Metagenome / Metatranscriptome Family F077872

Basic Information
Family ID	F077872
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	39 residues
Representative Sequence	MLLLYGLLALYALEIVLPLLALAIAFVTRRARRALSV
Number of Associated Samples	101
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	81.20 %
% of genes near scaffold ends (potentially truncated)	13.68 %
% of genes from short scaffolds (< 2000 bps)	80.34 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Most Common Taxonomy
Group	Bacteria (68.376 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.222 % of family members)
Environment Ontology (ENVO)	Unclassified (29.915 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (54.701 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF00027	cNMP_binding	24.79
PF12697	Abhydrolase_6	15.38
PF00561	Abhydrolase_1	13.68
PF05988	DUF899	1.71
PF08327	AHSA1	1.71
PF01022	HTH_5	1.71
PF07883	Cupin_2	0.85
PF08281	Sigma70_r4_2	0.85
PF08808	RES	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	1.71
COG5654	Predicted toxin component of a toxin-antitoxin system, contains RES domain	Defense mechanisms [V]	0.85

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.94 %
Unclassified	root	N/A	29.06 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.94 %
Unclassified	root	N/A	29.06 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	68.38 %
Unclassified	root	N/A	29.06 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.56 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	37.61 %
Unclassified	root	N/A	29.06 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2.56 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.06 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	27.35 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.56 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2.56 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.06 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	17.09 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	1.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.85 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.06 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	14.53 %
Basidiomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota	1.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.85 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.06 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	14.53 %
Agaricomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina	1.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.85 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.06 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	14.53 %
Agaricomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes	1.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.85 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908045\|KansclcFeb2_ConsensusfromContig814854	Not Available	1345	Open in IMG/M
2170459015\|G14TP7Y01DHPD0	Not Available	644	Open in IMG/M
3300000837\|AP72_2010_repI_A100DRAFT_1020270	Not Available	934	Open in IMG/M
3300000890\|JGI11643J12802_10122859	Not Available	659	Open in IMG/M
3300000891\|JGI10214J12806_10395740	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300000955\|JGI1027J12803_103295849	Not Available	987	Open in IMG/M
3300004157\|Ga0062590_102368807	Not Available	560	Open in IMG/M
3300005166\|Ga0066674_10377619	Not Available	662	Open in IMG/M
3300005171\|Ga0066677_10047545	All Organisms → cellular organisms → Bacteria	2132	Open in IMG/M
3300005178\|Ga0066688_10755273	Not Available	612	Open in IMG/M
3300005179\|Ga0066684_10051188	All Organisms → cellular organisms → Bacteria	2367	Open in IMG/M
3300005179\|Ga0066684_10443797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	872	Open in IMG/M
3300005186\|Ga0066676_10921818	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300005187\|Ga0066675_11152197	Not Available	577	Open in IMG/M
3300005332\|Ga0066388_105548424	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300005341\|Ga0070691_10447426	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300005444\|Ga0070694_100177833	All Organisms → cellular organisms → Bacteria	1572	Open in IMG/M
3300005454\|Ga0066687_10078734	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1615	Open in IMG/M
3300005454\|Ga0066687_10772815	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	572	Open in IMG/M
3300005553\|Ga0066695_10510182	Not Available	738	Open in IMG/M
3300005566\|Ga0066693_10026566	All Organisms → cellular organisms → Bacteria	1798	Open in IMG/M
3300005569\|Ga0066705_10715236	Not Available	603	Open in IMG/M
3300005598\|Ga0066706_11438422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	519	Open in IMG/M
3300005614\|Ga0068856_101008168	All Organisms → cellular organisms → Bacteria → Terrabacteria group	851	Open in IMG/M
3300005617\|Ga0068859_100772259	Not Available	1049	Open in IMG/M
3300005713\|Ga0066905_100925455	Not Available	764	Open in IMG/M
3300005713\|Ga0066905_101823059	Not Available	561	Open in IMG/M
3300005719\|Ga0068861_101480299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	665	Open in IMG/M
3300005764\|Ga0066903_100011344	All Organisms → cellular organisms → Bacteria	8613	Open in IMG/M
3300006031\|Ga0066651_10340512	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	805	Open in IMG/M
3300006031\|Ga0066651_10382625	All Organisms → cellular organisms → Bacteria → Terrabacteria group	752	Open in IMG/M
3300006032\|Ga0066696_10112019	Not Available	1657	Open in IMG/M
3300006034\|Ga0066656_10292758	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1050	Open in IMG/M
3300006046\|Ga0066652_101163811	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300006163\|Ga0070715_10131390	All Organisms → cellular organisms → Bacteria	1205	Open in IMG/M
3300006175\|Ga0070712_101549211	Not Available	579	Open in IMG/M
3300006791\|Ga0066653_10283222	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300006796\|Ga0066665_11443754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	534	Open in IMG/M
3300006881\|Ga0068865_101419993	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	620	Open in IMG/M
3300009012\|Ga0066710_102546478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	738	Open in IMG/M
3300009012\|Ga0066710_104564510	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	517	Open in IMG/M
3300009036\|Ga0105244_10429486	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300009092\|Ga0105250_10047593	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1720	Open in IMG/M
3300009137\|Ga0066709_100051109	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4667	Open in IMG/M
3300009137\|Ga0066709_100132055	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3148	Open in IMG/M
3300009176\|Ga0105242_10040981	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3733	Open in IMG/M
3300009792\|Ga0126374_10449562	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300010044\|Ga0126310_10000500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	13629	Open in IMG/M
3300010046\|Ga0126384_11441123	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes	643	Open in IMG/M
3300010147\|Ga0126319_1496219	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300010358\|Ga0126370_12003723	Not Available	566	Open in IMG/M
3300010371\|Ga0134125_10437576	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	1450	Open in IMG/M
3300011003\|Ga0138514_100138480	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	539	Open in IMG/M
3300012199\|Ga0137383_10027238	All Organisms → cellular organisms → Bacteria	3996	Open in IMG/M
3300012200\|Ga0137382_10607804	Not Available	781	Open in IMG/M
3300012200\|Ga0137382_10933897	Not Available	624	Open in IMG/M
3300012201\|Ga0137365_10014648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6159	Open in IMG/M
3300012208\|Ga0137376_10008791	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7062	Open in IMG/M
3300012209\|Ga0137379_10088461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2980	Open in IMG/M
3300012211\|Ga0137377_10025788	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5264	Open in IMG/M
3300012285\|Ga0137370_10065949	All Organisms → cellular organisms → Bacteria	1974	Open in IMG/M
3300012285\|Ga0137370_10234992	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1083	Open in IMG/M
3300012350\|Ga0137372_10313407	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1212	Open in IMG/M
3300012356\|Ga0137371_10005006	All Organisms → cellular organisms → Bacteria	10387	Open in IMG/M
3300012897\|Ga0157285_10283237	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300012975\|Ga0134110_10165521	Not Available	918	Open in IMG/M
3300012989\|Ga0164305_10019444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3502	Open in IMG/M
3300013296\|Ga0157374_10150805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2260	Open in IMG/M
3300013308\|Ga0157375_13042497	Not Available	560	Open in IMG/M
3300014157\|Ga0134078_10237944	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300014497\|Ga0182008_10877720	Not Available	526	Open in IMG/M
3300018027\|Ga0184605_10002563	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6150	Open in IMG/M
3300018027\|Ga0184605_10493314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	534	Open in IMG/M
3300018028\|Ga0184608_10136249	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1050	Open in IMG/M
3300018061\|Ga0184619_10024967	All Organisms → cellular organisms → Bacteria	2483	Open in IMG/M
3300018061\|Ga0184619_10426040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	596	Open in IMG/M
3300018081\|Ga0184625_10568772	Not Available	561	Open in IMG/M
3300018431\|Ga0066655_10323571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1008	Open in IMG/M
3300018431\|Ga0066655_10511982	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	797	Open in IMG/M
3300018431\|Ga0066655_10620238	Not Available	730	Open in IMG/M
3300018468\|Ga0066662_10516233	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300018482\|Ga0066669_11709469	All Organisms → cellular organisms → Bacteria → Terrabacteria group	578	Open in IMG/M
3300019789\|Ga0137408_1183409	All Organisms → cellular organisms → Bacteria	2131	Open in IMG/M
3300019875\|Ga0193701_1004952	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2514	Open in IMG/M
3300019887\|Ga0193729_1002474	All Organisms → cellular organisms → Bacteria	9187	Open in IMG/M
3300020022\|Ga0193733_1048009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1206	Open in IMG/M
3300021418\|Ga0193695_1016570	All Organisms → cellular organisms → Bacteria	1521	Open in IMG/M
3300021510\|Ga0222621_1018059	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1402	Open in IMG/M
3300025711\|Ga0207696_1054133	Not Available	1141	Open in IMG/M
3300025901\|Ga0207688_10073816	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1939	Open in IMG/M
3300025910\|Ga0207684_10068980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3005	Open in IMG/M
3300025910\|Ga0207684_10235002	All Organisms → cellular organisms → Bacteria	1581	Open in IMG/M
3300025927\|Ga0207687_10253634	All Organisms → cellular organisms → Bacteria	1400	Open in IMG/M
3300025933\|Ga0207706_10135338	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2168	Open in IMG/M
3300025961\|Ga0207712_11366457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	634	Open in IMG/M
3300026041\|Ga0207639_11963690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	546	Open in IMG/M
3300026310\|Ga0209239_1168256	Not Available	844	Open in IMG/M
3300026326\|Ga0209801_1115478	Not Available	1153	Open in IMG/M
3300026327\|Ga0209266_1304354	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300026550\|Ga0209474_10025633	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4485	Open in IMG/M
3300028711\|Ga0307293_10127151	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	810	Open in IMG/M
3300028784\|Ga0307282_10468709	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	611	Open in IMG/M
3300028784\|Ga0307282_10636936	Not Available	517	Open in IMG/M
3300028787\|Ga0307323_10239634	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	654	Open in IMG/M
3300028799\|Ga0307284_10245965	Not Available	711	Open in IMG/M
3300028828\|Ga0307312_11108698	Not Available	523	Open in IMG/M
3300028878\|Ga0307278_10514659	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes	522	Open in IMG/M
3300028881\|Ga0307277_10203325	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300028881\|Ga0307277_10461372	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	569	Open in IMG/M
3300028881\|Ga0307277_10475789	Not Available	560	Open in IMG/M
3300031421\|Ga0308194_10079429	Not Available	904	Open in IMG/M
3300031892\|Ga0310893_10504245	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300031938\|Ga0308175_100427642	All Organisms → cellular organisms → Bacteria	1391	Open in IMG/M
3300031943\|Ga0310885_10309194	Not Available	819	Open in IMG/M
3300032003\|Ga0310897_10353811	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300032421\|Ga0310812_10111472	Not Available	1135	Open in IMG/M
3300034268\|Ga0372943_0428939	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	85.47%
Host-Associated	Host-Associated	13.68%
Engineered	Engineered	0.85%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.63%
Plants	Host-Associated → Plants	13.68%
Aquatic	Environmental → Aquatic	6.84%
Solid Waste	Engineered → Solid Waste	0.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.55%
Sediment	Environmental → Aquatic → Sediment	5.98%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.13%
Freshwater	Environmental → Aquatic → Freshwater	0.85%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.85%
Grass	Engineered → Solid Waste → Grass	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	68.38%
Loam	Environmental → Terrestrial → Soil → Loam	9.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.98%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.13%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.85%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.85%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.85%
Composting	Engineered → Solid Waste → Grass → Composting	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.62%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	30.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.13%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.85%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.85%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	22.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.38%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.26%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	8.55%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.13%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.71%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.85%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.85%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.85%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.85%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
2170459015	Litter degradation PV4	Engineered	Open in IMG/M
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031892	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
KansclcFeb2_13903910	2124908045	Soil	MLLVYGLLALYALEIVLPLLALAIAFLTRRARRVFVRVI
4PV_02857050	2170459015	Switchgrass, Maize And Mischanthus Litter	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAI
AP72_2010_repI_A100DRAFT_10202702	3300000837	Forest Soil	MLLLYGLLALYALEIVLPLLALAIAYVTRRARRAPSV*
JGI11643J12802_101228592	3300000890	Soil	LLVYGLLALYALEIVLPLLALAIAFVMRRARAIVRLI*
JGI10214J12806_103957402	3300000891	Soil	MRGPRLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL*
JGI1027J12803_1032958492	3300000955	Soil	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIV*
Ga0062590_1023688071	3300004157	Soil	MRGPMLLVYGLLALYALEIVLPLLALAIAFVMRRARAIVRLI*
Ga0066674_103776191	3300005166	Soil	MKGPMLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI*
Ga0066677_100475452	3300005171	Soil	MLLLYGLFALYALEIVLPLLALAIAFVIRSTRRVFANQAA*
Ga0066688_107552731	3300005178	Soil	MSGPMLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV*
Ga0066684_100511882	3300005179	Soil	MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA*
Ga0066684_104437972	3300005179	Soil	LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAA*
Ga0066676_109218182	3300005186	Soil	MLLLYGLLALYALEIVLPLLGLAITFAIRSTRRIFANQAA*
Ga0066675_111521972	3300005187	Soil	MLLLYGLLGLYALEIVLPLFALAIAYAIRRTRRVFANQAT*
Ga0066388_1055484242	3300005332	Tropical Forest Soil	MKGPMLIVWGLLALYALEIVVPLAALTIAYVTRRARRLAGTRT*
Ga0070691_104474262	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MLLVYGLLALYALEIVLPLLVLAIAFATRRARRAIVRVI*
Ga0070694_1001778333	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL*
Ga0066687_100787341	3300005454	Soil	MLLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAA*
Ga0066687_107728151	3300005454	Soil	MLLLYGLLALYALEIVLPLLALAIAFAIRSTRRVFANQAA*
Ga0066695_105101822	3300005553	Soil	MLLVYGLLALYALEIIVPLLALAIAFVTRRARRALSV*
Ga0066693_100265664	3300005566	Soil	YGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA*
Ga0066705_107152361	3300005569	Soil	TAMRGPMLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT*
Ga0066706_114384221	3300005598	Soil	MLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV*
Ga0068856_1010081681	3300005614	Corn Rhizosphere	MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL*
Ga0068859_1007722592	3300005617	Switchgrass Rhizosphere	MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI*
Ga0066905_1009254551	3300005713	Tropical Forest Soil	MLLVYGLLALYALEIVLPLLALAIAFVTRRARRALSA*
Ga0066905_1018230592	3300005713	Tropical Forest Soil	MRGPMLLVYGLLALYALEIVVPLLALAIAFVTRRARRAPSV*
Ga0068861_1014802992	3300005719	Switchgrass Rhizosphere	LLVYGLLALYALEILLPLLALAIAFVTRRARRASSV*
Ga0066903_1000113446	3300005764	Tropical Forest Soil	MLIVWGLLALYALEIVLPLAALAIAYVSRRARRVFS*
Ga0066651_103405121	3300006031	Soil	MLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI*
Ga0066651_103826252	3300006031	Soil	MLILYGLLALYALEVVLPLLALAIAFAIRSTRRVFANQAA*
Ga0066696_101120193	3300006032	Soil	MLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT*
Ga0066656_102927581	3300006034	Soil	LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQAARPGRL*
Ga0066652_1011638112	3300006046	Soil	MLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI*
Ga0070715_101313901	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	IGMRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL*
Ga0070712_1015492112	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MLLLYGLLALYALEIVVPLLVLAIAFVTRRARRAI*
Ga0066653_102832222	3300006791	Soil	MLLVYGLLALYALEIIVPLLALAIAFVTRRARRAVRLI*
Ga0066665_114437542	3300006796	Soil	LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQALDRGRL*
Ga0068865_1014199932	3300006881	Miscanthus Rhizosphere	LLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI*
Ga0066710_1025464782	3300009012	Grasslands Soil	MLILYGLLALYALEIVLPLLALAIAFVTRCTRRAFTNRAA
Ga0066710_1045645102	3300009012	Grasslands Soil	LLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFANQALDRGRL
Ga0105244_104294862	3300009036	Miscanthus Rhizosphere	MLLVYGLLALYALEILLPLLALAIAFVTRRARRASSV*
Ga0105250_100475933	3300009092	Switchgrass Rhizosphere	MLLLYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI*
Ga0066709_1000511091	3300009137	Grasslands Soil	MLILYGLLALYALEIVLPLLALAIAFVTRCTRRAFTNRAA*
Ga0066709_1001320552	3300009137	Grasslands Soil	MLLVYGLLALYALEIILPLLALAIAFVTRRARRALSV*
Ga0105242_100409815	3300009176	Miscanthus Rhizosphere	MLLVYGLLALYALEIVLPLIALAIAFVTRRARRAI*
Ga0126374_104495622	3300009792	Tropical Forest Soil	MLIVWGLLALYALEIVVPLAALTIAYVTRRARRLAGTRT*
Ga0126310_1000050021	3300010044	Serpentine Soil	MLILYGLLALYALEVVLPLLALAIAFVTRSTRRALANRA*
Ga0126384_114411231	3300010046	Tropical Forest Soil	MLLVYGLLALYALEIVVPLLALAIAFVTRRARRARSA*
Ga0126319_14962191	3300010147	Soil	MLLVYGLLALYALEIVVPLLALAIAFVTRRARRALSV*
Ga0126370_120037232	3300010358	Tropical Forest Soil	MKGPMLIVWGLLALYALEIVLPLAALAIAYVSRRARRVFS*
Ga0134125_104375763	3300010371	Terrestrial Soil	GPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL*
Ga0138514_1001384801	3300011003	Soil	MLLLYGLLALYALEIVLPLLVLAIAFVTRRARRAFSVI*
Ga0137383_100272382	3300012199	Vadose Zone Soil	MLLVYGLFALYALEIIVPLLALAIAFVTRRARRALSV*
Ga0137382_106078041	3300012200	Vadose Zone Soil	LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVERLT*
Ga0137382_109338972	3300012200	Vadose Zone Soil	LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVEPL*
Ga0137365_100146486	3300012201	Vadose Zone Soil	MLILYGLLALYALEIVVPLVVLAVAFVKRRARAAVEHLT*
Ga0137376_100087915	3300012208	Vadose Zone Soil	MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRAFANRTA*
Ga0137379_100884617	3300012209	Vadose Zone Soil	VYGLLALYALEIIVPLLALAIAFVTRRARRALSV*
Ga0137377_100257883	3300012211	Vadose Zone Soil	MLLLYGLLGLYALEIVLPLLALAIAFVTRCARRALSV*
Ga0137370_100659492	3300012285	Vadose Zone Soil	MLLLYGLLALYALEIVLPLLALAVAFVIRSTRRVFRESSA*
Ga0137370_102349922	3300012285	Vadose Zone Soil	MLIVYGLLALYALEIVVPLLALAIAYVKRSTRRAFANRTA*
Ga0137372_103134072	3300012350	Vadose Zone Soil	MLILYCLLALYALEIVLPLLVLAIAFVTRGTRRVLANRAA*
Ga0137371_100050066	3300012356	Vadose Zone Soil	MLILYGLLALYALEIVVPLVVLAVAFVKRRARAGVEPF*
Ga0157285_102832372	3300012897	Soil	MSGPMLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAI*
Ga0134110_101655212	3300012975	Grasslands Soil	VELKGPMLIVWGLLALYALEIVLPLAALAIAYVTRRARRVLRVI*
Ga0164305_100194446	3300012989	Soil	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARAIVRLI*
Ga0157374_101508055	3300013296	Miscanthus Rhizosphere	MLLVYGLLALYALEILLPLLALAIACVTRRARRASSV*
Ga0157375_130424972	3300013308	Miscanthus Rhizosphere	WMRGPMLLVYGLLALYALEIVVPLLVLAIAFVTRRARRAI*
Ga0134078_102379442	3300014157	Grasslands Soil	MKGPMLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI*
Ga0182008_108777201	3300014497	Rhizosphere	MLLVYGLLAVYALEIVLPLLALAIAFLTRRARRVFVRVI*
Ga0184605_100025633	3300018027	Groundwater Sediment	MLILYGLLALYALEIVLPLLVLAIAFVTRGTRRVFANRAA
Ga0184605_104933141	3300018027	Groundwater Sediment	LLVYGLLALYALEIVLPLIALAIAFVTRRARRDVVRVI
Ga0184608_101362491	3300018028	Groundwater Sediment	MLLVYGLLALYALEIVLPLLALAIAFVTRRARRAIVRVI
Ga0184619_100249676	3300018061	Groundwater Sediment	MLILYGLLALYALEIVVPLIVLAVAFVSRRARAGVERVI
Ga0184619_104260401	3300018061	Groundwater Sediment	LLVYGLLALYALEIVLPLLVLAIAFVTRRARRASSV
Ga0184625_105687722	3300018081	Groundwater Sediment	LLVYGLLALYALEILLPLLALAIAFVTRRARRASSV
Ga0066655_103235712	3300018431	Grasslands Soil	MLIVYGLLALYALEIVLPLAALAIAFVTRRTRRAFVDRTA
Ga0066655_105119822	3300018431	Grasslands Soil	MLIVYGLLALYALEIVVPLLALAIAFVTRSTRRVFANRIA
Ga0066655_106202382	3300018431	Grasslands Soil	MLLLYGLFALYALEIVLPLLALAIAFVIRSTRRVFANQAA
Ga0066662_105162332	3300018468	Grasslands Soil	MLLLYGLLGLYALEIVLPLFALAIAYAIRRTRRVFANQAT
Ga0066669_117094692	3300018482	Grasslands Soil	MLIIWGLLALYALEIVLPLAALAIVYVTRRARRVLRVI
Ga0137408_11834095	3300019789	Vadose Zone Soil	MLLVYGLLALYALEIIVPLLALAIAFVTRRARRALSV
Ga0193701_10049524	3300019875	Soil	MLLVYGLLALYALEIVLPLLALAIAFVPRSARRAIVR
Ga0193729_10024747	3300019887	Soil	LILYGLLALYALEIVVPLVVLAVAFVTRRARAGLEHLT
Ga0193733_10480093	3300020022	Soil	LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVERLT
Ga0193695_10165702	3300021418	Soil	MLLLYGLLALYALEIVLPLLALAIAFVTRRARRALSV
Ga0222621_10180593	3300021510	Groundwater Sediment	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRASSV
Ga0207696_10541332	3300025711	Switchgrass Rhizosphere	MLLLYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI
Ga0207688_100738163	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRLI
Ga0207684_100689805	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MLFLYGLLALYALEIVLPLLALAIAFATRRVRRAASV
Ga0207684_102350023	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MLFLYGLLALYALEIVLPLLALAIAFVTRRARRALSV
Ga0207687_102536343	3300025927	Miscanthus Rhizosphere	GPMLLVYGLLALYALEILLPLLALAIAFVTRRARRASSV
Ga0207706_101353384	3300025933	Corn Rhizosphere	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIV
Ga0207712_113664571	3300025961	Switchgrass Rhizosphere	MLLVYGLLALYALEIVLPLIALAIAFVTRRARAIIRL
Ga0207639_119636902	3300026041	Corn Rhizosphere	MLLVYGLLALYALEIVLPLLALAIAFVMRRARRAIVR
Ga0209239_11682562	3300026310	Grasslands Soil	LILYGLLALYALEIVVPLVVLAVAFVTRRARAGVEPL
Ga0209801_11154782	3300026326	Soil	MSGPMLLLYGLLALYALEIVLPLLALAIALVTRRARRAFSV
Ga0209266_13043542	3300026327	Soil	MLLVYGLLALYALEIIVPLLALTIAFVTRRARRALSV
Ga0209474_100256335	3300026550	Soil	MLLLYGLLGLYALEIVLPLFALAIAYVIRRTRRVFANQAT
Ga0307293_101271513	3300028711	Soil	MLLVYGLLALYALEIVLPLLALAIAFVTRRARSAIV
Ga0307282_104687092	3300028784	Soil	MLILYGLLALYALEIVLPLLALAIAFVTRGTRRVFTNRAA
Ga0307282_106369361	3300028784	Soil	LILYGLLALYALEIVVPLIVLAVAFVSRRARAGVERVI
Ga0307323_102396342	3300028787	Soil	LLVYGLLALYALEIVLPLIALAIAFVTRRARRASSV
Ga0307284_102459652	3300028799	Soil	MLLVYGLLALYALEIVLPLLVLAIAFVTRRARRAIVRVI
Ga0307312_111086981	3300028828	Soil	MLLVYGLLALYALEIVLPLIALAIAFVTRRARRASSV
Ga0307278_105146591	3300028878	Soil	MLILYGLLALYALEVVLPLLALAIAFVTRSTRRALANRA
Ga0307277_102033252	3300028881	Soil	MLILYGLLALYALEIALPLVVLVIAFVTRGTRRVFANRAA
Ga0307277_104613721	3300028881	Soil	MLILYGLLALYALEVVLPLLVLAIAFLTRGTRRVFANRAA
Ga0307277_104757892	3300028881	Soil	MLLVYGLLALYALEILLPLIALAIAFVTRRARRASSA
Ga0308194_100794292	3300031421	Soil	PMLLVYGLLALYALEIVLPLLVLAIAFVTRRARGASSV
Ga0310893_105042452	3300031892	Soil	MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAP
Ga0308175_1004276422	3300031938	Soil	MLILYGLLALYALEVVLPLLALAIAFAIRSTRRVFANQAA
Ga0310885_103091941	3300031943	Soil	QIGMRGPMLLLYGLLTLYALEIVLPLLALAIAYVTRRARRAL
Ga0310897_103538111	3300032003	Soil	MLLLYGLLTLYALEIVLPLLALAIAYVTRRARRGL
Ga0310812_101114722	3300032421	Soil	MLLVYGLLALYALEIVLPLLALAIAFVTRRVRRAIVRVI
Ga0372943_0428939_196_309	3300034268	Soil	MLILYGLLALYALEIVLPLLALAVAYVTRRARRNLSY

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077872

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign