Basic Information | |
---|---|
Family ID | F077855 |
Family Type | Metagenome |
Number of Sequences | 117 |
Average Sequence Length | 40 residues |
Representative Sequence | MSSASPNSTRISKRFAELRASGELGIVAYITAGDPS |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 13.68 % |
% of genes near scaffold ends (potentially truncated) | 98.29 % |
% of genes from short scaffolds (< 2000 bps) | 94.87 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.795 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.932 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.205 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.282 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.81% β-sheet: 0.00% Coil/Unstructured: 67.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00291 | PALP | 82.91 |
PF00697 | PRAI | 2.56 |
PF00218 | IGPS | 2.56 |
PF03972 | MmgE_PrpD | 0.85 |
PF13520 | AA_permease_2 | 0.85 |
PF01850 | PIN | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 2.56 |
COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 2.56 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.65 % |
Unclassified | root | N/A | 27.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS402HYR9S | Not Available | 517 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101217279 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300003219|JGI26341J46601_10185602 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300004479|Ga0062595_102684332 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300004635|Ga0062388_101249259 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005339|Ga0070660_100442907 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300005450|Ga0066682_10510230 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300005552|Ga0066701_10955515 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005575|Ga0066702_10443155 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300005586|Ga0066691_10601837 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005610|Ga0070763_10329698 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005950|Ga0066787_10008727 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
3300005993|Ga0080027_10268584 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005995|Ga0066790_10259125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 742 | Open in IMG/M |
3300005995|Ga0066790_10320764 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300006028|Ga0070717_11175798 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300006046|Ga0066652_101068766 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300006163|Ga0070715_10358278 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006172|Ga0075018_10617015 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300006175|Ga0070712_101547736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300006755|Ga0079222_10518131 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300006794|Ga0066658_10595389 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300006804|Ga0079221_11458585 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006806|Ga0079220_11496973 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006893|Ga0073928_10777588 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300009088|Ga0099830_10435259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
3300009088|Ga0099830_11488116 | Not Available | 564 | Open in IMG/M |
3300009088|Ga0099830_11809788 | Not Available | 510 | Open in IMG/M |
3300009089|Ga0099828_10563006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1027 | Open in IMG/M |
3300009162|Ga0075423_11330023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300010361|Ga0126378_12057555 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300010362|Ga0126377_13331264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300011269|Ga0137392_10271471 | Not Available | 1398 | Open in IMG/M |
3300012189|Ga0137388_11480162 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012202|Ga0137363_10208695 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
3300012285|Ga0137370_10841916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 568 | Open in IMG/M |
3300012361|Ga0137360_10887562 | Not Available | 768 | Open in IMG/M |
3300012362|Ga0137361_10735318 | Not Available | 900 | Open in IMG/M |
3300012362|Ga0137361_11935046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 506 | Open in IMG/M |
3300012363|Ga0137390_10382874 | Not Available | 1386 | Open in IMG/M |
3300012363|Ga0137390_10744722 | Not Available | 940 | Open in IMG/M |
3300012917|Ga0137395_10309972 | Not Available | 1119 | Open in IMG/M |
3300012918|Ga0137396_10651028 | Not Available | 778 | Open in IMG/M |
3300012923|Ga0137359_10058598 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
3300012924|Ga0137413_10151947 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300012924|Ga0137413_11550545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300012927|Ga0137416_11486585 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300012971|Ga0126369_13323297 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012986|Ga0164304_11890383 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300013503|Ga0120127_10038672 | Not Available | 920 | Open in IMG/M |
3300015067|Ga0167640_126643 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300015241|Ga0137418_10392431 | Not Available | 1134 | Open in IMG/M |
3300016270|Ga0182036_10463591 | Not Available | 998 | Open in IMG/M |
3300016341|Ga0182035_11814252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300016445|Ga0182038_12000656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300017961|Ga0187778_10328692 | Not Available | 993 | Open in IMG/M |
3300017993|Ga0187823_10328283 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300020006|Ga0193735_1024832 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
3300020170|Ga0179594_10146622 | Not Available | 871 | Open in IMG/M |
3300020583|Ga0210401_10687389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300021046|Ga0215015_11070355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300021086|Ga0179596_10468550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300021170|Ga0210400_11142226 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300021178|Ga0210408_10314469 | Not Available | 1249 | Open in IMG/M |
3300021178|Ga0210408_11116717 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300021178|Ga0210408_11243166 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021180|Ga0210396_11279584 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300021384|Ga0213876_10427412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 704 | Open in IMG/M |
3300021402|Ga0210385_11036032 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300021405|Ga0210387_10704838 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 894 | Open in IMG/M |
3300021406|Ga0210386_10707194 | Not Available | 868 | Open in IMG/M |
3300021432|Ga0210384_11172594 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300021475|Ga0210392_10580437 | Not Available | 830 | Open in IMG/M |
3300021475|Ga0210392_11109105 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300021559|Ga0210409_11062085 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300021559|Ga0210409_11257073 | Not Available | 616 | Open in IMG/M |
3300021559|Ga0210409_11430416 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300024330|Ga0137417_1359190 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300025494|Ga0207928_1089896 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300026217|Ga0209871_1107198 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300026294|Ga0209839_10266119 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300026325|Ga0209152_10040177 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300026328|Ga0209802_1083924 | Not Available | 1471 | Open in IMG/M |
3300026343|Ga0209159_1035307 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
3300026542|Ga0209805_1447878 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300026551|Ga0209648_10048660 | All Organisms → cellular organisms → Bacteria | 3640 | Open in IMG/M |
3300026551|Ga0209648_10448498 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300026557|Ga0179587_10387247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
3300026557|Ga0179587_10981813 | Not Available | 556 | Open in IMG/M |
3300027047|Ga0208730_1012412 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 926 | Open in IMG/M |
3300027535|Ga0209734_1103194 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300027643|Ga0209076_1065874 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300027768|Ga0209772_10211877 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027825|Ga0209039_10418885 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027846|Ga0209180_10577274 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300027869|Ga0209579_10088572 | Not Available | 1639 | Open in IMG/M |
3300027889|Ga0209380_10808667 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300028536|Ga0137415_11061503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 622 | Open in IMG/M |
3300028731|Ga0302301_1052180 | Not Available | 1113 | Open in IMG/M |
3300031234|Ga0302325_12990250 | Not Available | 547 | Open in IMG/M |
3300031720|Ga0307469_10854019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
3300031753|Ga0307477_10490827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300031777|Ga0318543_10125752 | Not Available | 1116 | Open in IMG/M |
3300031777|Ga0318543_10205216 | Not Available | 875 | Open in IMG/M |
3300031793|Ga0318548_10142782 | Not Available | 1165 | Open in IMG/M |
3300031794|Ga0318503_10085848 | Not Available | 991 | Open in IMG/M |
3300031795|Ga0318557_10443337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300031797|Ga0318550_10648514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300031946|Ga0310910_10220698 | Not Available | 1475 | Open in IMG/M |
3300031959|Ga0318530_10229161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300031962|Ga0307479_10018196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6617 | Open in IMG/M |
3300032180|Ga0307471_101951092 | Not Available | 735 | Open in IMG/M |
3300032180|Ga0307471_104041819 | Not Available | 518 | Open in IMG/M |
3300032205|Ga0307472_102397885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300033158|Ga0335077_10112083 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
3300033158|Ga0335077_11156574 | Not Available | 761 | Open in IMG/M |
3300033289|Ga0310914_10107851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2406 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.13% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_05756510 | 2189573004 | Grass Soil | MTIAPQHSTRISKRFAQLRDAGELGIVAYITAGDP |
JGIcombinedJ26739_1012172791 | 3300002245 | Forest Soil | MPTSIANSTRIAKRFAELRASGELGIIAYVTAGDPSLDATLGFVLA |
JGI26341J46601_101856022 | 3300003219 | Bog Forest Soil | MTSVSQNSSRISQRFAELCASAEVGIIAYITAGDPTLDAT |
Ga0062595_1026843322 | 3300004479 | Soil | MSDWNHNRTRISRRFAELRESGELGIVAYIVAGDPSLEASLRYVL |
Ga0062388_1012492591 | 3300004635 | Bog Forest Soil | MTPSPTNSTRISRRFVRLRDSGELGIVAYITAGDPSLDATLQYVLA |
Ga0070660_1004429072 | 3300005339 | Corn Rhizosphere | MTITSNSKPGRISRRFAKLRERGELGIVAYITAGDPSLDATLRYV |
Ga0066682_105102302 | 3300005450 | Soil | LVGIETRIRSAFEALRSCGELGMVAYITAGDPSVEATLKFVLALA |
Ga0066701_109555151 | 3300005552 | Soil | MSARPSKLTRISRRFAELRAHGELGIVAYVTAGDPSLDATRTF |
Ga0066702_104431552 | 3300005575 | Soil | MLAASPTSTRISKRFADLRVSSELGIIAYITAGDPSLDAT |
Ga0066691_106018371 | 3300005586 | Soil | MIAVASNSTRISKRFAELRASGEVGVVAYIVAGDPSLDASLK |
Ga0070763_103296982 | 3300005610 | Soil | MPLATSNSTRISRRFATLRESGELGIVAYITAGDPSLAATLKF |
Ga0066787_100087273 | 3300005950 | Soil | MSNAPQTRISRCFAALRETGELGILAYITAGDPSMDATLE |
Ga0080027_102685842 | 3300005993 | Prmafrost Soil | MTASNPNPTRISQRFVELRASGELGIIAYITAGDP |
Ga0066790_102591251 | 3300005995 | Soil | MTMSNAPQTRISRCFAALRETGELGILAYITAGDPSMDATLEF |
Ga0066790_103207641 | 3300005995 | Soil | MNAALPNSTRISRRFAALRASGELGIVAYITAGDPSLDATLQ |
Ga0070717_111757981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVNAMTSPSTQTRIPKRFANLRASGELGIVAYITAGDPSLDATLKFV |
Ga0066652_1010687663 | 3300006046 | Soil | MMVRPPHSTRISKRFAELRASGELGIVAYIVAGDPSL |
Ga0070715_103582782 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTAPTHSTRISKRFAELRDAGELGIVAYITAGDP |
Ga0075018_106170151 | 3300006172 | Watersheds | MTIAPQHSTRISKRFAELRDAGELGIVAYITAGDPTLDA |
Ga0070712_1015477362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMMAANANPTRIARRFAELRERGELGIVAYITAGDPS |
Ga0079222_105181312 | 3300006755 | Agricultural Soil | MPVVSANSTRISQRFAALRESGELGIVAYITAGDPSLD |
Ga0066658_105953892 | 3300006794 | Soil | MIAVASNSTRISKRFAELRASGELGVIAYIVAGDPALDASLKYVL |
Ga0079221_114585852 | 3300006804 | Agricultural Soil | LKTRIHEQFSVLRKSGELGIVAYITAGDPSLDATLKFV |
Ga0079220_114969731 | 3300006806 | Agricultural Soil | MSAAPANSTRISKRFANLRESGELGIVAYITAGDPSLDATLKFVL |
Ga0073928_107775881 | 3300006893 | Iron-Sulfur Acid Spring | MTAAPQNSTRISKRFAELQAAAELGIIAYITAGDP |
Ga0099830_104352591 | 3300009088 | Vadose Zone Soil | MAPLNVEQTRISKRFAELRIEGELGIVAYITAGDPSFDATLKF |
Ga0099830_114881162 | 3300009088 | Vadose Zone Soil | MSSALPNSTRISERFAGLRASGELGIVAYLTAGDPSFDATLKYVLTLA* |
Ga0099830_118097883 | 3300009088 | Vadose Zone Soil | MVPATANPTRISRCFAELRASGELGLVAYITAGDPTLDAT |
Ga0099828_105630063 | 3300009089 | Vadose Zone Soil | MVAELTTNTRISLRFAELRTSGELGIVAYITAGDP |
Ga0075423_113300231 | 3300009162 | Populus Rhizosphere | MTITSNSKPGRISRRFAKLRERGELGIVAYITAGDPSLGATLR |
Ga0126378_120575551 | 3300010361 | Tropical Forest Soil | MSAAPAKPTRISKRFAELRASGELGIVAYITAGDPSLDATLKF |
Ga0126377_133312642 | 3300010362 | Tropical Forest Soil | LKTRIHERFRALQEAGELSIIAYITASDPSLDATLKFVLALA |
Ga0137392_102714712 | 3300011269 | Vadose Zone Soil | MPTTLSNATRISKRFADLRARGELGIVAYITAGDPSFD |
Ga0137388_114801622 | 3300012189 | Vadose Zone Soil | MPTTLSNATRISKRFADLRARGELGIVAYITAGDPSFDSTLKYVLA |
Ga0137363_102086951 | 3300012202 | Vadose Zone Soil | MSSVSPNSNRISNRFAELRASGELGIVAYITAGDPSFDA |
Ga0137370_108419162 | 3300012285 | Vadose Zone Soil | MMVTPPNSTRISKRFAELRASGELGIVAYIVAGDPSLEASLK |
Ga0137360_108875622 | 3300012361 | Vadose Zone Soil | MIAAPSNSTRISKRFAELRNSGELGMVAYITAGDP |
Ga0137361_107353181 | 3300012362 | Vadose Zone Soil | MSSASPNSTRISKRFAELRASGELGIVAYITAGDPS |
Ga0137361_119350461 | 3300012362 | Vadose Zone Soil | MVPANADRTRISRCFADLRASGELGIVAYITAGDPS |
Ga0137390_103828742 | 3300012363 | Vadose Zone Soil | MTLVASNSTRISKRFGKLRASGELGIVAYIVAGDPSLDASLKYVL |
Ga0137390_107447222 | 3300012363 | Vadose Zone Soil | MTSSFQDSTRISKRFAELRAAGELGIVAYITAGDPSLD |
Ga0137395_103099721 | 3300012917 | Vadose Zone Soil | MPVGAQNSSRISRRFAELRESGEMGIVAYITSGDPS |
Ga0137396_106510281 | 3300012918 | Vadose Zone Soil | MSSLSSNSTRISKRFAELRASGELGIVAYIVAGDPSLDASMKYVLAL |
Ga0137359_100585981 | 3300012923 | Vadose Zone Soil | MMSPLASKTRIHECFETLKRSGELGLVAYITAGDPTLDATLKFVLA |
Ga0137413_101519474 | 3300012924 | Vadose Zone Soil | MPVTTSTTTRISRRFAELKARGEMGIIAYITAGDPSL |
Ga0137413_115505451 | 3300012924 | Vadose Zone Soil | MIFATPNSTLISKRFAELRAGGELGIVAYITAGRPS |
Ga0137416_114865852 | 3300012927 | Vadose Zone Soil | MAVEATNSTRISRRFAQLRASGEMGIVAYITAGDP |
Ga0126369_133232972 | 3300012971 | Tropical Forest Soil | MSDAQYNRTRISQRFAELREAGELGIVAYIVAGDPSLDASLRYVL |
Ga0164304_118903831 | 3300012986 | Soil | MSGKTSISTRISKRFADLRASGELGIVAYVTAGDPSLGATLKF |
Ga0120127_100386722 | 3300013503 | Permafrost | MTMSNAPQTRISRCFAALRESGELGIVAYITAGDPSMDATLEFVLAL |
Ga0167640_1266432 | 3300015067 | Glacier Forefield Soil | MAMSNAHESRISRCFAALRETGELGIVAYITAGDPSMDATLE |
Ga0137418_103924312 | 3300015241 | Vadose Zone Soil | MSSLSSNSTRISKRFAELRASGELGIVAYIVAGDPSLDASMKYVLALAEG |
Ga0182036_104635911 | 3300016270 | Soil | MTIAPQHSTRISKRFAELREAGELGIVAYVTAGDPTL |
Ga0182035_118142522 | 3300016341 | Soil | MTSVAHNSTRLSKQFAELRAAGELGMVAYVTAGDP |
Ga0182038_120006561 | 3300016445 | Soil | MTTPPLNPSRISKRFAELRESGELALVAYLPAGAPTLDATLEFVL |
Ga0187778_103286922 | 3300017961 | Tropical Peatland | MMTAAPAKSTRIARRFAELRSVGELGIVAYITAGDPTLDLTLQF |
Ga0187823_103282831 | 3300017993 | Freshwater Sediment | MTSQPQNSTRTSQRFAELRAAGELGIVAYITAGDPT |
Ga0193735_10248321 | 3300020006 | Soil | MTAVASNSTRISKRFAELRASGELGVVAYIVAGDP |
Ga0179594_101466222 | 3300020170 | Vadose Zone Soil | MSGETSNSTRISKRFADLRASGELGIVAYITAGDPSL |
Ga0210401_106873892 | 3300020583 | Soil | MPLAASNSTRISKRFAVLRESGELGIVAYITAGDPTLHAT |
Ga0215015_110703551 | 3300021046 | Soil | MTSLAQNSTRISKRFAELRVAGELGIVAFITAGDPSIHATH |
Ga0179596_104685502 | 3300021086 | Vadose Zone Soil | MIAAPSNSTRISKRFAQLRNSGELGIVAYITAGDP |
Ga0210400_111422262 | 3300021170 | Soil | MTNPSQNSTRISKRFAELRAAGELGIVAYITAGDPSLD |
Ga0210408_103144692 | 3300021178 | Soil | MPLATSNSTRISKRFAALRQSGELGIVAYITAGDPTLDATH |
Ga0210408_111167172 | 3300021178 | Soil | MPVALSNSTRISKRFTDLRASGELGIVAYITAGDPSFDATLKYVL |
Ga0210408_112431662 | 3300021178 | Soil | MAAAFPSSTRISKRFAELRASGELGIVAYITAGDPSLDAP |
Ga0210396_112795841 | 3300021180 | Soil | MTAHTANSTRISQRFASLRERGELGIVAYITAGDP |
Ga0213876_104274121 | 3300021384 | Plant Roots | MTAQTANSTRTAQRFAALRERGELGIVAYITAGDPSLDATLKFVI |
Ga0210385_110360321 | 3300021402 | Soil | MTATTANSTRIAQRFASLREAGELGIVAYITAGDPSLDAT |
Ga0210387_107048381 | 3300021405 | Soil | MPLATSNSTRISKRFAALRESGELGIVAYITAGDPSL |
Ga0210386_107071941 | 3300021406 | Soil | MTAPAANSTRISQRFAELRESGELGIIAYITAGDPSLDATH |
Ga0210384_111725942 | 3300021432 | Soil | MMVATNSNSGRIARRFAELREAGELGIVAYITAGD |
Ga0210392_105804371 | 3300021475 | Soil | MINAPQNSTRISKRFAELRAAGELGMVAYITAGDP |
Ga0210392_111091051 | 3300021475 | Soil | MTAPAANSTRISQRFAELRESGELGIIAYITAGDPSL |
Ga0210409_110620852 | 3300021559 | Soil | MTSPSQNSTRISRRFTELRAAGELGIVAYITAGDPSLDATLK |
Ga0210409_112570732 | 3300021559 | Soil | MTTAPTHSTRISKRFAELRDAGELGIVAYITAGDPTL |
Ga0210409_114304161 | 3300021559 | Soil | MSSVSSNSSRISKRFAELRASGELGIVAYIVAGDPSL |
Ga0137417_13591901 | 3300024330 | Vadose Zone Soil | MSAVTTNSTRISKRFAELRASGELGIVAYIVAGDPSLDASL |
Ga0207928_10898961 | 3300025494 | Arctic Peat Soil | MTSAPPNPTRISKRFAQLRANGELGIVAFITAGDPTLEATLEFV |
Ga0209871_11071981 | 3300026217 | Permafrost Soil | MSVTDVQSTRITRRFAALRAAGELGIVAYITAGDPS |
Ga0209839_102661192 | 3300026294 | Soil | MTMSNAPQTRISRCFAALRETGELGIVAYITAGDPSMDATLEFVL |
Ga0209152_100401771 | 3300026325 | Soil | MIAVASNSTRISKRFAELRASGELGVIAYIVAGDPALD |
Ga0209802_10839241 | 3300026328 | Soil | MTVVASNSTRISKRFADLRATGELGIVAYLVAGDPSF |
Ga0209159_10353071 | 3300026343 | Soil | MMVRPPHSTRISKRFAELRASGELGIVAYIVAGDPSLDASLK |
Ga0209805_14478781 | 3300026542 | Soil | MSVAASNSTRISKRFAELRASGELGIVTYITAGDPSLDATLRF |
Ga0209648_100486605 | 3300026551 | Grasslands Soil | MSSISSNSNRISQRFAELRASGELGIVAYITAGDP |
Ga0209648_104484982 | 3300026551 | Grasslands Soil | MSAVTTNSTRISKRFAELRASGELGIVAYITAGDPS |
Ga0179587_103872471 | 3300026557 | Vadose Zone Soil | MISAPQNSTRISKRFAELRAAGELGLVAYITAGDPSL |
Ga0179587_109818131 | 3300026557 | Vadose Zone Soil | MIAAPSNPTRISKKFAELRASGELGIVAYITAGDPSLDATLKF |
Ga0208730_10124121 | 3300027047 | Forest Soil | MPTSIANSTRIAKRFAELRASGELGIIAYITAGDPS |
Ga0209734_11031942 | 3300027535 | Forest Soil | MPPATSNSTRISKRFAALRESGELGIVAYITAGDPSLDATLK |
Ga0209076_10658741 | 3300027643 | Vadose Zone Soil | MIAAASNSTRISKRFAELRVSGELGLVAYITAGDPSLDATL |
Ga0209772_102118772 | 3300027768 | Bog Forest Soil | MTNTPANSTRISRRFAQLRDSGELGIVAYITAGDPSLDA |
Ga0209039_104188851 | 3300027825 | Bog Forest Soil | MTTVSKNSSRISKRFAELGASAEVGIVAYITAGDPTLD |
Ga0209180_105772741 | 3300027846 | Vadose Zone Soil | MSAAPSNSTRISRRFAELRANGELGVVAYLTAGDPSIDATLRFVLA |
Ga0209579_100885721 | 3300027869 | Surface Soil | MTIPSPNSTRISKRFADLRESGELGIVAYITAGDPSFDATL |
Ga0209380_108086672 | 3300027889 | Soil | MTVSPPNPTRISQRFAELRASGELGIIAYITAGDPSLDAT |
Ga0137415_110615032 | 3300028536 | Vadose Zone Soil | MMVTPPNSTRISKRFAELRASGELGIVAYIVAGDPSL |
Ga0302301_10521802 | 3300028731 | Palsa | MSATDSNSTRITRRFAELREAGELGIIAYITAGDPSLEATFRF |
Ga0302325_129902502 | 3300031234 | Palsa | MTFVDAKSRISKRFAELRASGELGIIAYITAGDPS |
Ga0307469_108540191 | 3300031720 | Hardwood Forest Soil | MSAATSNQTRISKRFAALRESGELGIVAYITAGDPSLDATR |
Ga0307477_104908272 | 3300031753 | Hardwood Forest Soil | MIAAPSNSTRISKRFEELRASGELGIVAYITAGDPTLDATLRFV |
Ga0318543_101257521 | 3300031777 | Soil | MSPSPSNSTRISKRFAELGTAGELGLVTYITAGDPS |
Ga0318543_102052161 | 3300031777 | Soil | MTSALANSTRISRRFAELREDGELGIVAYITAGDPSLDA |
Ga0318548_101427822 | 3300031793 | Soil | MSPSPSNSTRISKRFAELGTAGELGLVTYITAGDPSLEATHK |
Ga0318503_100858481 | 3300031794 | Soil | MTTPPANPSRISKRFAELRESGELGIVAYLTAGDPMLDATLEFVL |
Ga0318557_104433371 | 3300031795 | Soil | MSAVPANSTRIGKRFAELRAAGELGLVAYITAGDPTLDA |
Ga0318550_106485141 | 3300031797 | Soil | MTTPPANPSRISKRFAELRESGELGIVAYLTAGDPT |
Ga0310910_102206981 | 3300031946 | Soil | MTSVAHNSTRLSKQFAELRAAGELGMVAYVTAGDPT |
Ga0318530_102291611 | 3300031959 | Soil | MTTSPANSTRISKRFAELRESGELGIVAYITAGDPTLDATLN |
Ga0307479_100181969 | 3300031962 | Hardwood Forest Soil | MIAAPSNSTRISKRFEELRASGELGIVAYITAGDPTL |
Ga0307471_1019510921 | 3300032180 | Hardwood Forest Soil | MIAAPSNSTRISKRFAELRASGELGLVAYITAGDP |
Ga0307471_1040418192 | 3300032180 | Hardwood Forest Soil | MIAAPSNSTRISKKFTELRASNKLGIVAYVTAGDPSL |
Ga0307472_1023978852 | 3300032205 | Hardwood Forest Soil | MMMAANANSTRISRRFAELRGRGELGIVAYITAGDPSLD |
Ga0335077_101120831 | 3300033158 | Soil | MTAASANSTRIGKRFAELRADGELGLIPYITAGDPTLDA |
Ga0335077_111565741 | 3300033158 | Soil | MSDAQHNRTRISRRFAELRENGELGIVAYIVAGDPSL |
Ga0310914_101078513 | 3300033289 | Soil | MSPSPSNSTRISKRFAELGTAGELGLVTYITAGDPSLEATHKF |
⦗Top⦘ |