Basic Information | |
---|---|
Family ID | F077861 |
Family Type | Metagenome |
Number of Sequences | 117 |
Average Sequence Length | 40 residues |
Representative Sequence | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 44.44 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 87.18 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.427 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.094 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.786 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.120 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF05221 | AdoHcyase | 2.56 |
PF07228 | SpoIIE | 1.71 |
PF02371 | Transposase_20 | 1.71 |
PF13714 | PEP_mutase | 1.71 |
PF04235 | DUF418 | 1.71 |
PF00670 | AdoHcyase_NAD | 1.71 |
PF02592 | Vut_1 | 0.85 |
PF07394 | DUF1501 | 0.85 |
PF00436 | SSB | 0.85 |
PF03965 | Penicillinase_R | 0.85 |
PF00691 | OmpA | 0.85 |
PF12704 | MacB_PCD | 0.85 |
PF02687 | FtsX | 0.85 |
PF03938 | OmpH | 0.85 |
PF16694 | Cytochrome_P460 | 0.85 |
PF07366 | SnoaL | 0.85 |
PF13407 | Peripla_BP_4 | 0.85 |
PF13302 | Acetyltransf_3 | 0.85 |
PF14659 | Phage_int_SAM_3 | 0.85 |
PF00903 | Glyoxalase | 0.85 |
PF13483 | Lactamase_B_3 | 0.85 |
PF13578 | Methyltransf_24 | 0.85 |
PF13376 | OmdA | 0.85 |
PF03551 | PadR | 0.85 |
PF01329 | Pterin_4a | 0.85 |
PF13564 | DoxX_2 | 0.85 |
PF03743 | TrbI | 0.85 |
PF00891 | Methyltransf_2 | 0.85 |
PF00106 | adh_short | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 4.27 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.71 |
COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 1.71 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.71 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.85 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.85 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.85 |
COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.85 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.43 % |
Unclassified | root | N/A | 49.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004633|Ga0066395_10083298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1503 | Open in IMG/M |
3300005187|Ga0066675_10940213 | Not Available | 652 | Open in IMG/M |
3300005332|Ga0066388_106697235 | Not Available | 580 | Open in IMG/M |
3300005434|Ga0070709_10361934 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300005446|Ga0066686_10115938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1741 | Open in IMG/M |
3300005446|Ga0066686_10279628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1131 | Open in IMG/M |
3300005530|Ga0070679_100424506 | Not Available | 1275 | Open in IMG/M |
3300005537|Ga0070730_10328248 | Not Available | 998 | Open in IMG/M |
3300005552|Ga0066701_10355452 | Not Available | 907 | Open in IMG/M |
3300005561|Ga0066699_10968830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 590 | Open in IMG/M |
3300005614|Ga0068856_100195123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
3300005616|Ga0068852_101167942 | Not Available | 791 | Open in IMG/M |
3300005764|Ga0066903_106339704 | Not Available | 617 | Open in IMG/M |
3300005841|Ga0068863_100793136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 944 | Open in IMG/M |
3300005921|Ga0070766_10960964 | Not Available | 586 | Open in IMG/M |
3300006163|Ga0070715_10227415 | Not Available | 963 | Open in IMG/M |
3300006800|Ga0066660_10476415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1047 | Open in IMG/M |
3300006854|Ga0075425_102445873 | Not Available | 579 | Open in IMG/M |
3300006954|Ga0079219_10326863 | Not Available | 968 | Open in IMG/M |
3300007788|Ga0099795_10070140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_56_11 | 1320 | Open in IMG/M |
3300007788|Ga0099795_10108571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
3300009520|Ga0116214_1144313 | Not Available | 885 | Open in IMG/M |
3300009792|Ga0126374_11789199 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010043|Ga0126380_11878720 | Not Available | 544 | Open in IMG/M |
3300010046|Ga0126384_10764941 | Not Available | 862 | Open in IMG/M |
3300010048|Ga0126373_12733254 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010048|Ga0126373_13022426 | Not Available | 524 | Open in IMG/M |
3300010159|Ga0099796_10138842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
3300010343|Ga0074044_10594420 | Not Available | 722 | Open in IMG/M |
3300010359|Ga0126376_12119636 | Not Available | 606 | Open in IMG/M |
3300010360|Ga0126372_13006479 | Not Available | 523 | Open in IMG/M |
3300010361|Ga0126378_13048096 | Not Available | 534 | Open in IMG/M |
3300010366|Ga0126379_11066695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 913 | Open in IMG/M |
3300010371|Ga0134125_10242174 | Not Available | 2005 | Open in IMG/M |
3300010373|Ga0134128_11763538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 681 | Open in IMG/M |
3300010375|Ga0105239_10457603 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300010376|Ga0126381_100302681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2190 | Open in IMG/M |
3300010376|Ga0126381_103910608 | Not Available | 581 | Open in IMG/M |
3300010397|Ga0134124_10498559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
3300010399|Ga0134127_13567557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 510 | Open in IMG/M |
3300012205|Ga0137362_11747904 | Not Available | 509 | Open in IMG/M |
3300012357|Ga0137384_10343420 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300012363|Ga0137390_10646392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300012923|Ga0137359_10487586 | Not Available | 1088 | Open in IMG/M |
3300012923|Ga0137359_10941639 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012929|Ga0137404_11718826 | Not Available | 583 | Open in IMG/M |
3300012960|Ga0164301_10626437 | Not Available | 798 | Open in IMG/M |
3300012971|Ga0126369_12801894 | Not Available | 571 | Open in IMG/M |
3300013105|Ga0157369_10302497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1663 | Open in IMG/M |
3300015356|Ga0134073_10349316 | Not Available | 543 | Open in IMG/M |
3300016319|Ga0182033_10104759 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
3300016341|Ga0182035_10209495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1547 | Open in IMG/M |
3300016445|Ga0182038_11730607 | Not Available | 564 | Open in IMG/M |
3300017927|Ga0187824_10175384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → Pyxidicoccus caerfyrddinensis | 720 | Open in IMG/M |
3300017943|Ga0187819_10490054 | Not Available | 701 | Open in IMG/M |
3300018044|Ga0187890_10671028 | Not Available | 585 | Open in IMG/M |
3300018057|Ga0187858_10436074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300018086|Ga0187769_11294661 | Not Available | 551 | Open in IMG/M |
3300018088|Ga0187771_11849643 | Not Available | 513 | Open in IMG/M |
3300018090|Ga0187770_11640689 | Not Available | 525 | Open in IMG/M |
3300020582|Ga0210395_10509384 | Not Available | 905 | Open in IMG/M |
3300021046|Ga0215015_10391791 | Not Available | 591 | Open in IMG/M |
3300021168|Ga0210406_10040212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4155 | Open in IMG/M |
3300021168|Ga0210406_11253579 | Not Available | 536 | Open in IMG/M |
3300021403|Ga0210397_11362298 | Not Available | 551 | Open in IMG/M |
3300021420|Ga0210394_10024921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5455 | Open in IMG/M |
3300021433|Ga0210391_10010100 | All Organisms → cellular organisms → Bacteria | 7663 | Open in IMG/M |
3300021433|Ga0210391_10918770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
3300021479|Ga0210410_10014950 | All Organisms → cellular organisms → Bacteria | 6692 | Open in IMG/M |
3300021560|Ga0126371_10220885 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
3300022557|Ga0212123_10498948 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300025463|Ga0208193_1033532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1240 | Open in IMG/M |
3300025928|Ga0207700_10351875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
3300025928|Ga0207700_10395208 | Not Available | 1211 | Open in IMG/M |
3300026845|Ga0207760_104859 | Not Available | 1165 | Open in IMG/M |
3300027371|Ga0209418_1038471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300027641|Ga0208827_1199820 | Not Available | 532 | Open in IMG/M |
3300028746|Ga0302233_10104454 | Not Available | 1115 | Open in IMG/M |
3300028746|Ga0302233_10305901 | Not Available | 601 | Open in IMG/M |
3300028759|Ga0302224_10383270 | Not Available | 570 | Open in IMG/M |
3300028877|Ga0302235_10414697 | Not Available | 576 | Open in IMG/M |
3300028906|Ga0308309_11248395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
3300029910|Ga0311369_10144900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2300 | Open in IMG/M |
3300029910|Ga0311369_10902429 | Not Available | 705 | Open in IMG/M |
3300029918|Ga0302143_1140528 | Not Available | 577 | Open in IMG/M |
3300029943|Ga0311340_11451111 | Not Available | 539 | Open in IMG/M |
3300029944|Ga0311352_10105395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2479 | Open in IMG/M |
3300030043|Ga0302306_10383346 | Not Available | 537 | Open in IMG/M |
3300030399|Ga0311353_10920946 | Not Available | 737 | Open in IMG/M |
3300030580|Ga0311355_11043138 | Not Available | 732 | Open in IMG/M |
3300030739|Ga0302311_10226947 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300031057|Ga0170834_112582898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 512 | Open in IMG/M |
3300031234|Ga0302325_10151893 | All Organisms → cellular organisms → Bacteria | 4139 | Open in IMG/M |
3300031236|Ga0302324_102178257 | Not Available | 688 | Open in IMG/M |
3300031236|Ga0302324_102693398 | Not Available | 601 | Open in IMG/M |
3300031524|Ga0302320_11084037 | Not Available | 837 | Open in IMG/M |
3300031640|Ga0318555_10608605 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300031682|Ga0318560_10307519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
3300031708|Ga0310686_101529484 | All Organisms → cellular organisms → Bacteria | 7945 | Open in IMG/M |
3300031718|Ga0307474_10079954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2431 | Open in IMG/M |
3300031718|Ga0307474_10089576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2295 | Open in IMG/M |
3300031768|Ga0318509_10028705 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
3300031768|Ga0318509_10404915 | Not Available | 763 | Open in IMG/M |
3300031777|Ga0318543_10104128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
3300031782|Ga0318552_10273638 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300031792|Ga0318529_10083334 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300031880|Ga0318544_10343341 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031896|Ga0318551_10902280 | Not Available | 516 | Open in IMG/M |
3300031942|Ga0310916_10964988 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300031946|Ga0310910_10401142 | Not Available | 1086 | Open in IMG/M |
3300031954|Ga0306926_12234905 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031954|Ga0306926_13023706 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300032055|Ga0318575_10550503 | Not Available | 585 | Open in IMG/M |
3300032076|Ga0306924_10761812 | Not Available | 1082 | Open in IMG/M |
3300032160|Ga0311301_12425720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300032261|Ga0306920_103135551 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300032261|Ga0306920_104239672 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.09% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.11% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066395_100832981 | 3300004633 | Tropical Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMQLLADLVERCQHR |
Ga0066675_109402131 | 3300005187 | Soil | MLALPMTLNTTAETEAARIARGLRERDMELLADLVERYQHRLV |
Ga0066388_1066972351 | 3300005332 | Tropical Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLV |
Ga0070709_103619341 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRYL |
Ga0066686_101159382 | 3300005446 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0066686_102796282 | 3300005446 | Soil | MSAFPMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0070679_1004245062 | 3300005530 | Corn Rhizosphere | MSALPMTLNTTAETETARIARGLREKDMQLVADLVERCQHR |
Ga0070730_103282483 | 3300005537 | Surface Soil | MTLNTTAETETAKIARGLRERDMELLADLVERCQH |
Ga0066701_103554522 | 3300005552 | Soil | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0066699_109688301 | 3300005561 | Soil | MLALPMTLNTTAETETARIARGLRERDMELLADLVERCQHR |
Ga0068856_1001951234 | 3300005614 | Corn Rhizosphere | MTLNTTAESETAKIARGLGEKDMELLSDLVERCQQRLVRYLL |
Ga0068852_1011679423 | 3300005616 | Corn Rhizosphere | MSALPMTLNMTAETETAKIARGLRERDMELLADLVE |
Ga0066903_1063397041 | 3300005764 | Tropical Forest Soil | MTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLV |
Ga0068863_1007931362 | 3300005841 | Switchgrass Rhizosphere | MSALPMTLNITAESETAKIARGLRESDTELLADLVERSQRRLV |
Ga0070766_109609641 | 3300005921 | Soil | MSALAMTLNTTAETETAKIARGLRERDMELLADLV |
Ga0070715_102274151 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLNTTAETETAKIARGLRVRDMELLADLVERCQHRLVRYLLY |
Ga0066660_104764153 | 3300006800 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERYQH |
Ga0075425_1024458731 | 3300006854 | Populus Rhizosphere | MTLNITAETETAKIPRGLRESDTELLADLVERCQH |
Ga0079219_103268632 | 3300006954 | Agricultural Soil | MTLNTTAEAETAKIARGLREKDMELLADLVERYQH |
Ga0099795_100701401 | 3300007788 | Vadose Zone Soil | MLALPMTLNTTAETETAKIARGLRERDMELLADLVERYQHRL |
Ga0099795_101085711 | 3300007788 | Vadose Zone Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERYQHRL |
Ga0116214_11443132 | 3300009520 | Peatlands Soil | MLALPMTLNTTAETETAKIARGLRERVSELFADLLERIRNRRVGYR |
Ga0126374_117891991 | 3300009792 | Tropical Forest Soil | MWALPMTLNTTVETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0126380_118787201 | 3300010043 | Tropical Forest Soil | MTLNMTAETETAKIARGLRERDMQLLADLVERCQHRLVRY |
Ga0126384_107649411 | 3300010046 | Tropical Forest Soil | MLALPITLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRYL |
Ga0126373_127332541 | 3300010048 | Tropical Forest Soil | MSALPMTWNTTAETETAKIARGLRERDMQLLADLVERCQHRLVRYLLY |
Ga0126373_130224261 | 3300010048 | Tropical Forest Soil | MLALPMTLNTTAETETAKIARGLRERDMELLADLVER |
Ga0099796_101388423 | 3300010159 | Vadose Zone Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERSQRR |
Ga0074044_105944202 | 3300010343 | Bog Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVR |
Ga0126376_121196361 | 3300010359 | Tropical Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMQLLADLVERCQHRL |
Ga0126372_130064791 | 3300010360 | Tropical Forest Soil | MFGLPMTLNTTAETETAKIARGLRERDMELLAGLVERYQHRL |
Ga0126378_130480962 | 3300010361 | Tropical Forest Soil | MTFNTTAETETAKIARGLRERDMQLVADLVERCQHRLVRY |
Ga0126379_110666951 | 3300010366 | Tropical Forest Soil | MLALPITLNTTAEVETAKIARGLRERDMDLLADLVERY |
Ga0134125_102421742 | 3300010371 | Terrestrial Soil | MTLNITAETETAKIARGLRESDTELLADLVERCQHRLVRYLLYLIG |
Ga0134128_117635383 | 3300010373 | Terrestrial Soil | MLALPMSLHTAAETETAKIARGLRERDTALLADLVERYQQRLVR |
Ga0105239_104576031 | 3300010375 | Corn Rhizosphere | MTLNTTAEIETAKIARGLRDGDMELLADLVERSHRRLVR |
Ga0126381_1003026811 | 3300010376 | Tropical Forest Soil | MSALPMTLNTTAETETETAKIARGLRERDMQLLADLVERCQHRLVRY |
Ga0126381_1039106081 | 3300010376 | Tropical Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMQLLADLVERY |
Ga0134124_104985591 | 3300010397 | Terrestrial Soil | MTLNTTAETETAKIARGLREKDMELLADLVERSQRRLV |
Ga0134127_135675572 | 3300010399 | Terrestrial Soil | MLALPMSLNTAAETESAKIARGLRERDTALLADLVERY |
Ga0137362_117479041 | 3300012205 | Vadose Zone Soil | MTLNTTAETETAKIARGLRERDMELLADLVERSQRRLVRYLLYL |
Ga0137384_103434202 | 3300012357 | Vadose Zone Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQH |
Ga0137390_106463922 | 3300012363 | Vadose Zone Soil | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRYLL |
Ga0137359_104875861 | 3300012923 | Vadose Zone Soil | MTLNTTAETEAAKIARGLRERDMELFADLVGRCQHR |
Ga0137359_109416392 | 3300012923 | Vadose Zone Soil | MSALPMTLNTTAENETAKIARGLRERDVELLADLVERCHHRLVRYLL |
Ga0137404_117188261 | 3300012929 | Vadose Zone Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERYQHRLVR |
Ga0164301_106264372 | 3300012960 | Soil | MAALTITLNITAETETAKTARGLRESDTELLADLVERS |
Ga0126369_128018942 | 3300012971 | Tropical Forest Soil | MSALPMTLNTTAEAETAKIARGLRERDMQLLADLVERCQHR |
Ga0157369_103024972 | 3300013105 | Corn Rhizosphere | MTLNTTAEIETAKIARGLRERDPELLGELVEQCHRRLVRYLLYLTGRR |
Ga0134073_103493161 | 3300015356 | Grasslands Soil | MLALPMTLNTTAETETAKIARGLRERDTELLADLVERCQHRLV |
Ga0182033_101047592 | 3300016319 | Soil | MLALPMTVNTTAETETAKIARGLHERDMELLADLVE |
Ga0182035_102094952 | 3300016341 | Soil | MLALPMTVNTTAETETAKIARGLHERDMELLADLV |
Ga0182038_117306071 | 3300016445 | Soil | MSALPMTLNTMAETETAKIARGLRERDMQLLADLVERCQHR |
Ga0187824_101753841 | 3300017927 | Freshwater Sediment | MTLNTRAETETGKIARGLRERDTELLADLVGRFQHRLLRYLL |
Ga0187819_104900542 | 3300017943 | Freshwater Sediment | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRL |
Ga0187890_106710281 | 3300018044 | Peatland | MTLNMTAETETAKIARGLRERDMELLADLVERCQHRLVR |
Ga0187858_104360742 | 3300018057 | Peatland | MTLNTTAETETAKIARGLREKDMELLADLVERCQHR |
Ga0187769_112946611 | 3300018086 | Tropical Peatland | MSALPMTLNTPAETETAKIARGLRERDRELLADLVERFQHRLVR |
Ga0187771_118496431 | 3300018088 | Tropical Peatland | MSALPMTLNTPAETETAKIARGLRERDMELLADLVERCQ |
Ga0187770_116406891 | 3300018090 | Tropical Peatland | MTWNTTAETETAKIARGLRERDMELLADLVERCQRRLVR |
Ga0210395_105093841 | 3300020582 | Soil | MLALPMTLNTTAETETETAKIARGLRERDMELLADLVERCQHRLVRYLLY |
Ga0215015_103917912 | 3300021046 | Soil | MSALPMTLNTTAETETAKIARGLRERDMGLLADLVDRFQHRLVRGDVTLIV |
Ga0210406_100402121 | 3300021168 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRY |
Ga0210406_112535791 | 3300021168 | Soil | MTLNTTAETETAKIARGLRERDMQLVADLVERCHDRLVRYLL |
Ga0210397_113622981 | 3300021403 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLV |
Ga0210394_100249217 | 3300021420 | Soil | MSALHMTLNTIAETETAKIARGLRERDMELFADLVE |
Ga0210391_100101001 | 3300021433 | Soil | MLALHMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0210391_109187701 | 3300021433 | Soil | MTLNTAAETETAKIARGLRERDMELLADLVERCQHRLVRY |
Ga0210410_100149506 | 3300021479 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELFADLVGRCQHRLVRYLLYLT |
Ga0126371_102208853 | 3300021560 | Tropical Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLVR |
Ga0212123_104989481 | 3300022557 | Iron-Sulfur Acid Spring | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRYLLPHREAGVC |
Ga0208193_10335323 | 3300025463 | Peatland | MTLHTTAETETAKIARGLRERDMELLADLVERCQQTG |
Ga0207700_103518751 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLNMTAETETAKIARGLRERDMELLADLVERCQQR |
Ga0207700_103952081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALPMTLNTTAETETAKIARGLRERDLELLADLVER |
Ga0207760_1048592 | 3300026845 | Tropical Forest Soil | MSALAMTLNTTAETETAKIARGLRERDMQLLADLVE |
Ga0209418_10384711 | 3300027371 | Forest Soil | MLALPMTLNMTAEAETAKIARGLRERNRELLAELVDRFH |
Ga0208827_11998201 | 3300027641 | Peatlands Soil | MTLNTTAETETAKIARGLRERDMELLADLVERYQHRLVR |
Ga0302233_101044542 | 3300028746 | Palsa | MSALPMTLNTTAETETAKIARGLREKDMELLADLVERY |
Ga0302233_103059012 | 3300028746 | Palsa | MTLNTTAETETAKIARGLRERDMELLADLVERYQHR |
Ga0302224_103832701 | 3300028759 | Palsa | MTLITTAETETAKIARGFRERDMELLADLVKRYQHRLVRY |
Ga0302235_104146971 | 3300028877 | Palsa | MLAIHMTLNTTAETETAKIARGLRERDIELLTDLVQRCQ |
Ga0308309_112483952 | 3300028906 | Soil | MTLNTAAETETAKIARGLRERDMELLADLVERCQHRLVRYLL |
Ga0311369_101449003 | 3300029910 | Palsa | MTLTTTAETETAKIARGLRERDMELLADLVERCQHRLVRYLL |
Ga0311369_109024291 | 3300029910 | Palsa | MLALPMTLNTTAETETAKIARGLRERDIELLTDLVQRCQQ |
Ga0302143_11405282 | 3300029918 | Bog | MTLNTTAETETAKIARGLRERDIELLADLVERCQHRLVRYLLY |
Ga0311340_114511111 | 3300029943 | Palsa | MSALPMTLNMTAETETAKIARGLRERDRELLADLV |
Ga0311352_101053955 | 3300029944 | Palsa | MTLMTTAETETAKIARGLRERDIELLTELVDRYQHRLVRYVL |
Ga0302306_103833461 | 3300030043 | Palsa | MTLNTTAETETAKIARGLRERDMELLADLVQCCQQRLVRYLLYLTG |
Ga0311353_109209461 | 3300030399 | Palsa | MSALPMTLITTAETETAKIARGFRERDMELLADLVKRYQHRLVRY |
Ga0311355_110431382 | 3300030580 | Palsa | MTLNTTAETETAKIARGLRERDMQLLTELVDLFQHRLVRYL |
Ga0302311_102269471 | 3300030739 | Palsa | MTLNTTAESETAKIARGLRERDVELLADLVERSQHRLVRY |
Ga0170834_1125828981 | 3300031057 | Forest Soil | MTLNTTAETEAAKIARGLRERDMELLADLVERYQHRLV |
Ga0302325_101518934 | 3300031234 | Palsa | MTLNMTAETETAKIARGLRERDMELLADLVERCQHRLVRYL |
Ga0302324_1021782571 | 3300031236 | Palsa | MLALPMTLNTTAETETAKIARGLRERDIELLTDLVQR |
Ga0302324_1026933981 | 3300031236 | Palsa | MLALHMTLNTTAETETARIARGLRERDMELLADLVER |
Ga0302320_110840371 | 3300031524 | Bog | MSALPMTLITTAETEMAKIARGLRERDMELLADLVER |
Ga0318555_106086051 | 3300031640 | Soil | MTLNTMAETETAKIARGLRERDMQLLADLVERCQHRLVRYL |
Ga0318560_103075191 | 3300031682 | Soil | MTLNTTAESETAKIARGLRERDMELLADLVERCQHRLVR |
Ga0310686_1015294846 | 3300031708 | Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVER |
Ga0307474_100799541 | 3300031718 | Hardwood Forest Soil | MSALPMTLNTTAETETAKIARGLRERDMELLADLVERCQHR |
Ga0307474_100895761 | 3300031718 | Hardwood Forest Soil | MTLNTTAETETAKIARGLRERDMELLADLVERCQHR |
Ga0318509_100287051 | 3300031768 | Soil | MSVLPMTLNTMAETETAKIARGLRERDMQLLADLVERCQHRLVR |
Ga0318509_104049151 | 3300031768 | Soil | MTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLVRY |
Ga0318543_101041282 | 3300031777 | Soil | MSALPMTLNTTAESETAKIARGLRERDMELLADLV |
Ga0318552_102736381 | 3300031782 | Soil | MTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLVRYL |
Ga0318529_100833341 | 3300031792 | Soil | MTLNTMAETETAKIARGLRERDMQLLADLVERCQHRLVRYLL |
Ga0318544_103433411 | 3300031880 | Soil | MSALPMTFNTTAETETAKIARGLRERDMELLADLVERCQH |
Ga0318551_109022801 | 3300031896 | Soil | MTLNTTAETETAKIARGLRERDMQLLADLVERCQHRLVRYLL |
Ga0310916_109649881 | 3300031942 | Soil | MTLNTMAETETAKIARGLRERDMQLLADLVERCQHRLV |
Ga0310910_104011421 | 3300031946 | Soil | MSALPMTLNTMAETETAKIARGLRERDMQLLADLVERCQH |
Ga0306926_122349052 | 3300031954 | Soil | MSALAMTLNTTAETETAKIARGLRERDMELLADLVERCQH |
Ga0306926_130237061 | 3300031954 | Soil | MSALAMTLNTTAETETAKIARGLRERDMELLADLVERCQHRLV |
Ga0318575_105505031 | 3300032055 | Soil | MSALPMTLNTTAESETAKIARGLRERDMELLADLVERCQHRLV |
Ga0306924_107618121 | 3300032076 | Soil | MTWNTTAETETAKIARGLRERDMQLLADLVERCQHRLVRYLLYLI |
Ga0311301_124257201 | 3300032160 | Peatlands Soil | MTLNTTAETETAKIARGLRERNMELLADLVERCQHRLVRYLL |
Ga0306920_1031355511 | 3300032261 | Soil | MSALAMTLNTTAETETAKIARGLRERDMELLADLVER |
Ga0306920_1042396721 | 3300032261 | Soil | MTLNTTAETETAKIARGLRERDMELLADLVERCQHRLVRYLLY |
⦗Top⦘ |