVQYGSR* |
| Ga0105079_10452302 | 3300009805 | Groundwater Sand | MSGLTLRVLAALAAGALVLAFVTSLVLVSSQSASSVSTRPVVQYGSR* |
| Ga0105061_10330061 | 3300009807 | Groundwater Sand | MTGLTIRVLAALSAGALILAFISALVLVSSQGASSVSTEPLLVYGSR* |
| Ga0105089_11001302 | 3300009809 | Groundwater Sand | MSGLTVRVLAALAAGALVLAFVTSLALVSSQSASSQSTRPLLQYGSR* |
| Ga0105070_10757721 | 3300009815 | Groundwater Sand | MSGLTVRVLAALAAGALVLAFVTSLALVSSQRASSQSTRPLLQYGSR* |
| Ga0105076_10279532 | 3300009816 | Groundwater Sand | MNGLTMRILAALAAGALILAFVSSLVLVSSQGASSVSTEPLLVYGSR* |
| Ga0126313_100098174 | 3300009840 | Serpentine Soil | MSGLTLRVLAALAAGALVLAFVSSLALVSSQSASSVSTKPLVVYGSR* |
| Ga0126313_100119912 | 3300009840 | Serpentine Soil | MSGLTLRALAVLAAGALVLAFVASLFIVSSQNASSVSTKPLVVYGSR* |
| Ga0105074_10195542 | 3300010029 | Groundwater Sand | MSGLTLRVLAALAAGALVLAFVTSLVPVSSQSASSVSTRPLVQYGSR* |
| Ga0126315_111988051 | 3300010038 | Serpentine Soil | MSGLTLRVLAALAAGALVLAFVASLVLVSSQNASSVSSRPLVVYGSR* |
| Ga0126312_111195111 | 3300010041 | Serpentine Soil | MSGLTLRALAALAAGALVLAFVASLAIVSSQNASSVSTRPL |
| Ga0126312_114313162 | 3300010041 | Serpentine Soil | VLAALAAGALVLAFVSSLALVSSQSASSVSTKPLVVYGSR* |
| Ga0126310_102867071 | 3300010044 | Serpentine Soil | MSGLTLRALAALAAGALVLAFVASLAIVSSQNASSVSTRPLVVY |
| Ga0126377_119657102 | 3300010362 | Tropical Forest Soil | MSGLTMRTLAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR* |
| Ga0120192_101523602 | 3300012021 | Terrestrial | MSGLTLRVLAALAAGALVLAFVSSLVLVSSQTATSVSTRPLVRYGSR* |
| Ga0137369_100427952 | 3300012355 | Vadose Zone Soil | MSGLTMRILAALAAVALILAFVSSLVLVTSQGASSVSTEPLLVYGSR* |
| Ga0137369_101796982 | 3300012355 | Vadose Zone Soil | MTGLTIRVLAALSAGALILAFISALVLVSSPGASSVSTEPLLVYGSR* |
| Ga0162651_1000288611 | 3300012938 | Soil | MSGLTLRALAALAAGALVLAFVASLFLVASQNASSVSTEPLVVYGSR* |
| Ga0182000_100052503 | 3300014487 | Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSSRPLVVYGSR* |
| Ga0182000_103758931 | 3300014487 | Soil | MSGLTLRLLVAIAAGALVLAFVASLALISSQSASSVSGQPLIVY |
| Ga0182000_106447262 | 3300014487 | Soil | SRMSGLTLRALATLAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR* |
| Ga0190266_101929402 | 3300017965 | Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0190266_105112962 | 3300017965 | Soil | MTGLTLRFLVAIAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR |
| Ga0190266_109131952 | 3300017965 | Soil | MSGLTLRLLVGLAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR |
| Ga0184608_104478152 | 3300018028 | Groundwater Sediment | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVY |
| Ga0184634_100479932 | 3300018031 | Groundwater Sediment | MSGLTLRVLAALAAGALVLAFVTSLVLVSSQSASSVSTRPLVQYGSR |
| Ga0184638_10984432 | 3300018052 | Groundwater Sediment | MSGLTLRVLAALAAGALVLAFVSSLVLVSSQSASSVSTRPLVQYGSR |
| Ga0184638_12589451 | 3300018052 | Groundwater Sediment | MSGLTMRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0184632_103148712 | 3300018075 | Groundwater Sediment | PMSGLTLRVLAGLAVGALVLAFVASLVLVSSQGASSVSTEPLIVYGSR |
| Ga0184609_100014791 | 3300018076 | Groundwater Sediment | GLAVGALVLAFVASLVLVSSQGASSVSTEPLIVYGSR |
| Ga0184609_100180093 | 3300018076 | Groundwater Sediment | MSGLKLRVLVGLAVGALVLAFVASLVLVSSQGASSVSTEPLIVYGSR |
| Ga0184625_102688872 | 3300018081 | Groundwater Sediment | MSGLTLRALAALAAGALVLAFVASLFLVSSQNASSVSTEPLVVYGSR |
| Ga0190269_100440962 | 3300018465 | Soil | MSGLTLRALAALAAGALVLAFVASLFIVSSQNASSVSTKPLVVYGSR |
| Ga0190269_113197581 | 3300018465 | Soil | PPVAPVGILRPTSPTRSRMSGLTLRTLAALAAGALVLAFVASLVLVSSQNASSVSTRSLVVYGSR |
| Ga0190269_113588561 | 3300018465 | Soil | PRRSRMSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0190268_100218012 | 3300018466 | Soil | MTGLTLRLLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR |
| Ga0190268_117243521 | 3300018466 | Soil | RMSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR |
| Ga0190270_123584131 | 3300018469 | Soil | MSGLTLRALVALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0190274_134968701 | 3300018476 | Soil | RALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0190264_101425172 | 3300019377 | Soil | MSGLTLRVLAGLAVGALVLAFVASLVLVSSQGASSVSSEPLIVYGSR |
| Ga0190264_108551772 | 3300019377 | Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSNEPLVVYGSR |
| Ga0190267_102957392 | 3300019767 | Soil | MSGLTLRVLVGLAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR |
| Ga0190267_110044592 | 3300019767 | Soil | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR |
| Ga0210378_100033455 | 3300021073 | Groundwater Sediment | MSGLTVRVLAALAAGALVLAFVTSLALVSSQSASSQSTRPLLQYGSR |
| Ga0210381_102742532 | 3300021078 | Groundwater Sediment | TLRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0193737_10613222 | 3300021972 | Soil | MSGLTLRVLAGLAVGALVLAFVASLVLVSSQGASSVSTEPLIVYGSR |
| Ga0209896_10263951 | 3300027006 | Groundwater Sand | LAALAAGALVLAFVSSLVLVSSQSASSVSTRPLVQYGSR |
| Ga0209845_10019402 | 3300027324 | Groundwater Sand | MSGLTLRVLAALAAGALVLAFITSLVLVSSQSASSVSTRPLVQYGSR |
| Ga0209842_10448381 | 3300027379 | Groundwater Sand | NGLTMRILAALAAGALILAFVSSLVLVSSQGASSVSTEPLLVYGSR |
| Ga0209887_10221062 | 3300027561 | Groundwater Sand | MNGLTMRILAALAAGALILAFVSSLVLVSSQGASSVSTEPLLVYGSR |
| Ga0209795_100371192 | 3300027718 | Agave | MTGLTLRLLAAIAAGALVLAFVASLVLISSQGASSVSGEPLIVYGSR |
| Ga0209795_100954522 | 3300027718 | Agave | MTGLTLRVLAALAAGALVLAFVSSLVLVSSQSSSSVSTRPLVQYGSR |
| Ga0209461_100530692 | 3300027750 | Agave | MSGLTLRALAALAAGALVLAFVASLALVSSQNASSVSTRPLVVYGSR |
| Ga0209461_100877662 | 3300027750 | Agave | MSGLTLRLLVAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR |
| Ga0209461_101068762 | 3300027750 | Agave | MTGLTLRLLAAIAAGALVLAFVASLVLISSQGASSVSGEPLVVYGSR |
| Ga0209574_100958932 | 3300027809 | Agave | MTGLTLRLLAAIAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR |
| Ga0209574_103079991 | 3300027809 | Agave | MSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSSRPLVVYGSR |
| Ga0209857_10834322 | 3300027957 | Groundwater Sand | TMRILAALAAGALILAFVSSLVLVSSQGASSVSTEPLLVYGSR |
| Ga0307285_101796082 | 3300028712 | Soil | LAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0307319_100938661 | 3300028722 | Soil | ALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0307323_103147142 | 3300028787 | Soil | LRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0307305_100855203 | 3300028807 | Soil | AAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR |
| Ga0307278_100093633 | 3300028878 | Soil | MSGLTLRTLAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0268240_100156501 | 3300030496 | Soil | MSGLTLRALAVLAAGALVLAFVASLVLVSSQNASSVSSRPLVVYGSR |
| Ga0308187_101903741 | 3300031114 | Soil | RMTGLTLRFLVAIAAGALVLAFVASLALISSQGASSVSGEPLIVYGSR |
| Ga0307408_1002486432 | 3300031548 | Rhizosphere | MSGLTLRALAALAAGALVLAFVASLALVSSQNASSVSTKPLVVYGSR |
| Ga0307408_1015352751 | 3300031548 | Rhizosphere | ALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR |
| Ga0307408_1017102122 | 3300031548 | Rhizosphere | MSGLTLRVLAALAAGALALAFVSSLALVSSQSASSVSTKPLVVYGSR |
| Ga0307408_1019008091 | 3300031548 | Rhizosphere | RRSRMSGLTLRALAALAAGALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0307405_100049855 | 3300031731 | Rhizosphere | MSGLTLRALAVLAAGALVLAFVASLFIVSSQNASSVSTKPLVVYGSR |
| Ga0307405_106586332 | 3300031731 | Rhizosphere | MTGLTLRLLVALAAGALVLAFVASLVLISSQGASSVSGEPLIVYGSR |
| Ga0307405_115285682 | 3300031731 | Rhizosphere | MSGLTLRALAALAAGALVLAFVASLAIVSSQNASSVSTRPLVVYGSR |
| Ga0307405_117671832 | 3300031731 | Rhizosphere | TLRALAALAAGALVLAFVASLAIVSSQNASSVSTRPLVVYGSR |
| Ga0307413_105514631 | 3300031824 | Rhizosphere | TLRLLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR |
| Ga0307410_102272251 | 3300031852 | Rhizosphere | MSGLTLRVLAALAAGALVLAFVSSLALVSSQSASSVSTKPLVVYGSR |
| Ga0307410_110138031 | 3300031852 | Rhizosphere | LAALAAGALVLAFVASLFIVSSQNASSVSTKPLVVYGSR |
| Ga0307410_115634751 | 3300031852 | Rhizosphere | TLRALAALAAGALVLAFVASLVLVSSQNASSVSTRPLVVYGSR |
| Ga0307414_100122705 | 3300032004 | Rhizosphere | MTGLTLRLLAAIAAGALILAFVASLALISSQSASSVSGEPLIVYGSR |
| Ga0307415_1002168122 | 3300032126 | Rhizosphere | MTGLTLRVLAALAAGALVLAFVASLVLVSSQSASSVPTRPLVQYGSR |
| Ga0268251_100758912 | 3300032159 | Agave | MSGLTLRALAALAAGALVLAFVASLAIVSSQNASSVSTKPLVVYGSR |
| Ga0268251_101669992 | 3300032159 | Agave | MTGLTLRLLAAIAAGALVLAFVASLALISSQGASSVSGEPLIVY |
| Ga0334946_026422_762_905 | 3300034026 | Sub-Biocrust Soil | MSGLTLRALAALAASALVLAFVASLVLVSSQNASSVSTKPLVVYGSR |
| Ga0334913_003510_2999_3142 | 3300034172 | Sub-Biocrust Soil | MTGLTLRVLAAIAAGALVLAFVASLALISSQSASSVSGEPLIVYGSR |
| Ga0334913_007646_1842_1985 | 3300034172 | Sub-Biocrust Soil | MTGLTLRVLAALAAGALVLAFVSSLVLVSSQSGSSVSTRPLVQYGSR |
| ⦗Top⦘ |