| Basic Information | |
|---|---|
| Family ID | F077871 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRQSPGVLDGNQL |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.598 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.932 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.607 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.03% β-sheet: 0.00% Coil/Unstructured: 72.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 9.40 |
| PF00440 | TetR_N | 8.55 |
| PF02567 | PhzC-PhzF | 7.69 |
| PF16925 | TetR_C_13 | 6.84 |
| PF00106 | adh_short | 2.56 |
| PF03795 | YCII | 1.71 |
| PF00589 | Phage_integrase | 1.71 |
| PF00085 | Thioredoxin | 1.71 |
| PF13411 | MerR_1 | 0.85 |
| PF12833 | HTH_18 | 0.85 |
| PF00723 | Glyco_hydro_15 | 0.85 |
| PF13374 | TPR_10 | 0.85 |
| PF09339 | HTH_IclR | 0.85 |
| PF02518 | HATPase_c | 0.85 |
| PF13683 | rve_3 | 0.85 |
| PF13613 | HTH_Tnp_4 | 0.85 |
| PF13460 | NAD_binding_10 | 0.85 |
| PF03176 | MMPL | 0.85 |
| PF00135 | COesterase | 0.85 |
| PF09278 | MerR-DNA-bind | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 7.69 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.71 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.85 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.85 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.85 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.85 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.60 % |
| Unclassified | root | N/A | 9.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M102I86SF | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
| 2189573002|GZIGXIF02HJ131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 518 | Open in IMG/M |
| 3300000956|JGI10216J12902_110242708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1297 | Open in IMG/M |
| 3300001867|JGI12627J18819_10392289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 564 | Open in IMG/M |
| 3300004081|Ga0063454_100829518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300004091|Ga0062387_101449797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300005172|Ga0066683_10426613 | Not Available | 816 | Open in IMG/M |
| 3300005332|Ga0066388_108333243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300005338|Ga0068868_100497675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300005364|Ga0070673_101870258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300005406|Ga0070703_10609033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 505 | Open in IMG/M |
| 3300005435|Ga0070714_100264852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1592 | Open in IMG/M |
| 3300005435|Ga0070714_102460482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 505 | Open in IMG/M |
| 3300005437|Ga0070710_10270450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1099 | Open in IMG/M |
| 3300005437|Ga0070710_10620898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300005451|Ga0066681_10994408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 500 | Open in IMG/M |
| 3300005468|Ga0070707_101719081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 594 | Open in IMG/M |
| 3300005530|Ga0070679_100200604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1961 | Open in IMG/M |
| 3300005548|Ga0070665_100209843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1948 | Open in IMG/M |
| 3300005563|Ga0068855_100545039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1256 | Open in IMG/M |
| 3300005564|Ga0070664_100963333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 801 | Open in IMG/M |
| 3300005614|Ga0068856_100400330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1393 | Open in IMG/M |
| 3300005713|Ga0066905_101274986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300006163|Ga0070715_10134505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1194 | Open in IMG/M |
| 3300006175|Ga0070712_101014294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 719 | Open in IMG/M |
| 3300006755|Ga0079222_12542913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 514 | Open in IMG/M |
| 3300006804|Ga0079221_10744352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 691 | Open in IMG/M |
| 3300006854|Ga0075425_100167731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2520 | Open in IMG/M |
| 3300006954|Ga0079219_10517110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300009093|Ga0105240_12589509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 524 | Open in IMG/M |
| 3300009177|Ga0105248_11931829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 670 | Open in IMG/M |
| 3300009700|Ga0116217_10824100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 571 | Open in IMG/M |
| 3300009826|Ga0123355_11879374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 561 | Open in IMG/M |
| 3300010048|Ga0126373_10659509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1102 | Open in IMG/M |
| 3300010048|Ga0126373_12603978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300010358|Ga0126370_10518393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium obuense | 1011 | Open in IMG/M |
| 3300010360|Ga0126372_10103997 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300010360|Ga0126372_12260574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300010361|Ga0126378_11045892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300010366|Ga0126379_11209802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300010376|Ga0126381_101392193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1014 | Open in IMG/M |
| 3300010396|Ga0134126_10376328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1652 | Open in IMG/M |
| 3300010396|Ga0134126_12745611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 534 | Open in IMG/M |
| 3300012198|Ga0137364_10541073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300012210|Ga0137378_10395662 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300012357|Ga0137384_10371753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300012361|Ga0137360_11831034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 513 | Open in IMG/M |
| 3300012930|Ga0137407_11965530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 558 | Open in IMG/M |
| 3300012971|Ga0126369_10552362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300012971|Ga0126369_11442238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium obuense | 778 | Open in IMG/M |
| 3300014968|Ga0157379_11496553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 657 | Open in IMG/M |
| 3300016294|Ga0182041_10306427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1318 | Open in IMG/M |
| 3300016319|Ga0182033_11669772 | Not Available | 577 | Open in IMG/M |
| 3300016357|Ga0182032_11509831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 583 | Open in IMG/M |
| 3300016422|Ga0182039_10754978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300016445|Ga0182038_10894596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 782 | Open in IMG/M |
| 3300016445|Ga0182038_12155373 | Not Available | 505 | Open in IMG/M |
| 3300017924|Ga0187820_1245863 | Not Available | 573 | Open in IMG/M |
| 3300017937|Ga0187809_10120275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300017946|Ga0187879_10703481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 563 | Open in IMG/M |
| 3300017948|Ga0187847_10885169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 508 | Open in IMG/M |
| 3300021404|Ga0210389_10405754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
| 3300021407|Ga0210383_10584522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300021479|Ga0210410_11059246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300021560|Ga0126371_13591815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300024279|Ga0247692_1077413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300025898|Ga0207692_11029809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 544 | Open in IMG/M |
| 3300025915|Ga0207693_10799722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300025915|Ga0207693_10913116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 673 | Open in IMG/M |
| 3300025924|Ga0207694_11523844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 564 | Open in IMG/M |
| 3300025926|Ga0207659_11496775 | Not Available | 577 | Open in IMG/M |
| 3300025929|Ga0207664_10963737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 765 | Open in IMG/M |
| 3300026035|Ga0207703_11306236 | Not Available | 698 | Open in IMG/M |
| 3300026088|Ga0207641_11958025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 587 | Open in IMG/M |
| 3300027775|Ga0209177_10129565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
| 3300027787|Ga0209074_10131088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 882 | Open in IMG/M |
| 3300027882|Ga0209590_10004514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5923 | Open in IMG/M |
| 3300028379|Ga0268266_10157472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2053 | Open in IMG/M |
| 3300028379|Ga0268266_10222645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1735 | Open in IMG/M |
| 3300028800|Ga0265338_10060982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3308 | Open in IMG/M |
| 3300031543|Ga0318516_10771979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300031546|Ga0318538_10624274 | Not Available | 585 | Open in IMG/M |
| 3300031549|Ga0318571_10262352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces shenzhenensis | 638 | Open in IMG/M |
| 3300031573|Ga0310915_10586350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300031640|Ga0318555_10212952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300031668|Ga0318542_10249157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 903 | Open in IMG/M |
| 3300031682|Ga0318560_10021816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2939 | Open in IMG/M |
| 3300031719|Ga0306917_10406885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1063 | Open in IMG/M |
| 3300031719|Ga0306917_10747601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300031719|Ga0306917_10862617 | Not Available | 709 | Open in IMG/M |
| 3300031747|Ga0318502_10320710 | Not Available | 913 | Open in IMG/M |
| 3300031770|Ga0318521_10270600 | Not Available | 996 | Open in IMG/M |
| 3300031778|Ga0318498_10171630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 986 | Open in IMG/M |
| 3300031779|Ga0318566_10502217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 594 | Open in IMG/M |
| 3300031782|Ga0318552_10492643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300031819|Ga0318568_10572376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300031831|Ga0318564_10103861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300031896|Ga0318551_10045178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2202 | Open in IMG/M |
| 3300031912|Ga0306921_11023070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300031945|Ga0310913_11012610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
| 3300031981|Ga0318531_10053736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. CiP3 | 1715 | Open in IMG/M |
| 3300032043|Ga0318556_10647316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 551 | Open in IMG/M |
| 3300032052|Ga0318506_10028356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2118 | Open in IMG/M |
| 3300032052|Ga0318506_10159968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300032060|Ga0318505_10198466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300032065|Ga0318513_10304615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabichelini | 774 | Open in IMG/M |
| 3300032074|Ga0308173_11865280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 567 | Open in IMG/M |
| 3300032261|Ga0306920_102184656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 770 | Open in IMG/M |
| 3300032829|Ga0335070_11294128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300032895|Ga0335074_10643967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1041 | Open in IMG/M |
| 3300032954|Ga0335083_11134467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 609 | Open in IMG/M |
| 3300032955|Ga0335076_10069572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3467 | Open in IMG/M |
| 3300032955|Ga0335076_10304933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1481 | Open in IMG/M |
| 3300032955|Ga0335076_10972302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 731 | Open in IMG/M |
| 3300033004|Ga0335084_11647271 | Not Available | 632 | Open in IMG/M |
| 3300033289|Ga0310914_11187071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300033289|Ga0310914_11382801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_04206270 | 2189573001 | Grass Soil | MKYMLQVRFNGADTVIGRLPTEEQQNVRAEFEAIRQSSGVLDGQPAPSR |
| FE1_01168910 | 2189573002 | Grass Soil | MKYLLQVRFNGADAVIGKLPAGEQEKITAEFIAIRRSP |
| JGI10216J12902_1102427083 | 3300000956 | Soil | MKYMLQVRFNGADLTINELPAEQRQAIFAEFEAIGRLPG |
| JGI12627J18819_103922891 | 3300001867 | Forest Soil | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGT |
| Ga0063454_1008295182 | 3300004081 | Soil | MKYLLQIRFNGADAAIGRLPAAERQRIVAEFEAILDTPGVLDGNQLQPAGTA |
| Ga0062387_1014497971 | 3300004091 | Bog Forest Soil | MKFLLQVRFNGAGAVISELPAEEQQKLTAEFEAIRRSPGVLDGNQLQAAGTA |
| Ga0066683_104266131 | 3300005172 | Soil | MKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQSAGVLDSNQL |
| Ga0066388_1083332432 | 3300005332 | Tropical Forest Soil | MKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLAAAG |
| Ga0068868_1004976751 | 3300005338 | Miscanthus Rhizosphere | MLQVRFNGADEMIHMLPADEQEKVTAEFIAIRESSDVLDGNQL |
| Ga0070673_1018702582 | 3300005364 | Switchgrass Rhizosphere | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQA |
| Ga0070703_106090331 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGAAVTVRVSDGQA |
| Ga0070714_1002648521 | 3300005435 | Agricultural Soil | MKYMLQVRFNGADAVIGGLPPDEQEKVTAEFEAIRRSPGVLDGNQLQAAN |
| Ga0070714_1024604821 | 3300005435 | Agricultural Soil | MKFLLQVRFNGADKVIGTLPAEKQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATV |
| Ga0070710_102704502 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYMLQVRFNGADAEIAKLPAAEQEKVTAEFEAVRRSPGVLDG |
| Ga0070710_106208981 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRQSPGVLDGNQL |
| Ga0066681_109944081 | 3300005451 | Soil | MKFLLQVRFNGADKVIGTLAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATVR |
| Ga0070707_1017190811 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLLQIRFNGADTMIGELPAGEQHKVTAEFEAIRQSPGV |
| Ga0070679_1002006041 | 3300005530 | Corn Rhizosphere | VKYMLQVRFNGADAVIRRLPADEQERLTAEFIAIRKSSGVLDGNQLEAPSSAST |
| Ga0070665_1002098434 | 3300005548 | Switchgrass Rhizosphere | MKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIR |
| Ga0068855_1005450392 | 3300005563 | Corn Rhizosphere | MKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQAA |
| Ga0070664_1009633332 | 3300005564 | Corn Rhizosphere | MKYLLQVRFNGADAVIGTLPAGEQEKITAEFITIRRAPGVLDGNQ |
| Ga0068856_1004003303 | 3300005614 | Corn Rhizosphere | VKYMLQVRFNGADAIIGRLPADEQERLTAEFIAIRKSSGVLDGNQLEAPSSASTV |
| Ga0066905_1012749861 | 3300005713 | Tropical Forest Soil | MRYMIQVRFNGADAAIHLLPADEQAKITAEFQAIR |
| Ga0070715_101345052 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQA |
| Ga0070712_1010142941 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSPGVLDGNQLQAA |
| Ga0079222_125429132 | 3300006755 | Agricultural Soil | MKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIRTSPGVL |
| Ga0079221_107443522 | 3300006804 | Agricultural Soil | MKYLLQIRFNGADAVIRTLPPREQEKITAEFIAIRTSPGVLDGN |
| Ga0075425_1001677313 | 3300006854 | Populus Rhizosphere | MKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIRTSPGVLDGNQLQAAS |
| Ga0079219_105171102 | 3300006954 | Agricultural Soil | MKYMLQVRFNGADALIGRLAAEEQQKVTAEFQAIRQFPGVLDGNQLAAAGTAA |
| Ga0105240_125895093 | 3300009093 | Corn Rhizosphere | MRFLLQIRFNGADTMIGELPAEEQHKVTAEFEAIRQSPGVLDGNQLQAAS |
| Ga0105248_119318292 | 3300009177 | Switchgrass Rhizosphere | MKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIR |
| Ga0116217_108241002 | 3300009700 | Peatlands Soil | MKFLLQVRFNGADKVIGALPAEDQEKVTAEFEAIRRSPGVLDGNQLQAASEAATVRV |
| Ga0123355_118793741 | 3300009826 | Termite Gut | MLQVRFNGADALIGGLPAAEREKVTAEFEAIRRTAGVLDGNQ |
| Ga0126373_106595092 | 3300010048 | Tropical Forest Soil | MKYMLQVRFNGADAVIHSLPAGEQEKITAEFVAVRKSSGVLDGNQLDAAGSAKTV |
| Ga0126373_126039781 | 3300010048 | Tropical Forest Soil | MKYMLQVRFNGADVIGRLPVQEREQVTTEFEEIGRSPGVLDGNQLQA |
| Ga0126370_105183932 | 3300010358 | Tropical Forest Soil | MLQVRFDGANAVIHKLPADEQEKVTAEFIAIRKSSGVLDGNQLQAA |
| Ga0126372_101039971 | 3300010360 | Tropical Forest Soil | MKYLLQVRFNGADAVIGKLPAGEQEKITAEFIEIRRSPGVLDGNQ |
| Ga0126372_122605742 | 3300010360 | Tropical Forest Soil | MKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLA |
| Ga0126378_110458921 | 3300010361 | Tropical Forest Soil | MKYMLQVRFNGADAVIHKLPADEQEKVTAEFIAIRKS |
| Ga0126379_112098021 | 3300010366 | Tropical Forest Soil | MKYMLQVRFNGADALIGRLPAEEQQKVTAEFQAIRAFPGVLDGNQLAAAGTAAT |
| Ga0126381_1013921931 | 3300010376 | Tropical Forest Soil | MKYMLQVRFNGAGALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLAAA |
| Ga0134126_103763281 | 3300010396 | Terrestrial Soil | MLQVRFNGADKAIGELPAGDQEKVTAEFKEVRRSAGVLDGNQL |
| Ga0134126_127456111 | 3300010396 | Terrestrial Soil | MQGDRVKYMLQVRFNGADAVIGGLPAAEQEKVTAEFEAIRRSAGVLDGNQLQAAA |
| Ga0137364_105410731 | 3300012198 | Vadose Zone Soil | MKFLLQVRFNGADTMISELPAEEQHKVTAEFEAIRQSP |
| Ga0137378_103956621 | 3300012210 | Vadose Zone Soil | MKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSSGVLDGNQLQAASTA |
| Ga0137384_103717533 | 3300012357 | Vadose Zone Soil | MKFLLQVRFNGAGNVIGDLPAEEQQKVTAEFEAIRQSSGVLDGNQLQAAGTAVTVRVEG |
| Ga0137360_118310341 | 3300012361 | Vadose Zone Soil | MKFLLQVRFNGAGNVIGELPSEEQQKVTAEFEAIRQSSGVLDGNQ |
| Ga0137407_119655302 | 3300012930 | Vadose Zone Soil | MKFLLQVRFNGADNVIGELPAEEQQKVTAEFEEIRQSSGVL |
| Ga0126369_105523621 | 3300012971 | Tropical Forest Soil | MKYMLQVRFNGADTVMGRLSAEEQQNVRAEFEAVRQSSGVLDGNQLQATTQVELVEIG* |
| Ga0126369_114422382 | 3300012971 | Tropical Forest Soil | MLQIRFNGADAVIHKLPADEQEKVTAEFIAIRKSSGVLDG |
| Ga0157379_114965532 | 3300014968 | Switchgrass Rhizosphere | MKFMLQVRFNGADKAIGELSAGDQQKVTAEFEEIRRSPGVLDGNQLQAAGTAATVRVDGRQP |
| Ga0182041_103064271 | 3300016294 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQLQAAGTAATVR |
| Ga0182033_116697721 | 3300016319 | Soil | VKYMLQVRFNGADAVIAKLPAGEQEKVTAEFIAIRK |
| Ga0182032_115098311 | 3300016357 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQLQAASGAATVRVH |
| Ga0182039_107549782 | 3300016422 | Soil | MKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGNQLQAAGTAATVRLD |
| Ga0182038_108945961 | 3300016445 | Soil | MTYLLQVRFNGADEVIHKLSADEQEKITAEFVAIRKSSGVLDGNQLEAAST |
| Ga0182038_121553731 | 3300016445 | Soil | MKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQS |
| Ga0187820_12458631 | 3300017924 | Freshwater Sediment | VKYMLQVRFNGADAAIGRLPADEQEKITAEFEAIRRYPG |
| Ga0187809_101202752 | 3300017937 | Freshwater Sediment | VKYMLQVRFNGADEVIRKLPADEQEKVTADFIAIRESSGVLDGNQL |
| Ga0187879_107034811 | 3300017946 | Peatland | MEFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRRSPGVLDGYQLQAASTA |
| Ga0187847_108851692 | 3300017948 | Peatland | MEFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIR |
| Ga0210389_104057541 | 3300021404 | Soil | MKFLLQVRFNGADKVIGTLPAEEQKRVTGEFEAIRRSPGVLDGNQLQAAGTAA |
| Ga0210383_105845222 | 3300021407 | Soil | MKFLLQVRFNGADKVIGALPAEEQKKVTGEFEAIRETSGVLDGNQLQAASE |
| Ga0210410_110592461 | 3300021479 | Soil | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATVRVD |
| Ga0126371_135918151 | 3300021560 | Tropical Forest Soil | VKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSSGVLDGNQLQAASTAAT |
| Ga0247692_10774132 | 3300024279 | Soil | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQ |
| Ga0207692_110298091 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMLQIRFNGADKAIGGLPAAEQEKVTAEFEAIRRSPGVLDGNQLQAVGTASTVRV |
| Ga0207693_107997223 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLLQVRFDGADKVIGTLPAEEQKRVTGEFEAIRRSPGVLDGNQLQAAG |
| Ga0207693_109131161 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSPGVLDGNQLQAASTAATV |
| Ga0207694_115238441 | 3300025924 | Corn Rhizosphere | MKYMLQVRFNGADTVIGRLSAGEQQNVRAEFEAIRQSPGVLDGNKLQAASTAAT |
| Ga0207659_114967751 | 3300025926 | Miscanthus Rhizosphere | VKYMLQVRFNGADEMIHMLPADEQEKVTAEFIAIRESSDVLDGNQLQAA |
| Ga0207664_109637371 | 3300025929 | Agricultural Soil | MKFLLQVRFNGAGTVIGALPAEEQKKVTGEFEAIRRSPGVLDG |
| Ga0207703_113062362 | 3300026035 | Switchgrass Rhizosphere | MKFMLQVRFNGADKAIGELSAGDQQKVTAEFEEIRRSPGVLDGNQLQAAGTAATVR |
| Ga0207641_119580251 | 3300026088 | Switchgrass Rhizosphere | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLD |
| Ga0209177_101295653 | 3300027775 | Agricultural Soil | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAG |
| Ga0209074_101310881 | 3300027787 | Agricultural Soil | VKYLLQVRFNGAEAVIHELPADEQEKVTAEFIAIRKSPGVLDGNQLEAPG |
| Ga0209590_100045148 | 3300027882 | Vadose Zone Soil | MKYMLQVRFNGADAAIGRLPADEQQKVTAEFEAIRRSPGVLDGNQL |
| Ga0268266_101574721 | 3300028379 | Switchgrass Rhizosphere | MKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQAAGAAVTVRVS |
| Ga0268266_102226453 | 3300028379 | Switchgrass Rhizosphere | VKYMLQVRFNGADAIIDRLPADEQERLTAEFIAIRKSSGVLDGN |
| Ga0265338_100609824 | 3300028800 | Rhizosphere | MKFLLQVRFNGADKVIGALPAADQQKVTDEFIAVRQSPGVLDGNQLQAASE |
| Ga0318516_107719792 | 3300031543 | Soil | MKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDG |
| Ga0318538_106242742 | 3300031546 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIR |
| Ga0318571_102623522 | 3300031549 | Soil | MKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQSS |
| Ga0310915_105863501 | 3300031573 | Soil | MKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGNQLQAA |
| Ga0318555_102129521 | 3300031640 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQ |
| Ga0318542_102491572 | 3300031668 | Soil | MKYMLQVRFNGADTLIGTLPAEEQQKVTAEFQVIRQFPG |
| Ga0318560_100218165 | 3300031682 | Soil | VKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAA |
| Ga0306917_104068852 | 3300031719 | Soil | MKYMLQVRFNGADALIGTLPAEEQQKVTAEFQVIRQFPGVLDGNQLAAAGTA |
| Ga0306917_107476012 | 3300031719 | Soil | MKYMLQVRFNGAGALIGRLPAAEQQKVTAEFQAIRHSPGVLDGNQL |
| Ga0306917_108626171 | 3300031719 | Soil | VKYMLQVRFNGVDEVIHKLPADDQEKVTAEFIAIRESSGVLDGNQ |
| Ga0318502_103207102 | 3300031747 | Soil | VKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLD |
| Ga0318521_102706001 | 3300031770 | Soil | VKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAATVRVHGG |
| Ga0318498_101716301 | 3300031778 | Soil | MTYLLQVRFNGADEVIHKLPADEQEKVTAEFVAIRKSSGVLDGNQLEAASA |
| Ga0318566_105022171 | 3300031779 | Soil | MKYMLQVRFNGADALIGTLPAEEQQKVTAEFQVIRQFPGVLDGNQLAAAGTAATVRV |
| Ga0318552_104926431 | 3300031782 | Soil | MKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRW |
| Ga0318568_105723762 | 3300031819 | Soil | MKYMLQVRFNGADIVIGRLSAREQQDVRAEFEAIRQSSGVLDGSQLQAASTA |
| Ga0318564_101038611 | 3300031831 | Soil | MKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGN |
| Ga0318551_100451781 | 3300031896 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQ |
| Ga0306921_110230702 | 3300031912 | Soil | MKYMLQVRFNGAGALIGRLPAAEQQTVTAEFQAIRHSPGVLDGNQ |
| Ga0310913_110126101 | 3300031945 | Soil | VKYMLQVRFNGVDEVIHKLPADEQEKVTAEFIAIRKSSGVLDGSQLQAA |
| Ga0318531_100537363 | 3300031981 | Soil | VKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRK |
| Ga0318556_106473162 | 3300032043 | Soil | MKYMLQVRFNGADALIGTLPADEQQKLTAEFQAIRQFPGVLDGNQLAAADTAATV |
| Ga0318506_100283561 | 3300032052 | Soil | VKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAATVRE |
| Ga0318506_101599682 | 3300032052 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGN |
| Ga0318505_101984661 | 3300032060 | Soil | VKYMLQVRFNGADAAIGRLPADEQEKITAEFEAIRRSPGVLDGNQLQAAS |
| Ga0318513_103046151 | 3300032065 | Soil | MKFLLQVRFNGAGHVIGELPVGEQQKVTAEFEAIRQSPGVLDGNQLQAA |
| Ga0308173_118652802 | 3300032074 | Soil | VKFLLQVRFNGADTVIGELPAEERQKVTGEFIAIRSSVGVLGGN |
| Ga0306920_1021846561 | 3300032261 | Soil | MKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDANQLQAAGTAATVCM |
| Ga0335070_112941281 | 3300032829 | Soil | MKYMLQVRFNGADIVIGRLSAREQQHVRAEFEAIRQSSGVLDGSQLQVA |
| Ga0335074_106439671 | 3300032895 | Soil | MKYMLQVRFNGADAAIGRLPADEQAKITGEFEAIRRSPGVLDGN |
| Ga0335083_111344671 | 3300032954 | Soil | MKFLLQVRFNGAGAVIGALPAGEQQKVTAEFEAIRQSPGVLDDNQLQAA |
| Ga0335076_100695721 | 3300032955 | Soil | MKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQ |
| Ga0335076_103049331 | 3300032955 | Soil | VKYMLQVRFNGADEVIRKLPAGEREKVTAEFIAIRESS |
| Ga0335076_109723021 | 3300032955 | Soil | VKYMLQVRFNGADAVIGGLPADEQEKITAEFEAIRQSP |
| Ga0335084_116472711 | 3300033004 | Soil | MKYVLQVRFNGADTVIGSLSAKEQQNVHAEFEAIRQSP |
| Ga0310914_111870712 | 3300033289 | Soil | MKFMLQVRFNGADTVISELPAEEQQKVTAEFEAIR |
| Ga0310914_113828012 | 3300033289 | Soil | MKYMLQVRFNGADIVIGRLSAREQQDVRAEFEAIRQSSGVL |
| ⦗Top⦘ |