| Basic Information | |
|---|---|
| Family ID | F077839 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNALWLSLLFAAPWLAAIAYTWSRAPRMDGPPPSMADRTRERLWA |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.66 % |
| % of genes near scaffold ends (potentially truncated) | 29.91 % |
| % of genes from short scaffolds (< 2000 bps) | 80.34 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.829 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.239 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.120 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 4.27 |
| PF04234 | CopC | 2.56 |
| PF07883 | Cupin_2 | 2.56 |
| PF13426 | PAS_9 | 1.71 |
| PF12728 | HTH_17 | 1.71 |
| PF03070 | TENA_THI-4 | 1.71 |
| PF03144 | GTP_EFTU_D2 | 1.71 |
| PF13427 | DUF4111 | 0.85 |
| PF00587 | tRNA-synt_2b | 0.85 |
| PF04677 | CwfJ_C_1 | 0.85 |
| PF13508 | Acetyltransf_7 | 0.85 |
| PF13520 | AA_permease_2 | 0.85 |
| PF00679 | EFG_C | 0.85 |
| PF08241 | Methyltransf_11 | 0.85 |
| PF07726 | AAA_3 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF04185 | Phosphoesterase | 0.85 |
| PF07366 | SnoaL | 0.85 |
| PF16317 | Glyco_hydro_99 | 0.85 |
| PF00248 | Aldo_ket_red | 0.85 |
| PF13551 | HTH_29 | 0.85 |
| PF00722 | Glyco_hydro_16 | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF05901 | Excalibur | 0.85 |
| PF02195 | ParBc | 0.85 |
| PF01323 | DSBA | 0.85 |
| PF13189 | Cytidylate_kin2 | 0.85 |
| PF00271 | Helicase_C | 0.85 |
| PF05721 | PhyH | 0.85 |
| PF00582 | Usp | 0.85 |
| PF13481 | AAA_25 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 2.56 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.83 % |
| Unclassified | root | N/A | 40.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01DVFGF | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2113235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium roseum | 600 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101359137 | Not Available | 696 | Open in IMG/M |
| 3300000956|JGI10216J12902_100968236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6035 | Open in IMG/M |
| 3300000956|JGI10216J12902_102491740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300000956|JGI10216J12902_109693906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus sabuli | 4178 | Open in IMG/M |
| 3300000956|JGI10216J12902_115771436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 685 | Open in IMG/M |
| 3300001538|A10PFW1_10063063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5068 | Open in IMG/M |
| 3300001686|C688J18823_10028667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 3797 | Open in IMG/M |
| 3300001686|C688J18823_10245464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1192 | Open in IMG/M |
| 3300001686|C688J18823_10972481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300002568|C688J35102_120951794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2922 | Open in IMG/M |
| 3300004071|Ga0055486_10135329 | Not Available | 589 | Open in IMG/M |
| 3300004081|Ga0063454_101195960 | Not Available | 628 | Open in IMG/M |
| 3300004081|Ga0063454_101867467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300004114|Ga0062593_100016147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3753 | Open in IMG/M |
| 3300004114|Ga0062593_101805021 | Not Available | 672 | Open in IMG/M |
| 3300004156|Ga0062589_101583379 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300004157|Ga0062590_100166795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1537 | Open in IMG/M |
| 3300004479|Ga0062595_100603257 | Not Available | 856 | Open in IMG/M |
| 3300004479|Ga0062595_102048697 | Not Available | 555 | Open in IMG/M |
| 3300005162|Ga0066814_10027131 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005166|Ga0066674_10088038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
| 3300005176|Ga0066679_10362500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
| 3300005178|Ga0066688_11020445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300005206|Ga0068995_10016713 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300005332|Ga0066388_100031682 | All Organisms → cellular organisms → Bacteria | 4986 | Open in IMG/M |
| 3300005332|Ga0066388_100056630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4100 | Open in IMG/M |
| 3300005339|Ga0070660_100072243 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300005436|Ga0070713_100353528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
| 3300005436|Ga0070713_100463593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300005439|Ga0070711_100286700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1305 | Open in IMG/M |
| 3300005439|Ga0070711_100633784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
| 3300005466|Ga0070685_10044308 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300005487|Ga0074211_133722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300005526|Ga0073909_10053361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
| 3300005553|Ga0066695_10410833 | Not Available | 838 | Open in IMG/M |
| 3300005556|Ga0066707_10928337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300005566|Ga0066693_10354072 | Not Available | 592 | Open in IMG/M |
| 3300005587|Ga0066654_10199794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300005713|Ga0066905_100142442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1713 | Open in IMG/M |
| 3300005764|Ga0066903_100062936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4657 | Open in IMG/M |
| 3300005764|Ga0066903_100088815 | All Organisms → cellular organisms → Bacteria | 4091 | Open in IMG/M |
| 3300005841|Ga0068863_101095102 | Not Available | 801 | Open in IMG/M |
| 3300006031|Ga0066651_10334749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300006046|Ga0066652_100150995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1948 | Open in IMG/M |
| 3300006046|Ga0066652_100262255 | Not Available | 1518 | Open in IMG/M |
| 3300006046|Ga0066652_101187467 | Not Available | 722 | Open in IMG/M |
| 3300006049|Ga0075417_10211450 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300006163|Ga0070715_10609723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300006791|Ga0066653_10225542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 953 | Open in IMG/M |
| 3300006871|Ga0075434_101663447 | Not Available | 646 | Open in IMG/M |
| 3300006914|Ga0075436_100800460 | Not Available | 702 | Open in IMG/M |
| 3300007076|Ga0075435_102006922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300009012|Ga0066710_100685046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1561 | Open in IMG/M |
| 3300009012|Ga0066710_100932416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300009038|Ga0099829_10163276 | Not Available | 1785 | Open in IMG/M |
| 3300009088|Ga0099830_11174297 | Not Available | 637 | Open in IMG/M |
| 3300009090|Ga0099827_10044435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3305 | Open in IMG/M |
| 3300009090|Ga0099827_10070031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2704 | Open in IMG/M |
| 3300009090|Ga0099827_10093147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2380 | Open in IMG/M |
| 3300009137|Ga0066709_100401179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1902 | Open in IMG/M |
| 3300009143|Ga0099792_10853948 | Not Available | 600 | Open in IMG/M |
| 3300009176|Ga0105242_11637421 | Not Available | 678 | Open in IMG/M |
| 3300009792|Ga0126374_10992593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 658 | Open in IMG/M |
| 3300009801|Ga0105056_1077220 | Not Available | 503 | Open in IMG/M |
| 3300009816|Ga0105076_1016260 | Not Available | 1275 | Open in IMG/M |
| 3300010136|Ga0127447_1140254 | Not Available | 563 | Open in IMG/M |
| 3300010304|Ga0134088_10359816 | Not Available | 707 | Open in IMG/M |
| 3300010364|Ga0134066_10114272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300010371|Ga0134125_11166159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300010398|Ga0126383_10089853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2711 | Open in IMG/M |
| 3300010398|Ga0126383_10578485 | Not Available | 1192 | Open in IMG/M |
| 3300012010|Ga0120118_1006221 | Not Available | 3648 | Open in IMG/M |
| 3300012096|Ga0137389_11155992 | Not Available | 663 | Open in IMG/M |
| 3300012205|Ga0137362_10661363 | Not Available | 899 | Open in IMG/M |
| 3300012207|Ga0137381_10777481 | Not Available | 831 | Open in IMG/M |
| 3300012210|Ga0137378_10643381 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012212|Ga0150985_100889483 | Not Available | 644 | Open in IMG/M |
| 3300012212|Ga0150985_102742691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300012362|Ga0137361_11171109 | Not Available | 691 | Open in IMG/M |
| 3300012923|Ga0137359_11004505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300012951|Ga0164300_10524556 | Not Available | 682 | Open in IMG/M |
| 3300012961|Ga0164302_11112573 | Not Available | 625 | Open in IMG/M |
| 3300012972|Ga0134077_10179158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300012977|Ga0134087_10152547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1006 | Open in IMG/M |
| 3300012989|Ga0164305_11333208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 629 | Open in IMG/M |
| 3300013501|Ga0120154_1014946 | Not Available | 2091 | Open in IMG/M |
| 3300013772|Ga0120158_10013422 | All Organisms → cellular organisms → Bacteria | 7284 | Open in IMG/M |
| 3300014031|Ga0120173_1026137 | Not Available | 840 | Open in IMG/M |
| 3300014056|Ga0120125_1113270 | Not Available | 641 | Open in IMG/M |
| 3300014150|Ga0134081_10314033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300014823|Ga0120170_1050767 | Not Available | 933 | Open in IMG/M |
| 3300015372|Ga0132256_101018024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 944 | Open in IMG/M |
| 3300015374|Ga0132255_104457454 | Not Available | 593 | Open in IMG/M |
| 3300018078|Ga0184612_10468581 | Not Available | 622 | Open in IMG/M |
| 3300018081|Ga0184625_10001560 | All Organisms → cellular organisms → Bacteria | 9634 | Open in IMG/M |
| 3300018468|Ga0066662_12978431 | Not Available | 503 | Open in IMG/M |
| 3300018482|Ga0066669_10294948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
| 3300022756|Ga0222622_10242039 | Not Available | 1218 | Open in IMG/M |
| 3300025325|Ga0209341_10263905 | Not Available | 1425 | Open in IMG/M |
| 3300026088|Ga0207641_10545795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1130 | Open in IMG/M |
| 3300026300|Ga0209027_1023013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2361 | Open in IMG/M |
| 3300026325|Ga0209152_10041543 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300027032|Ga0209877_1024124 | Not Available | 593 | Open in IMG/M |
| 3300027577|Ga0209874_1091688 | Not Available | 732 | Open in IMG/M |
| 3300027843|Ga0209798_10311454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300027862|Ga0209701_10302378 | Not Available | 918 | Open in IMG/M |
| 3300027873|Ga0209814_10440216 | Not Available | 575 | Open in IMG/M |
| 3300027875|Ga0209283_10554394 | Not Available | 734 | Open in IMG/M |
| 3300027882|Ga0209590_10147097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1458 | Open in IMG/M |
| 3300027952|Ga0209889_1015173 | Not Available | 1812 | Open in IMG/M |
| 3300028711|Ga0307293_10296232 | Not Available | 513 | Open in IMG/M |
| 3300028814|Ga0307302_10069012 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300028889|Ga0247827_10634266 | Not Available | 688 | Open in IMG/M |
| 3300031997|Ga0315278_10185984 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium | 2134 | Open in IMG/M |
| 3300032516|Ga0315273_10070542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4745 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.82% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.27% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.71% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.85% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_01271040 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MNALWLSLLFGAPWLAAIAYSWSRAPRMDGPPPSMAHRTRERL |
| ICChiseqgaiiDRAFT_21132352 | 3300000033 | Soil | MNALWLSLLFGAPWLAAIAYTWSRAPRMDGPAPSMAHRMRERLWA* |
| INPhiseqgaiiFebDRAFT_1013591372 | 3300000364 | Soil | LLFGAPWLAAIAYVWSRAPRVDGPPPSMADYARERLWA* |
| JGI10216J12902_1009682362 | 3300000956 | Soil | MNALWLTLIFAAPWLAAIAYVWSRAPRMDDPPPSMAERARARLWA* |
| JGI10216J12902_1024917403 | 3300000956 | Soil | SPRGWHTRPMNALWLSFLFASPWLAAIAYAWSRAPRMDGPPPSMADRTRERLWH* |
| JGI10216J12902_1096939061 | 3300000956 | Soil | ALWLTLLFAAPWLAAIAYTWSRAPRMDGPPPSQAERARERLPKS* |
| JGI10216J12902_1157714361 | 3300000956 | Soil | ALWLTLLFAAPWLAAIGYTWSRAPRGDGPPPSMAERTRERLWPKS* |
| A10PFW1_100630631 | 3300001538 | Permafrost | MNALWLSLLFAAPWLAAIAYTWSRAPRMDGPPPSMADRTRERLWA* |
| C688J18823_100286671 | 3300001686 | Soil | MDALWIALFFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERL |
| C688J18823_102454642 | 3300001686 | Soil | LKRYGHTGRVNALWVTLLLAAPWLVMLAYTWSRAPRMDGPPPSLADRARQRLWS* |
| C688J18823_109724812 | 3300001686 | Soil | GAYRYSSCGWHTRLMDALWITXLLAAPWLVLLAYTWSRAPRMDGPPPSLADRARQRLWS* |
| C688J35102_1209517943 | 3300002568 | Soil | MDALWIALFFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERLWS* |
| Ga0055486_101353292 | 3300004071 | Natural And Restored Wetlands | VLESIGISLLFGAPWIAAIIWTWWRAPRFDDVPPSMADRARTRLWA* |
| Ga0063454_1011959602 | 3300004081 | Soil | GWHTRPMNALWLSLLFGAPWLVAIAFAWSRAPRTDDPPPSMADRTRERLWV* |
| Ga0063454_1018674672 | 3300004081 | Soil | LKRCGHTGSVDALWVTLLLAAPWLVMLAYTWSRAPRMDGPPPSLADRARERLWS* |
| Ga0062593_1000161475 | 3300004114 | Soil | MNALWVTLLLASPWLAAVAYTWSRAPRMDGPPPSMADRTRERLWT* |
| Ga0062593_1018050212 | 3300004114 | Soil | MNALWLSLLFGAPWLAAIGYAWSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0062589_1015833792 | 3300004156 | Soil | MHALWITLLFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERLWS* |
| Ga0062590_1001667953 | 3300004157 | Soil | MNALWVTLLLAAPWLAAIAYTWSRAPRMEGPPPSMADRTRTRLWS* |
| Ga0062595_1006032572 | 3300004479 | Soil | MNTLWLSLLFGAPWLAAIAYTWSRAPRMDGPPPSMADHARERLWTT* |
| Ga0062595_1020486971 | 3300004479 | Soil | MNALWLSLLFGAPWLAAIAYVWSRAPRVDGPPPSMADYARERLWA* |
| Ga0066814_100271311 | 3300005162 | Soil | MNALWVTLLLAAPWLAATAYTWSRAPRMEGPPPSMADRTRARLWS* |
| Ga0066674_100880381 | 3300005166 | Soil | MLPVWLSLLFGAPWLVAIVWVRSRAPRTDVVPPSMAESARERLWT* |
| Ga0066679_103625001 | 3300005176 | Soil | MNALWLSLLFGAPWLAGIAYTLSRAPRMDGPLPSMAHRTRERLWT* |
| Ga0066688_110204452 | 3300005178 | Soil | WLTLLFSAPWLAAIAYTWSRAPRRDVPPPSMADRTRDRLWA* |
| Ga0068995_100167132 | 3300005206 | Natural And Restored Wetlands | MYGLWLSLLFGAPWLVAIVWTWSRAPRADSVPPSMGERARQRLWTI* |
| Ga0066388_1000316826 | 3300005332 | Tropical Forest Soil | MSALWLSLLFASPWLAAIAYVWPRAPRMDTAPPSMADRARDRLWV* |
| Ga0066388_1000566302 | 3300005332 | Tropical Forest Soil | MSPIWLSLLFGAPWLVPTIWIWSRLPRTDDVPPSLASASRQRLWST* |
| Ga0070660_1000722433 | 3300005339 | Corn Rhizosphere | MNALWVTLLLAAPWLAAIAYTWSRAPRTEGPPPSMADRTRARLWS* |
| Ga0070713_1003535281 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALWVTLLLASPWLVLLAYTWSRAPRLDGPPPSLADRARQR |
| Ga0070713_1004635933 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALWVTLLLAAPWLVLLAYSWSRAPRMDGPPPSLADRARQRLWS* |
| Ga0070711_1002867002 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALWLSLFFASPWLAAIAYTWSRAPRMDDPPPSMADRARDRLWV* |
| Ga0070711_1006337843 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | WVTLVLAAPWIAAIAFTWSRAPRMDNPPPSMADRARERLWA* |
| Ga0070685_100443083 | 3300005466 | Switchgrass Rhizosphere | MNALWVTLLLAAPWLAAIAYTWSRAPRMEGPPPSMADRTRARLWS* |
| Ga0074211_1337221 | 3300005487 | Sediment | MLYSFGLSLLLGAPWLVAIIWTWSRAPRVDAVLPSMADRTRERLWV* |
| Ga0073909_100533613 | 3300005526 | Surface Soil | MNALWVTLLLAAPWLAAIAYTWSRAPRMESPPPSMADRTRARLWS* |
| Ga0066695_104108331 | 3300005553 | Soil | MNALWLSLLFASPWLAAIAYAWSRAPRMDGPPPSMADRTRDRLWV* |
| Ga0066707_109283371 | 3300005556 | Soil | MLPVWLSLLFGAPWLVAIVWVRSRAPRTDVVPPSMAESARE |
| Ga0066693_103540721 | 3300005566 | Soil | MNALWLTLTFAGPWLAAIAYVWSRAPRMDGPPPSMADR |
| Ga0066654_101997941 | 3300005587 | Soil | LKRCGHTGWVDALWVTLLLTAPWLAMLAYTWSRAPRMDGPPPSLADRARERLWS* |
| Ga0066905_1001424422 | 3300005713 | Tropical Forest Soil | MNALWVTLLLSTPWLAAIAYTWSRAPRMDRPPPSQADRTRERLWA* |
| Ga0066903_1000629361 | 3300005764 | Tropical Forest Soil | LLFGAPWLVPTIWIWSRLPRTDDVPPSLAKASRQRLWST* |
| Ga0066903_1000888154 | 3300005764 | Tropical Forest Soil | MIALWLSLLFGSPLLAAIAHTWSRAPRMEGPPPSMADRARDRLWL* |
| Ga0068863_1010951022 | 3300005841 | Switchgrass Rhizosphere | MNALWLSLFFASPWLAAIAYTWSRAPRMDDPPPSMADRARNRLWV* |
| Ga0066651_103347491 | 3300006031 | Soil | MNALWLTLIFAAPWLAAIAYVWSRAPRMDGPPPSMADRARARLWA* |
| Ga0066652_1001509952 | 3300006046 | Soil | MQALWLSLLFGAPWLAGIAYVWSRAPRMDGTPPSMAERTRERLWT* |
| Ga0066652_1002622553 | 3300006046 | Soil | MNALWVALFLAAPWLAAIAYTWSRAPRMEGPPPSMADRTRARLWS* |
| Ga0066652_1011874671 | 3300006046 | Soil | MNALWLTLTFAGPWLAAIAYVWSRAPRMDGPPPSMADRA |
| Ga0075417_102114502 | 3300006049 | Populus Rhizosphere | MQALWITLLFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERLWS* |
| Ga0070715_106097232 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALWVTLLLASPWLVLLAYTWSRAPRLDGPPPSLADRARERLWS* |
| Ga0066653_102255422 | 3300006791 | Soil | MNALWLTLTFAAPWLAAIAYVWSRAPRMDGPPPSMADRARARLWA* |
| Ga0075434_1016634473 | 3300006871 | Populus Rhizosphere | AMSTLLLSLLFAAPWLAAITWVWSRAPKLEGPPPSLADRARERLWAS* |
| Ga0075436_1008004601 | 3300006914 | Populus Rhizosphere | ASPWLAAIAYTWSRAPRMDDPPPSMADRARDRLWV* |
| Ga0075435_1020069222 | 3300007076 | Populus Rhizosphere | MNALWLSLLFASPWLAAIAYTWSRAPRMDDPPPSMADRARDRLWV* |
| Ga0066710_1006850461 | 3300009012 | Grasslands Soil | MNALWLSLFFGAPWLAAIAYGWSRAPRMDGPPPSMAHRTRERLWA |
| Ga0066710_1009324163 | 3300009012 | Grasslands Soil | MNALWLSLFFGAPWLAAIAYTWSRAPRMDGPAPSMAHRMRERLWA |
| Ga0099829_101632764 | 3300009038 | Vadose Zone Soil | MNALWLSLLFGAPWLVAIAYTFSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0099830_111742971 | 3300009088 | Vadose Zone Soil | SPRGWHNQPMNALWLSLLFGAPWLAAIAYTLSRVPRMDGPPPSMAHRTRERLWA* |
| Ga0099827_100444352 | 3300009090 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYTLSRVPRMDGPPPSMAHRTRERLWA* |
| Ga0099827_100700313 | 3300009090 | Vadose Zone Soil | MNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0099827_100931473 | 3300009090 | Vadose Zone Soil | ADRSRSSPRDWHNQPMNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMAHRTRERLWA |
| Ga0066709_1004011793 | 3300009137 | Grasslands Soil | MNALWLSLFFGAPWLAAIAYTWSRAPRMDGPAPSMAHRMRERLWA* |
| Ga0099792_108539481 | 3300009143 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYTLSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0105242_116374212 | 3300009176 | Miscanthus Rhizosphere | MNALWVSLFFASPWLAAIAYTWSRAPRMDDLPPSMADRARDRLWV |
| Ga0126374_109925931 | 3300009792 | Tropical Forest Soil | MTALWLSLLFGAPWLAAIAYVWSRAPRDDSPPPSMADYARERLWT* |
| Ga0105056_10772202 | 3300009801 | Groundwater Sand | MYGLWLSLLFGAPWLAAIIWIWSRAPRTDVVPPSMGEQALQRLSTI* |
| Ga0105076_10162601 | 3300009816 | Groundwater Sand | MYSLWLSLLFGAPWLAAIIWIWSRAPRTDVVPPSMGEQALQRLSTI* |
| Ga0127447_11402541 | 3300010136 | Grasslands Soil | SLLFGAPWLVAIVWVRSRAPRTDVVPPSMADSARERLWT* |
| Ga0134088_103598161 | 3300010304 | Grasslands Soil | MNALWLSLLFGAPWLAAIAYTLSRAPRMHGPPPSMAHRTRERLWA* |
| Ga0134066_101142721 | 3300010364 | Grasslands Soil | MLPVCLSLLFGAPWLVAIVWVRSRAPRTDVVPPSMAESARERLWT* |
| Ga0134125_111661591 | 3300010371 | Terrestrial Soil | MNALWVSLFFASPWLAAIAYTWSRAPRMDDLPPSMADRARDRLWV* |
| Ga0126383_100898532 | 3300010398 | Tropical Forest Soil | MSPIWLSLLFGAPWLVPTIWIWSRLPRTDDVPPSLANASRQRLWST* |
| Ga0126383_105784851 | 3300010398 | Tropical Forest Soil | WHTQPMNALWLTLLLAAPWLAALAYTWSRAPRMDGPPPSTAERTRERLWH* |
| Ga0120118_10062212 | 3300012010 | Permafrost | MNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMAHRTRERLWDLTS* |
| Ga0137389_111559922 | 3300012096 | Vadose Zone Soil | GWHNQPMNALWLSLLFGAPWLAAIAYTLSRVPRMDGPPPSMAHRTRERLWA* |
| Ga0137362_106613631 | 3300012205 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYALSRAPRMDGPPPSMAQRTRERLWA* |
| Ga0137381_107774812 | 3300012207 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYSWSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0137378_106433811 | 3300012210 | Vadose Zone Soil | MDALWIALFFAAPWLAAIAYTWSRAPSMDGPPPAMAERTRERLWS* |
| Ga0150985_1008894831 | 3300012212 | Avena Fatua Rhizosphere | GWHTRRMNALWLSLLFGAPWLVAIAFAWSRAPRTDDPPPSMADRTRERL* |
| Ga0150985_1027426911 | 3300012212 | Avena Fatua Rhizosphere | LLLAAPWLVLLAYTWSRAPRMDGPPPSLADRARQRLWS* |
| Ga0137361_111711092 | 3300012362 | Vadose Zone Soil | MNALWLSLFFGAPWLAAIAYALSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0137359_110045051 | 3300012923 | Vadose Zone Soil | IWKRGADRCRCSSRGWHNQPMNALWRSLLFGAGWLAAIAYALSRAPRMDGPPPSMAHRTRERLWA* |
| Ga0164300_105245561 | 3300012951 | Soil | VHALWLTLLFAAPWLAAIVYTWSRAPRMDCPPPSMAERTRERLW |
| Ga0164302_111125732 | 3300012961 | Soil | MNAFWLSLLFGAPWLAAIAYTWSRAPRMDGPPPSLAERTRSRLWS* |
| Ga0134077_101791582 | 3300012972 | Grasslands Soil | VDALWVTLLLAAPWLVMLAYTWWRAPRMDGPPPSLADRARERLWS* |
| Ga0134087_101525473 | 3300012977 | Grasslands Soil | MLPVWLSLLFGAPWLVAIVWVRSRAPRTDVVPPSMA |
| Ga0164305_113332081 | 3300012989 | Soil | PHGWHHRPVNAFWVTLVLAAPWLAAIAFTWSRAPRMDSPPPSMADRARERLWA* |
| Ga0120154_10149461 | 3300013501 | Permafrost | VNALWLSLLFGAPWLAAIAYTWSRAPRMDGPPPSMAHRTRERLWDLT |
| Ga0120158_100134228 | 3300013772 | Permafrost | LPSSPRGWHNQLMNALWLSLLFAAPWLAAIAYTWSRAPRMDGPPPSMADRTRERLWA* |
| Ga0120173_10261371 | 3300014031 | Permafrost | MNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMADRARAPLGLK |
| Ga0120125_11132701 | 3300014056 | Permafrost | MNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMADRTRERLWA* |
| Ga0134081_103140332 | 3300014150 | Grasslands Soil | VDALWVTLLLAAPWLVMLAYTWSRAPRMDGPPPSLADRARERLWS* |
| Ga0120170_10507672 | 3300014823 | Permafrost | MNALWLSLLFGAPWLVAIAYTLPRAPRMDGPPPSMAHRTRERLWV* |
| Ga0132256_1010180242 | 3300015372 | Arabidopsis Rhizosphere | MNALWLSLLFASPWLAAIAYTWSRAPRMDDPPPSMADRARNRLWV* |
| Ga0132255_1044574541 | 3300015374 | Arabidopsis Rhizosphere | MNALFLLLLFASPWLAAIAYTWSRAPRMDDPPPSMADRARDRLWV* |
| Ga0184612_104685811 | 3300018078 | Groundwater Sediment | MTVLGISLLFGAPWLLAIAWTWSLAPRVDSVVPSLGERLRERLRTI |
| Ga0184625_100015603 | 3300018081 | Groundwater Sediment | MYGLWLSLLFGAPWLAAIIWIWSRAPRTDVVPPSMGEQALQRLSTI |
| Ga0066662_129784311 | 3300018468 | Grasslands Soil | MNALWLSLFFGAPWLAAIAYTLSRAPRMDGPPPSMAHRTRERLWA |
| Ga0066669_102949483 | 3300018482 | Grasslands Soil | MLPVWLSLLFGAPWLVAIVWVRSRAPRTDVVPPSMAESARERLWT |
| Ga0222622_102420392 | 3300022756 | Groundwater Sediment | MEGLWISLVFGAPWLVAIAWVWSRGPRMDGLPPSMADRMRERLSQT |
| Ga0209341_102639052 | 3300025325 | Soil | MNGLWLSLLFGAPWLAAIVWTWSRAPRADSVPPSMGERARQRLWTI |
| Ga0207641_105457952 | 3300026088 | Switchgrass Rhizosphere | MNALWLSLFFASPWLAAIAYTWSRAPRMDDPPPSMADRARNRLWV |
| Ga0209027_10230132 | 3300026300 | Grasslands Soil | MDALWIALFFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERLWS |
| Ga0209152_100415432 | 3300026325 | Soil | VDALWVTLLLAAPWLAMLAYTWSRAPRMDGPPPSLADRARERLWS |
| Ga0209877_10241242 | 3300027032 | Groundwater Sand | MHGLWLSLLFGAPWLAAIIWIWSRAPRTDVVPPSMGEQALQRLSTI |
| Ga0209874_10916883 | 3300027577 | Groundwater Sand | MSGLWLSILFGAPWLAAIVGAWSRAPRADAVPPSLGERARQRLWTL |
| Ga0209798_103114541 | 3300027843 | Wetland Sediment | MLYSFGLSLLFGAPWLVAIIWTWSRAPRSDAVPPSMADRTRERLWA |
| Ga0209701_103023782 | 3300027862 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYTLSRAPRMDGPPPSMAHRTRERLWA |
| Ga0209814_104402161 | 3300027873 | Populus Rhizosphere | MQALWITLLFAAPWLAAIAYTWSRAPSMDGPPPSMAERTRERLWS |
| Ga0209283_105543942 | 3300027875 | Vadose Zone Soil | MNALWLSLLFGAPWLAAIAYTLSRAPRMDGPPPSMAHRTRERLWP |
| Ga0209590_101470972 | 3300027882 | Vadose Zone Soil | MNALWLSLLFGAPWLVAIAYTLSRAPRMDGPPPSMAHRTRERLWA |
| Ga0209889_10151733 | 3300027952 | Groundwater Sand | MSSIWLSILFGAPWLAAIVGAWSRAPRADAVPPSLGERARQRLSTL |
| Ga0307293_102962322 | 3300028711 | Soil | SWHYQAMQALWLSLLFGAPWLAGIAYVWSRAPRMDGPPPSMAERTRERLWA |
| Ga0307302_100690121 | 3300028814 | Soil | DARGSPRSWHYQAMQALWLSLLFGAPWLAGIAYVWSRAPRMDGPPPSMAERTRERLWA |
| Ga0247827_106342662 | 3300028889 | Soil | MYGLWLSLLFGAPWLAAIIWIWSRVPRTDVVPPSMGEQALQRLSTI |
| Ga0315278_101859842 | 3300031997 | Sediment | MLYSFGLSLLLGAPWLVAIIWTWSRAPRLDAVLPSMADRTRERLWA |
| Ga0315273_100705423 | 3300032516 | Sediment | MLYSFGLSLLLGAPWLVAIIWTWSRAPRVDAVLPSMADRTRERLWV |
| ⦗Top⦘ |