| Basic Information | |
|---|---|
| Family ID | F077872 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLLLYGLLALYALEIVLPLLALAIAFVTRRARRALSV |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.20 % |
| % of genes near scaffold ends (potentially truncated) | 13.68 % |
| % of genes from short scaffolds (< 2000 bps) | 80.34 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.376 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.701 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00027 | cNMP_binding | 24.79 |
| PF12697 | Abhydrolase_6 | 15.38 |
| PF00561 | Abhydrolase_1 | 13.68 |
| PF05988 | DUF899 | 1.71 |
| PF08327 | AHSA1 | 1.71 |
| PF01022 | HTH_5 | 1.71 |
| PF07883 | Cupin_2 | 0.85 |
| PF08281 | Sigma70_r4_2 | 0.85 |
| PF08808 | RES | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.71 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.94 % |
| Unclassified | root | N/A | 29.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig814854 | Not Available | 1345 | Open in IMG/M |
| 2170459015|G14TP7Y01DHPD0 | Not Available | 644 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1020270 | Not Available | 934 | Open in IMG/M |
| 3300000890|JGI11643J12802_10122859 | Not Available | 659 | Open in IMG/M |
| 3300000891|JGI10214J12806_10395740 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300000955|JGI1027J12803_103295849 | Not Available | 987 | Open in IMG/M |
| 3300004157|Ga0062590_102368807 | Not Available | 560 | Open in IMG/M |
| 3300005166|Ga0066674_10377619 | Not Available | 662 | Open in IMG/M |
| 3300005171|Ga0066677_10047545 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300005178|Ga0066688_10755273 | Not Available | 612 | Open in IMG/M |
| 3300005179|Ga0066684_10051188 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300005179|Ga0066684_10443797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 872 | Open in IMG/M |
| 3300005186|Ga0066676_10921818 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005187|Ga0066675_11152197 | Not Available | 577 | Open in IMG/M |
| 3300005332|Ga0066388_105548424 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005341|Ga0070691_10447426 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005444|Ga0070694_100177833 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300005454|Ga0066687_10078734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1615 | Open in IMG/M |
| 3300005454|Ga0066687_10772815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300005553|Ga0066695_10510182 | Not Available | 738 | Open in IMG/M |
| 3300005566|Ga0066693_10026566 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300005569|Ga0066705_10715236 | Not Available | 603 | Open in IMG/M |
| 3300005598|Ga0066706_11438422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300005614|Ga0068856_101008168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 851 | Open in IMG/M |
| 3300005617|Ga0068859_100772259 | Not Available | 1049 | Open in IMG/M |
| 3300005713|Ga0066905_100925455 | Not Available | 764 | Open in IMG/M |
| 3300005713|Ga0066905_101823059 | Not Available | 561 | Open in IMG/M |
| 3300005719|Ga0068861_101480299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300005764|Ga0066903_100011344 | All Organisms → cellular organisms → Bacteria | 8613 | Open in IMG/M |
| 3300006031|Ga0066651_10340512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300006031|Ga0066651_10382625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 752 | Open in IMG/M |
| 3300006032|Ga0066696_10112019 | Not Available | 1657 | Open in IMG/M |
| 3300006034|Ga0066656_10292758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1050 | Open in IMG/M |
| 3300006046|Ga0066652_101163811 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006163|Ga0070715_10131390 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300006175|Ga0070712_101549211 | Not Available | 579 | Open in IMG/M |
| 3300006791|Ga0066653_10283222 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006796|Ga0066665_11443754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300006881|Ga0068865_101419993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300009012|Ga0066710_102546478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300009012|Ga0066710_104564510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300009036|Ga0105244_10429486 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009092|Ga0105250_10047593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1720 | Open in IMG/M |
| 3300009137|Ga0066709_100051109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4667 | Open in IMG/M |
| 3300009137|Ga0066709_100132055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3148 | Open in IMG/M |
| 3300009176|Ga0105242_10040981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3733 | Open in IMG/M |
| 3300009792|Ga0126374_10449562 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010044|Ga0126310_10000500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13629 | Open in IMG/M |
| 3300010046|Ga0126384_11441123 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 643 | Open in IMG/M |
| 3300010147|Ga0126319_1496219 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010358|Ga0126370_12003723 | Not Available | 566 | Open in IMG/M |
| 3300010371|Ga0134125_10437576 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1450 | Open in IMG/M |
| 3300011003|Ga0138514_100138480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012199|Ga0137383_10027238 | All Organisms → cellular organisms → Bacteria | 3996 | Open in IMG/M |
| 3300012200|Ga0137382_10607804 | Not Available | 781 | Open in IMG/M |
| 3300012200|Ga0137382_10933897 | Not Available | 624 | Open in IMG/M |
| 3300012201|Ga0137365_10014648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6159 | Open in IMG/M |
| 3300012208|Ga0137376_10008791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7062 | Open in IMG/M |
| 3300012209|Ga0137379_10088461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2980 | Open in IMG/M |
| 3300012211|Ga0137377_10025788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5264 | Open in IMG/M |
| 3300012285|Ga0137370_10065949 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300012285|Ga0137370_10234992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1083 | Open in IMG/M |
| 3300012350|Ga0137372_10313407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
| 3300012356|Ga0137371_10005006 | All Organisms → cellular organisms → Bacteria | 10387 | Open in IMG/M |
| 3300012897|Ga0157285_10283237 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012975|Ga0134110_10165521 | Not Available | 918 | Open in IMG/M |
| 3300012989|Ga0164305_10019444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3502 | Open in IMG/M |
| 3300013296|Ga0157374_10150805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2260 | Open in IMG/M |
| 3300013308|Ga0157375_13042497 | Not Available | 560 | Open in IMG/M |
| 3300014157|Ga0134078_10237944 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300014497|Ga0182008_10877720 | Not Available | 526 | Open in IMG/M |
| 3300018027|Ga0184605_10002563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6150 | Open in IMG/M |
| 3300018027|Ga0184605_10493314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300018028|Ga0184608_10136249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1050 | Open in IMG/M |
| 3300018061|Ga0184619_10024967 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300018061|Ga0184619_10426040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300018081|Ga0184625_10568772 | Not Available | 561 | Open in IMG/M |
| 3300018431|Ga0066655_10323571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300018431|Ga0066655_10511982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300018431|Ga0066655_10620238 | Not Available | 730 | Open in IMG/M |
| 3300018468|Ga0066662_10516233 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300018482|Ga0066669_11709469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300019789|Ga0137408_1183409 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300019875|Ga0193701_1004952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
| 3300019887|Ga0193729_1002474 | All Organisms → cellular organisms → Bacteria | 9187 | Open in IMG/M |
| 3300020022|Ga0193733_1048009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1206 | Open in IMG/M |
| 3300021418|Ga0193695_1016570 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300021510|Ga0222621_1018059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1402 | Open in IMG/M |
| 3300025711|Ga0207696_1054133 | Not Available | 1141 | Open in IMG/M |
| 3300025901|Ga0207688_10073816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1939 | Open in IMG/M |
| 3300025910|Ga0207684_10068980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3005 | Open in IMG/M |
| 3300025910|Ga0207684_10235002 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300025927|Ga0207687_10253634 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300025933|Ga0207706_10135338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2168 | Open in IMG/M |
| 3300025961|Ga0207712_11366457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300026041|Ga0207639_11963690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300026310|Ga0209239_1168256 | Not Available | 844 | Open in IMG/M |
| 3300026326|Ga0209801_1115478 | Not Available | 1153 | Open in IMG/M |
| 3300026327|Ga0209266_1304354 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026550|Ga0209474_10025633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4485 | Open in IMG/M |
| 3300028711|Ga0307293_10127151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300028784|Ga0307282_10468709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300028784|Ga0307282_10636936 | Not Available | 517 | Open in IMG/M |
| 3300028787|Ga0307323_10239634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300028799|Ga0307284_10245965 | Not Available | 711 | Open in IMG/M |
| 3300028828|Ga0307312_11108698 | Not Available | 523 | Open in IMG/M |
| 3300028878|Ga0307278_10514659 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 522 | Open in IMG/M |
| 3300028881|Ga0307277_10203325 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300028881|Ga0307277_10461372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300028881|Ga0307277_10475789 | Not Available | 560 | Open in IMG/M |
| 3300031421|Ga0308194_10079429 | Not Available | 904 | Open in IMG/M |
| 3300031892|Ga0310893_10504245 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031938|Ga0308175_100427642 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300031943|Ga0310885_10309194 | Not Available | 819 | Open in IMG/M |
| 3300032003|Ga0310897_10353811 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032421|Ga0310812_10111472 | Not Available | 1135 | Open in IMG/M |
| 3300034268|Ga0372943_0428939 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_13903910 | 2124908045 | Soil | MLLVYGLLALYALEIVLPLLALAIAFLTRRARRVFVRVI |
| 4PV_02857050 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAI |
| AP72_2010_repI_A100DRAFT_10202702 | 3300000837 | Forest Soil | MLLLYGLLALYALEIVLPLLALAIAYVTRRARRAPSV* |
| JGI11643J12802_101228592 | 3300000890 | Soil | LLVYGLLALYALEIVLPLLALAIAFVMRRARAIVRLI* |
| JGI10214J12806_103957402 | 3300000891 | Soil | MRGPRLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL* |
| JGI1027J12803_1032958492 | 3300000955 | Soil | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIV* |
| Ga0062590_1023688071 | 3300004157 | Soil | MRGPMLLVYGLLALYALEIVLPLLALAIAFVMRRARAIVRLI* |
| Ga0066674_103776191 | 3300005166 | Soil | MKGPMLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI* |
| Ga0066677_100475452 | 3300005171 | Soil | MLLLYGLFALYALEIVLPLLALAIAFVIRSTRRVFANQAA* |
| Ga0066688_107552731 | 3300005178 | Soil | MSGPMLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV* |
| Ga0066684_100511882 | 3300005179 | Soil | MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA* |
| Ga0066684_104437972 | 3300005179 | Soil | LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAA* |
| Ga0066676_109218182 | 3300005186 | Soil | MLLLYGLLALYALEIVLPLLGLAITFAIRSTRRIFANQAA* |
| Ga0066675_111521972 | 3300005187 | Soil | MLLLYGLLGLYALEIVLPLFALAIAYAIRRTRRVFANQAT* |
| Ga0066388_1055484242 | 3300005332 | Tropical Forest Soil | MKGPMLIVWGLLALYALEIVVPLAALTIAYVTRRARRLAGTRT* |
| Ga0070691_104474262 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVYGLLALYALEIVLPLLVLAIAFATRRARRAIVRVI* |
| Ga0070694_1001778333 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL* |
| Ga0066687_100787341 | 3300005454 | Soil | MLLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAA* |
| Ga0066687_107728151 | 3300005454 | Soil | MLLLYGLLALYALEIVLPLLALAIAFAIRSTRRVFANQAA* |
| Ga0066695_105101822 | 3300005553 | Soil | MLLVYGLLALYALEIIVPLLALAIAFVTRRARRALSV* |
| Ga0066693_100265664 | 3300005566 | Soil | YGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA* |
| Ga0066705_107152361 | 3300005569 | Soil | TAMRGPMLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT* |
| Ga0066706_114384221 | 3300005598 | Soil | MLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV* |
| Ga0068856_1010081681 | 3300005614 | Corn Rhizosphere | MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL* |
| Ga0068859_1007722592 | 3300005617 | Switchgrass Rhizosphere | MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI* |
| Ga0066905_1009254551 | 3300005713 | Tropical Forest Soil | MLLVYGLLALYALEIVLPLLALAIAFVTRRARRALSA* |
| Ga0066905_1018230592 | 3300005713 | Tropical Forest Soil | MRGPMLLVYGLLALYALEIVVPLLALAIAFVTRRARRAPSV* |
| Ga0068861_1014802992 | 3300005719 | Switchgrass Rhizosphere | LLVYGLLALYALEILLPLLALAIAFVTRRARRASSV* |
| Ga0066903_1000113446 | 3300005764 | Tropical Forest Soil | MLIVWGLLALYALEIVLPLAALAIAYVSRRARRVFS* |
| Ga0066651_103405121 | 3300006031 | Soil | MLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI* |
| Ga0066651_103826252 | 3300006031 | Soil | MLILYGLLALYALEVVLPLLALAIAFAIRSTRRVFANQAA* |
| Ga0066696_101120193 | 3300006032 | Soil | MLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT* |
| Ga0066656_102927581 | 3300006034 | Soil | LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAARPGRL* |
| Ga0066652_1011638112 | 3300006046 | Soil | MLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI* |
| Ga0070715_101313901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IGMRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL* |
| Ga0070712_1015492112 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLYGLLALYALEIVVPLLVLAIAFVTRRARRAI* |
| Ga0066653_102832222 | 3300006791 | Soil | MLLVYGLLALYALEIIVPLLALAIAFVTRRARRAVRLI* |
| Ga0066665_114437542 | 3300006796 | Soil | LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQALDRGRL* |
| Ga0068865_1014199932 | 3300006881 | Miscanthus Rhizosphere | LLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI* |
| Ga0066710_1025464782 | 3300009012 | Grasslands Soil | MLILYGLLALYALEIVLPLLALAIAFVTRCTRRAFTNRAA |
| Ga0066710_1045645102 | 3300009012 | Grasslands Soil | LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQALDRGRL |
| Ga0105244_104294862 | 3300009036 | Miscanthus Rhizosphere | MLLVYGLLALYALEILLPLLALAIAFVTRRARRASSV* |
| Ga0105250_100475933 | 3300009092 | Switchgrass Rhizosphere | MLLLYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI* |
| Ga0066709_1000511091 | 3300009137 | Grasslands Soil | MLILYGLLALYALEIVLPLLALAIAFVTRCTRRAFTNRAA* |
| Ga0066709_1001320552 | 3300009137 | Grasslands Soil | MLLVYGLLALYALEIILPLLALAIAFVTRRARRALSV* |
| Ga0105242_100409815 | 3300009176 | Miscanthus Rhizosphere | MLLVYGLLALYALEIVLPLIALAIAFVTRRARRAI* |
| Ga0126374_104495622 | 3300009792 | Tropical Forest Soil | MLIVWGLLALYALEIVVPLAALTIAYVTRRARRLAGTRT* |
| Ga0126310_1000050021 | 3300010044 | Serpentine Soil | MLILYGLLALYALEVVLPLLALAIAFVTRSTRRALANRA* |
| Ga0126384_114411231 | 3300010046 | Tropical Forest Soil | MLLVYGLLALYALEIVVPLLALAIAFVTRRARRARSA* |
| Ga0126319_14962191 | 3300010147 | Soil | MLLVYGLLALYALEIVVPLLALAIAFVTRRARRALSV* |
| Ga0126370_120037232 | 3300010358 | Tropical Forest Soil | MKGPMLIVWGLLALYALEIVLPLAALAIAYVSRRARRVFS* |
| Ga0134125_104375763 | 3300010371 | Terrestrial Soil | GPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL* |
| Ga0138514_1001384801 | 3300011003 | Soil | MLLLYGLLALYALEIVLPLLVLAIAFVTRRARRAFSVI* |
| Ga0137383_100272382 | 3300012199 | Vadose Zone Soil | MLLVYGLFALYALEIIVPLLALAIAFVTRRARRALSV* |
| Ga0137382_106078041 | 3300012200 | Vadose Zone Soil | LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVERLT* |
| Ga0137382_109338972 | 3300012200 | Vadose Zone Soil | LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVEPL* |
| Ga0137365_100146486 | 3300012201 | Vadose Zone Soil | MLILYGLLALYALEIVVPLVVLAVAFVKRRARAAVEHLT* |
| Ga0137376_100087915 | 3300012208 | Vadose Zone Soil | MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRAFANRTA* |
| Ga0137379_100884617 | 3300012209 | Vadose Zone Soil | VYGLLALYALEIIVPLLALAIAFVTRRARRALSV* |
| Ga0137377_100257883 | 3300012211 | Vadose Zone Soil | MLLLYGLLGLYALEIVLPLLALAIAFVTRCARRALSV* |
| Ga0137370_100659492 | 3300012285 | Vadose Zone Soil | MLLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFRESSA* |
| Ga0137370_102349922 | 3300012285 | Vadose Zone Soil | MLIVYGLLALYALEIVVPLLALAIAYVKRSTRRAFANRTA* |
| Ga0137372_103134072 | 3300012350 | Vadose Zone Soil | MLILYCLLALYALEIVLPLLVLAIAFVTRGTRRVLANRAA* |
| Ga0137371_100050066 | 3300012356 | Vadose Zone Soil | MLILYGLLALYALEIVVPLVVLAVAFVKRRARAGVEPF* |
| Ga0157285_102832372 | 3300012897 | Soil | MSGPMLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAI* |
| Ga0134110_101655212 | 3300012975 | Grasslands Soil | VELKGPMLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI* |
| Ga0164305_100194446 | 3300012989 | Soil | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARAIVRLI* |
| Ga0157374_101508055 | 3300013296 | Miscanthus Rhizosphere | MLLVYGLLALYALEILLPLLALAIACVTRRARRASSV* |
| Ga0157375_130424972 | 3300013308 | Miscanthus Rhizosphere | WMRGPMLLVYGLLALYALEIVVPLLVLAIAFVTRRARRAI* |
| Ga0134078_102379442 | 3300014157 | Grasslands Soil | MKGPMLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI* |
| Ga0182008_108777201 | 3300014497 | Rhizosphere | MLLVYGLLAVYALEIVLPLLALAIAFLTRRARRVFVRVI* |
| Ga0184605_100025633 | 3300018027 | Groundwater Sediment | MLILYGLLALYALEIVLPLLVLAIAFVTRGTRRVFANRAA |
| Ga0184605_104933141 | 3300018027 | Groundwater Sediment | LLVYGLLALYALEIVLPLIALAIAFVTRRARRDVVRVI |
| Ga0184608_101362491 | 3300018028 | Groundwater Sediment | MLLVYGLLALYALEIVLPLLALAIAFVTRRARRAIVRVI |
| Ga0184619_100249676 | 3300018061 | Groundwater Sediment | MLILYGLLALYALEIVVPLIVLAVAFVSRRARAGVERVI |
| Ga0184619_104260401 | 3300018061 | Groundwater Sediment | LLVYGLLALYALEIVLPLLVLAIAFVTRRARRASSV |
| Ga0184625_105687722 | 3300018081 | Groundwater Sediment | LLVYGLLALYALEILLPLLALAIAFVTRRARRASSV |
| Ga0066655_103235712 | 3300018431 | Grasslands Soil | MLIVYGLLALYALEIVLPLAALAIAFVTRRTRRAFVDRTA |
| Ga0066655_105119822 | 3300018431 | Grasslands Soil | MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA |
| Ga0066655_106202382 | 3300018431 | Grasslands Soil | MLLLYGLFALYALEIVLPLLALAIAFVIRSTRRVFANQAA |
| Ga0066662_105162332 | 3300018468 | Grasslands Soil | MLLLYGLLGLYALEIVLPLFALAIAYAIRRTRRVFANQAT |
| Ga0066669_117094692 | 3300018482 | Grasslands Soil | MLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI |
| Ga0137408_11834095 | 3300019789 | Vadose Zone Soil | MLLVYGLLALYALEIIVPLLALAIAFVTRRARRALSV |
| Ga0193701_10049524 | 3300019875 | Soil | MLLVYGLLALYALEIVLPLLALAIAFVPRSARRAIVR |
| Ga0193729_10024747 | 3300019887 | Soil | LILYGLLALYALEIVVPLVVLAVAFVTRRARAGLEHLT |
| Ga0193733_10480093 | 3300020022 | Soil | LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVERLT |
| Ga0193695_10165702 | 3300021418 | Soil | MLLLYGLLALYALEIVLPLLALAIAFVTRRARRALSV |
| Ga0222621_10180593 | 3300021510 | Groundwater Sediment | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRASSV |
| Ga0207696_10541332 | 3300025711 | Switchgrass Rhizosphere | MLLLYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI |
| Ga0207688_100738163 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI |
| Ga0207684_100689805 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFLYGLLALYALEIVLPLLALAIAFATRRVRRAASV |
| Ga0207684_102350023 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFLYGLLALYALEIVLPLLALAIAFVTRRARRALSV |
| Ga0207687_102536343 | 3300025927 | Miscanthus Rhizosphere | GPMLLVYGLLALYALEILLPLLALAIAFVTRRARRASSV |
| Ga0207706_101353384 | 3300025933 | Corn Rhizosphere | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIV |
| Ga0207712_113664571 | 3300025961 | Switchgrass Rhizosphere | MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRL |
| Ga0207639_119636902 | 3300026041 | Corn Rhizosphere | MLLVYGLLALYALEIVLPLLALAIAFVMRRARRAIVR |
| Ga0209239_11682562 | 3300026310 | Grasslands Soil | LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVEPL |
| Ga0209801_11154782 | 3300026326 | Soil | MSGPMLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV |
| Ga0209266_13043542 | 3300026327 | Soil | MLLVYGLLALYALEIIVPLLALTIAFVTRRARRALSV |
| Ga0209474_100256335 | 3300026550 | Soil | MLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT |
| Ga0307293_101271513 | 3300028711 | Soil | MLLVYGLLALYALEIVLPLLALAIAFVTRRARSAIV |
| Ga0307282_104687092 | 3300028784 | Soil | MLILYGLLALYALEIVLPLLALAIAFVTRGTRRVFTNRAA |
| Ga0307282_106369361 | 3300028784 | Soil | LILYGLLALYALEIVVPLIVLAVAFVSRRARAGVERVI |
| Ga0307323_102396342 | 3300028787 | Soil | LLVYGLLALYALEIVLPLIALAIAFVTRRARRASSV |
| Ga0307284_102459652 | 3300028799 | Soil | MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIVRVI |
| Ga0307312_111086981 | 3300028828 | Soil | MLLVYGLLALYALEIVLPLIALAIAFVTRRARRASSV |
| Ga0307278_105146591 | 3300028878 | Soil | MLILYGLLALYALEVVLPLLALAIAFVTRSTRRALANRA |
| Ga0307277_102033252 | 3300028881 | Soil | MLILYGLLALYALEIALPLVVLVIAFVTRGTRRVFANRAA |
| Ga0307277_104613721 | 3300028881 | Soil | MLILYGLLALYALEVVLPLLVLAIAFLTRGTRRVFANRAA |
| Ga0307277_104757892 | 3300028881 | Soil | MLLVYGLLALYALEILLPLIALAIAFVTRRARRASSA |
| Ga0308194_100794292 | 3300031421 | Soil | PMLLVYGLLALYALEIVLPLLVLAIAFVTRRARGASSV |
| Ga0310893_105042452 | 3300031892 | Soil | MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAP |
| Ga0308175_1004276422 | 3300031938 | Soil | MLILYGLLALYALEVVLPLLALAIAFAIRSTRRVFANQAA |
| Ga0310885_103091941 | 3300031943 | Soil | QIGMRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL |
| Ga0310897_103538111 | 3300032003 | Soil | MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRGL |
| Ga0310812_101114722 | 3300032421 | Soil | MLLVYGLLALYALEIVLPLLALAIAFVTRRVRRAIVRVI |
| Ga0372943_0428939_196_309 | 3300034268 | Soil | MLILYGLLALYALEIVLPLLALAVAYVTRRARRNLSY |
| ⦗Top⦘ |