Metagenome / Metatranscriptome Family F077836

Basic Information
Family ID	F077836
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	39 residues
Representative Sequence	MVGWTDVVIVSLIAIGSVVLVGILGYLIEKKGAQEGNEDK
Number of Associated Samples	95
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	61.54 %
% of genes near scaffold ends (potentially truncated)	9.40 %
% of genes from short scaffolds (< 2000 bps)	71.79 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (99.145 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (11.111 % of family members)
Environment Ontology (ENVO)	Unclassified (52.137 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (63.248 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF12543	DUF3738	3.42
PF00903	Glyoxalase	2.56
PF13620	CarboxypepD_reg	2.56
PF09980	DUF2214	2.56
PF00753	Lactamase_B	2.56
PF00694	Aconitase_C	1.71
PF13148	DUF3987	0.85
PF00312	Ribosomal_S15	0.85
PF01865	PhoU_div	0.85
PF13442	Cytochrome_CBB3	0.85
PF04366	Ysc84	0.85
PF00069	Pkinase	0.85
PF02897	Peptidase_S9_N	0.85
PF01547	SBP_bac_1	0.85
PF02452	PemK_toxin	0.85
PF12700	HlyD_2	0.85
PF07995	GSDH	0.85
PF06537	DHOR	0.85
PF07075	DUF1343	0.85
PF13847	Methyltransf_31	0.85
PF01152	Bac_globin	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.42
COG0184	Ribosomal protein S15P/S13E	Translation, ribosomal structure and biogenesis [J]	0.85
COG1392	Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family	Inorganic ion transport and metabolism [P]	0.85
COG1505	Prolyl endopeptidase PreP, S9A serine peptidase family	Amino acid transport and metabolism [E]	0.85
COG1770	Protease II	Amino acid transport and metabolism [E]	0.85
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.85
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.85
COG2346	Truncated hemoglobin YjbI	Inorganic ion transport and metabolism [P]	0.85
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.85
COG3488	Uncharacterized conserved protein with two CxxC motifs, DUF1111 family	General function prediction only [R]	0.85
COG3876	Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family	Cell wall/membrane/envelope biogenesis [M]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.15 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.15 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.15 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	50.43 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	29.91 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.85 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	23.93 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	14.53 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.85 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	21.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5.98 %
Hyphomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales	0.85 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.85 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.85 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.85 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.85 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	21.37 %
Devosiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae	1.71 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.85 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.85 %
unclassified Bryobacterales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales	0.85 %
Hyphomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	21.37 %
Pelagibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium	1.71 %
Ponticaulis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Ponticaulis	0.85 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	21.37 %
Pelagibacterium halotolerans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans	1.71 %
Ponticaulis koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Ponticaulis → Ponticaulis koreensis	0.85 %
unclassified Planctomycetaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	21.37 %
Pelagibacterium halotolerans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans	1.71 %
Planctomycetaceae bacterium SCGC AG-212-F19	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19	0.85 %
Ponticaulis koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Ponticaulis → Ponticaulis koreensis	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100751604	All Organisms → cellular organisms → Bacteria	2271	Open in IMG/M
3300000567\|JGI12270J11330_10042368	All Organisms → cellular organisms → Bacteria	2529	Open in IMG/M
3300004799\|Ga0058863_11048893	All Organisms → cellular organisms → Bacteria → Acidobacteria	738	Open in IMG/M
3300004803\|Ga0058862_11340173	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	692	Open in IMG/M
3300005328\|Ga0070676_11091310	All Organisms → cellular organisms → Bacteria → Proteobacteria	603	Open in IMG/M
3300005329\|Ga0070683_100021470	All Organisms → cellular organisms → Bacteria → Proteobacteria	5764	Open in IMG/M
3300005334\|Ga0068869_100155500	All Organisms → cellular organisms → Bacteria → Proteobacteria	1776	Open in IMG/M
3300005364\|Ga0070673_100183390	All Organisms → cellular organisms → Bacteria → Proteobacteria	1793	Open in IMG/M
3300005435\|Ga0070714_100015269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6178	Open in IMG/M
3300005439\|Ga0070711_100717764	All Organisms → cellular organisms → Bacteria → Proteobacteria	843	Open in IMG/M
3300005439\|Ga0070711_102080144	All Organisms → cellular organisms → Bacteria → Acidobacteria	500	Open in IMG/M
3300005440\|Ga0070705_101747698	All Organisms → cellular organisms → Bacteria → Acidobacteria	526	Open in IMG/M
3300005529\|Ga0070741_10000040	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	470804	Open in IMG/M
3300005534\|Ga0070735_10014063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Ponticaulis → Ponticaulis koreensis	5981	Open in IMG/M
3300005542\|Ga0070732_10263874	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300005547\|Ga0070693_101179873	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	587	Open in IMG/M
3300005548\|Ga0070665_100706831	All Organisms → cellular organisms → Bacteria → Acidobacteria	1021	Open in IMG/M
3300005563\|Ga0068855_100103563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3274	Open in IMG/M
3300005614\|Ga0068856_100398689	All Organisms → cellular organisms → Bacteria → Proteobacteria	1396	Open in IMG/M
3300005616\|Ga0068852_100067519	All Organisms → cellular organisms → Bacteria	3126	Open in IMG/M
3300005617\|Ga0068859_100138854	All Organisms → cellular organisms → Bacteria	2504	Open in IMG/M
3300005617\|Ga0068859_102883145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	527	Open in IMG/M
3300005618\|Ga0068864_100131957	All Organisms → cellular organisms → Bacteria	2245	Open in IMG/M
3300005718\|Ga0068866_10261919	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1063	Open in IMG/M
3300005719\|Ga0068861_101242250	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	722	Open in IMG/M
3300005842\|Ga0068858_100291049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans	1557	Open in IMG/M
3300006163\|Ga0070715_10654212	All Organisms → cellular organisms → Bacteria → Acidobacteria	622	Open in IMG/M
3300006163\|Ga0070715_10770774	All Organisms → cellular organisms → Bacteria → Acidobacteria	581	Open in IMG/M
3300006175\|Ga0070712_101710735	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	551	Open in IMG/M
3300006358\|Ga0068871_100051346	All Organisms → cellular organisms → Bacteria → Proteobacteria	3338	Open in IMG/M
3300006358\|Ga0068871_100105367	All Organisms → cellular organisms → Bacteria	2366	Open in IMG/M
3300006638\|Ga0075522_10000824	All Organisms → cellular organisms → Bacteria	22955	Open in IMG/M
3300006755\|Ga0079222_10288292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans	1062	Open in IMG/M
3300006804\|Ga0079221_10196777	All Organisms → cellular organisms → Bacteria → Proteobacteria	1100	Open in IMG/M
3300006854\|Ga0075425_100515218	All Organisms → cellular organisms → Bacteria → Acidobacteria	1377	Open in IMG/M
3300006881\|Ga0068865_100486568	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1026	Open in IMG/M
3300006893\|Ga0073928_10629574	All Organisms → cellular organisms → Bacteria → Acidobacteria	755	Open in IMG/M
3300009093\|Ga0105240_10318540	All Organisms → cellular organisms → Bacteria → Acidobacteria	1773	Open in IMG/M
3300009093\|Ga0105240_10572635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1247	Open in IMG/M
3300009093\|Ga0105240_10846939	All Organisms → cellular organisms → Bacteria → Acidobacteria	987	Open in IMG/M
3300009098\|Ga0105245_10468558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1271	Open in IMG/M
3300009098\|Ga0105245_10649380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1085	Open in IMG/M
3300009101\|Ga0105247_10198810	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1346	Open in IMG/M
3300009143\|Ga0099792_11147816	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300009176\|Ga0105242_12982026	All Organisms → cellular organisms → Bacteria → Acidobacteria	524	Open in IMG/M
3300009177\|Ga0105248_10433903	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19	1480	Open in IMG/M
3300009177\|Ga0105248_12234818	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	623	Open in IMG/M
3300009545\|Ga0105237_10207728	All Organisms → cellular organisms → Bacteria → Proteobacteria	1958	Open in IMG/M
3300009545\|Ga0105237_10803422	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	947	Open in IMG/M
3300009545\|Ga0105237_12567124	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	520	Open in IMG/M
3300009551\|Ga0105238_10027009	All Organisms → cellular organisms → Bacteria → Proteobacteria	5851	Open in IMG/M
3300009551\|Ga0105238_11106590	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	815	Open in IMG/M
3300010359\|Ga0126376_10611762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1032	Open in IMG/M
3300010373\|Ga0134128_10550285	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1286	Open in IMG/M
3300010375\|Ga0105239_13017362	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300010379\|Ga0136449_100002997	All Organisms → cellular organisms → Bacteria	50670	Open in IMG/M
3300010379\|Ga0136449_100129228	All Organisms → cellular organisms → Bacteria	5040	Open in IMG/M
3300010379\|Ga0136449_102704942	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	704	Open in IMG/M
3300010397\|Ga0134124_12610420	All Organisms → cellular organisms → Bacteria → Acidobacteria	548	Open in IMG/M
3300010399\|Ga0134127_10577950	All Organisms → cellular organisms → Bacteria → Acidobacteria	1149	Open in IMG/M
3300010400\|Ga0134122_10258020	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1476	Open in IMG/M
3300011119\|Ga0105246_11790416	All Organisms → cellular organisms → Bacteria → Acidobacteria	586	Open in IMG/M
3300011120\|Ga0150983_10796758	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300012200\|Ga0137382_11124807	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	560	Open in IMG/M
3300012469\|Ga0150984_104132854	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	575	Open in IMG/M
3300012931\|Ga0153915_11043790	All Organisms → cellular organisms → Bacteria → Proteobacteria	953	Open in IMG/M
3300012982\|Ga0168317_1001513	All Organisms → cellular organisms → Bacteria	12875	Open in IMG/M
3300013296\|Ga0157374_10494000	All Organisms → cellular organisms → Bacteria → Proteobacteria	1228	Open in IMG/M
3300013307\|Ga0157372_10820722	All Organisms → cellular organisms → Bacteria → Acidobacteria	1080	Open in IMG/M
3300014325\|Ga0163163_12736438	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	550	Open in IMG/M
3300017792\|Ga0163161_10839399	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	775	Open in IMG/M
3300020580\|Ga0210403_10141213	All Organisms → cellular organisms → Bacteria → Acidobacteria	1967	Open in IMG/M
3300021170\|Ga0210400_10772446	All Organisms → cellular organisms → Bacteria → Acidobacteria	788	Open in IMG/M
3300021407\|Ga0210383_10130440	All Organisms → cellular organisms → Bacteria	2129	Open in IMG/M
3300025862\|Ga0209483_1002267	All Organisms → cellular organisms → Bacteria	13591	Open in IMG/M
3300025899\|Ga0207642_10163168	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1198	Open in IMG/M
3300025899\|Ga0207642_10427059	All Organisms → cellular organisms → Bacteria → Acidobacteria	798	Open in IMG/M
3300025900\|Ga0207710_10563827	All Organisms → cellular organisms → Bacteria → Acidobacteria	594	Open in IMG/M
3300025905\|Ga0207685_10118211	All Organisms → cellular organisms → Bacteria → Proteobacteria	1159	Open in IMG/M
3300025909\|Ga0207705_10086820	All Organisms → cellular organisms → Bacteria	2287	Open in IMG/M
3300025911\|Ga0207654_10015058	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4006	Open in IMG/M
3300025911\|Ga0207654_11102235	All Organisms → cellular organisms → Bacteria → Acidobacteria	578	Open in IMG/M
3300025912\|Ga0207707_11416399	All Organisms → cellular organisms → Bacteria → Acidobacteria	554	Open in IMG/M
3300025913\|Ga0207695_10050355	All Organisms → cellular organisms → Bacteria → Acidobacteria	4383	Open in IMG/M
3300025918\|Ga0207662_10856248	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	642	Open in IMG/M
3300025921\|Ga0207652_10723918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	887	Open in IMG/M
3300025924\|Ga0207694_10111308	All Organisms → cellular organisms → Bacteria → Proteobacteria	2178	Open in IMG/M
3300025927\|Ga0207687_10001507	All Organisms → cellular organisms → Bacteria	15957	Open in IMG/M
3300025927\|Ga0207687_10254523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1397	Open in IMG/M
3300025927\|Ga0207687_10475060	All Organisms → cellular organisms → Bacteria → Proteobacteria	1040	Open in IMG/M
3300025927\|Ga0207687_11264764	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	634	Open in IMG/M
3300025934\|Ga0207686_10634672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	844	Open in IMG/M
3300025935\|Ga0207709_10963756	Not Available	696	Open in IMG/M
3300025942\|Ga0207689_10030200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4516	Open in IMG/M
3300025942\|Ga0207689_10119495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2168	Open in IMG/M
3300026035\|Ga0207703_10263482	All Organisms → cellular organisms → Bacteria → Proteobacteria	1559	Open in IMG/M
3300027842\|Ga0209580_10422048	All Organisms → cellular organisms → Bacteria → Acidobacteria	665	Open in IMG/M
3300027854\|Ga0209517_10002534	All Organisms → cellular organisms → Bacteria	25533	Open in IMG/M
3300027986\|Ga0209168_10046647	All Organisms → cellular organisms → Bacteria	2329	Open in IMG/M
3300028381\|Ga0268264_10047194	All Organisms → cellular organisms → Bacteria	3580	Open in IMG/M
3300028800\|Ga0265338_10146701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1840	Open in IMG/M
3300029636\|Ga0222749_10188769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1024	Open in IMG/M
3300029636\|Ga0222749_10303575	All Organisms → cellular organisms → Bacteria → Proteobacteria	826	Open in IMG/M
3300031057\|Ga0170834_102003848	All Organisms → cellular organisms → Bacteria → Acidobacteria	556	Open in IMG/M
3300031128\|Ga0170823_17429531	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	707	Open in IMG/M
3300031474\|Ga0170818_102249893	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	766	Open in IMG/M
3300031474\|Ga0170818_104392905	All Organisms → cellular organisms → Bacteria → Acidobacteria	655	Open in IMG/M
3300031595\|Ga0265313_10005853	All Organisms → cellular organisms → Bacteria	8920	Open in IMG/M
3300031716\|Ga0310813_11571005	All Organisms → cellular organisms → Bacteria → Acidobacteria	614	Open in IMG/M
3300031740\|Ga0307468_101993093	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	556	Open in IMG/M
3300031938\|Ga0308175_100165495	All Organisms → cellular organisms → Bacteria → Acidobacteria	2138	Open in IMG/M
3300031947\|Ga0310909_11515871	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	534	Open in IMG/M
3300032160\|Ga0311301_10314563	All Organisms → cellular organisms → Bacteria	2491	Open in IMG/M
3300032160\|Ga0311301_12834982	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	528	Open in IMG/M
3300033412\|Ga0310810_10069534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	4254	Open in IMG/M
3300033513\|Ga0316628_104017457	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300034090\|Ga0326723_0605906	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	507	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	51.28%
Environmental	Environmental	48.72%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	49.57%
Terrestrial	Environmental → Terrestrial	47.01%
Aquatic	Environmental → Aquatic	1.71%
Human	Host-Associated → Human	1.71%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	45.30%
Rhizosphere	Host-Associated → Plants → Rhizosphere	31.62%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.38%
Roots	Host-Associated → Plants → Roots	2.56%
Digestive System	Host-Associated → Human → Digestive System	1.71%
Freshwater	Environmental → Aquatic → Freshwater	0.85%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.85%
Peat	Environmental → Terrestrial → Peat	0.85%
Geologic	Environmental → Terrestrial → Geologic	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.64%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	15.38%
Loam	Environmental → Terrestrial → Soil → Loam	11.97%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.56%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.71%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.85%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.85%
Mine	Environmental → Terrestrial → Geologic → Mine	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.64%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	15.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.11%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.71%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.71%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.85%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.85%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	11.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	8.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.84%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	5.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.13%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	4.27%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.42%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.71%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.71%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.71%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.71%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.85%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.85%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.85%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.85%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.85%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.85%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012982	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027854	Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077836

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1007516043	3300000364	Soil	MMVWTDVAMVVLLAIGAVVVVGVLGYLIEKKGAEDS*
JGI12270J11330_100423684	3300000567	Peatlands Soil	MVGPVDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGNAGRERDK*
Ga0058863_110488931	3300004799	Host-Associated	MVGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGKKDK*
Ga0058862_113401732	3300004803	Host-Associated	MVGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGNKDK*
Ga0070676_110913102	3300005328	Miscanthus Rhizosphere	MVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGAQEGNEDR*
Ga0070683_1000214703	3300005329	Corn Rhizosphere	MVGPIDILLVSLIAIGSVVLIGVLGYLIEKGTPEGNQEGNKDK*
Ga0068869_1001555002	3300005334	Miscanthus Rhizosphere	MVGSTDVLIVSLIAVGSVVLVGLLGYLIEKKGAQEGNEDK*
Ga0070673_1001833902	3300005364	Switchgrass Rhizosphere	MAGWTDAVIVSLLALGAVVVIGVLGYLIEKKGAKEGNEDK*
Ga0070714_1000152694	3300005435	Agricultural Soil	MMGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGTGEGNQEGNKDK*
Ga0070711_1007177642	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MMGWTDVLIVSLIAIGSVVLIGVLGYLIDKTGTGEGNQEGNKDK*
Ga0070711_1020801442	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MVGPIDILLVSLIAIGSVVLVVVLGYLIETKGAREGNEDK*
Ga0070705_1017476981	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MAGWTDAVIVSLLALGAVVVIGVLGYLIEKKGAQEGNEDK*
Ga0070741_10000040381	3300005529	Surface Soil	MASWTDAVIVTLIALGAAVLVGVLGYLADKKGTEDH*
Ga0070735_100140635	3300005534	Surface Soil	MVGLKDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGNEDK*
Ga0070732_102638742	3300005542	Surface Soil	MVGSTDIVIVSLIAIGSVVLVGVLGYLIEKKGSQDGGEDK*
Ga0070693_1011798731	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MAGWLDAVIVSLITIGTVALVGILGYLIEKKGAQEGSEDK*
Ga0070665_1007068313	3300005548	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGVLGYLIEKKGAEDK*
Ga0068855_1001035633	3300005563	Corn Rhizosphere	MVGPVDIVIVSLIAIGAVVLIGVLGYLIEKGTQEGNQEGNKDK*
Ga0068856_1003986892	3300005614	Corn Rhizosphere	MVGLLDVVFVTLIAIGAAVLVGILGYLIDKTGAEDT*
Ga0068852_1000675191	3300005616	Corn Rhizosphere	GWTDVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGNKDK*
Ga0068859_1001388543	3300005617	Switchgrass Rhizosphere	MMGWTDVVIVSLLALGAVVVVGVLGYLIEKKGSEDK*
Ga0068859_1028831452	3300005617	Switchgrass Rhizosphere	MAGWIDAIIVTLIAIGSVVVIGILGYLIEKKGAEDT*
Ga0068864_1001319572	3300005618	Switchgrass Rhizosphere	MAGWTDAVIVSLIAIGSVVLVGILGYLIEKKGAEDK*
Ga0068866_102619192	3300005718	Miscanthus Rhizosphere	MAGWTDALIVTLIAIGTVVLVGILGYLIEKKGTEDK*
Ga0068861_1012422502	3300005719	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGTQEGNEDK*
Ga0068858_1002910492	3300005842	Switchgrass Rhizosphere	MVGLLDVVFVTLLAIGAAVLIGVLGYLIDKTGADQ*
Ga0070715_106542122	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	RTLILMVGPADVVIVSLIAIGAVVLIGVLGYLIDKKGTQEGNNDK*
Ga0070715_107707742	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	VFWPLILMVGPIDVVFVSLLAIGSVVLVGILGYLIEKGTQEGNQEGKKDK*
Ga0070712_1017107352	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MVGPADVVFVSLIAIGAVVLIGVLGYLIEKKGTEDK*
Ga0068871_1000513462	3300006358	Miscanthus Rhizosphere	MVGWTDVLIVSLIAIGSVVLVGVLGFLIEKKGAEDR*
Ga0068871_1001053672	3300006358	Miscanthus Rhizosphere	MVGPIDILLVSLIAIGSVVLVGVLGYLIETKGAREGNEDK*
Ga0075522_1000082412	3300006638	Arctic Peat Soil	MVGPADIVFVTLIAIGAVVLVGVLGYLIDKKGTQEGDQEGSKDK*
Ga0079222_102882922	3300006755	Agricultural Soil	MASWTDAVIVTLIAIGVSALVGVLGYLIEKKGTQGGSER*
Ga0079221_101967773	3300006804	Agricultural Soil	DAVIVTLIAIGVSALVGVLGYLIEKKGTQGGSER*
Ga0075425_1005152182	3300006854	Populus Rhizosphere	MVGWTDIVIVSLIAIGAVVLVGVLGYLIDKKGSEDQ*
Ga0068865_1004865683	3300006881	Miscanthus Rhizosphere	MVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAEDK*
Ga0073928_106295742	3300006893	Iron-Sulfur Acid Spring	MVGWTDIVIVSLIAIGSVVLVGILGYLIEKKGAQEGSEEK*
Ga0105240_103185403	3300009093	Corn Rhizosphere	MVADVLIVSLIAIGSVVLVGVLGYLIEKKGAEDK*
Ga0105240_105726352	3300009093	Corn Rhizosphere	MVGWTDVVIVSLISLGSVVLVGVLGYLIEKKGAEDK*
Ga0105240_108469391	3300009093	Corn Rhizosphere	MMVWTDVAMVVVLAIGAVVVVGVLGYLIEKKGTDN*
Ga0105245_104685582	3300009098	Miscanthus Rhizosphere	VVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAEDK*
Ga0105245_106493802	3300009098	Miscanthus Rhizosphere	MVGWTDVVIVSLIAIGSVVLVGVLGYLIEKNGAGDK*
Ga0105247_101988104	3300009101	Switchgrass Rhizosphere	LMVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGAQEGNEDR*
Ga0099792_111478162	3300009143	Vadose Zone Soil	MMAWTDIVIVVLLAIGAVVVVGVLGYLIEKKGAEDQ*
Ga0105242_129820261	3300009176	Miscanthus Rhizosphere	LILMVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAQEGKEDK*
Ga0105248_104339033	3300009177	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAQEGKEDK*
Ga0105248_122348181	3300009177	Switchgrass Rhizosphere	MAGWTDAVIVSLIAIGSVVLMGILGYLIEKKGAEDR*
Ga0105237_102077284	3300009545	Corn Rhizosphere	MVGWTDVVIVSLISLGAVVLVGVLGYLIDKKVAEDE*
Ga0105237_108034222	3300009545	Corn Rhizosphere	MMVWSDVAMVVVLAIGAVVVVGVLGYLIEKKGTDN*
Ga0105237_125671241	3300009545	Corn Rhizosphere	MAGWTDALIVTLIAIATVVLVGILGYLIEKKGTEDK*
Ga0105238_100270093	3300009551	Corn Rhizosphere	MVGWTEVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGNKDK*
Ga0105238_111065902	3300009551	Corn Rhizosphere	MAGWTDAVIVSLIAIGSVVVIGILGYLIEKKGAEDK*
Ga0126376_106117622	3300010359	Tropical Forest Soil	MVGWTDVVIVSLISLGSVVLVGVLGYLIDRKGTDE*
Ga0134128_105502854	3300010373	Terrestrial Soil	FRSLILMMGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGTGEGNQEGNKDK*
Ga0105239_130173622	3300010375	Corn Rhizosphere	MVGPADVVFVSLIAIGAVVLIGVLGYLIEKKGAREGNEDK*
Ga0136449_10000299727	3300010379	Peatlands Soil	MVGLTDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGNAGRERDK*
Ga0136449_1001292285	3300010379	Peatlands Soil	MFGLLDVVLVTLIAIGSVVLVGILGYLIEKKGADK*
Ga0136449_1027049422	3300010379	Peatlands Soil	MVGLTDIVIVSLLAVGSTVLVGILGYLIDKKATQEGNEDQ*
Ga0134124_126104202	3300010397	Terrestrial Soil	MVGLLDVVFVTLIAIGAAVLIGVLGYLIDKTGAEDR*
Ga0134127_105779502	3300010399	Terrestrial Soil	MVGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGTQEENQEGNKDK*
Ga0134122_102580202	3300010400	Terrestrial Soil	MAGWIDAIIVTLIAIGSDVVIGILGYLIEKKGAQEENGDR*
Ga0105246_117904162	3300011119	Miscanthus Rhizosphere	VVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAQEGKEDK*
Ga0150983_107967582	3300011120	Forest Soil	MVGPVDVLIVSLLAIGSVVLIGVLGYLVEKIGTHEGGQEGNQEGNKHK*
Ga0137382_111248072	3300012200	Vadose Zone Soil	MVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGAQEGSEDK*
Ga0150984_1041328542	3300012469	Avena Fatua Rhizosphere	MTSWTDAVIVSLLTVGAVVLIGVLGYLIEKKGTKDP*
Ga0153915_110437902	3300012931	Freshwater Wetlands	MVGWTDVVIVSLVAVGSVVLVGVLGYLIEKKGAEDK*
Ga0168317_10015139	3300012982	Weathered Mine Tailings	MVGLLDVVFVTLIAIGAAVLVGILGYLIDKTAEDK*
Ga0157374_104940002	3300013296	Miscanthus Rhizosphere	MMVWTDVAMVVLLAIGAVVVVGVLGYLIEKKGTDN*
Ga0157372_108207221	3300013307	Corn Rhizosphere	MVGWTDVFIVSLIAIGSVVVIGILGYLIEKKGAEDK*
Ga0163163_127364382	3300014325	Switchgrass Rhizosphere	MMGWTDVVIVSLLALGAVVLVGVLGYLIEKKGSEDK*
Ga0163161_108393992	3300017792	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGILGYLIEKKGAEDK
Ga0210403_101412133	3300020580	Soil	MVGLTDVVIVSLLAIGAVVLIGVLGYLIEKNGAEDK
Ga0210400_107724462	3300021170	Soil	MVGSTDILIVSLIAIGSVVLIGVLGYLIEKNGAQEGGEDK
Ga0210383_101304402	3300021407	Soil	MVGLKDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGKEDQ
Ga0209483_10022676	3300025862	Arctic Peat Soil	MVGPADIVFVTLIAIGAVVLVGVLGYLIDKKGTQEGDQEGSKDK
Ga0207642_101631682	3300025899	Miscanthus Rhizosphere	MAGWTDALIVTLIAIGTVVLVGILGYLIEKKGTEDK
Ga0207642_104270592	3300025899	Miscanthus Rhizosphere	MVGATDVLIVSLIAIGSVVLVGVLGYLIEKKGAEDK
Ga0207710_105638272	3300025900	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGAQEGNEDK
Ga0207685_101182112	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MVGPVDVVIVSLIAIGAVVLIGVLGYLIDKKGTQEGNNDK
Ga0207705_100868202	3300025909	Corn Rhizosphere	MVGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGKKDK
Ga0207654_100150586	3300025911	Corn Rhizosphere	MVGWTDVVIVSLIAIGSVVLIGVLGYLIDKTGAQEGNQEGNKDK
Ga0207654_111022352	3300025911	Corn Rhizosphere	MVGPIDILLVSLIAIGSVVLIGVLGYLIEKGTPEGNQEGNKDK
Ga0207707_114163992	3300025912	Corn Rhizosphere	MMVWSDVAMVVVLAIGAVVVVGVLGYLIEKKGTDN
Ga0207695_100503553	3300025913	Corn Rhizosphere	MVGPVDIVIVSLIAIGAVVLIGVLGYLIEKGTQEGNQEGNKDK
Ga0207662_108562482	3300025918	Switchgrass Rhizosphere	MAGWTDAVIVSLLALGAVVVIGVLGYLIEKKGAQEGNEDK
Ga0207652_107239182	3300025921	Corn Rhizosphere	MMVWTDVAMVVLLAIGAVVVVGVLGYLIEKKGTDN
Ga0207694_101113084	3300025924	Corn Rhizosphere	MMVWTDVAMVVVLAIGAVVVVGVLGYLIEKKGTDN
Ga0207687_100015079	3300025927	Miscanthus Rhizosphere	MVGWTDVLIVSLIAIGSVVLVGVLGFLIEKKGAEDR
Ga0207687_102545232	3300025927	Miscanthus Rhizosphere	MAGWTDAVIVSLLALGAVVVIGVLGYLIEKKGAKEGNEDK
Ga0207687_104750602	3300025927	Miscanthus Rhizosphere	MVGWTDVVIVSLIAIGSVVLVGVLGYLIEKNGAGDK
Ga0207687_112647642	3300025927	Miscanthus Rhizosphere	MAGWIDAIIVTLIAIGSVVVIGILGYLIEKKGAEDT
Ga0207686_106346722	3300025934	Miscanthus Rhizosphere	MMGWTDVVIVSLLALGAVVVVGVLGYLIEKKGSEDK
Ga0207709_109637562	3300025935	Miscanthus Rhizosphere	MAGWTDAVIVSLLALGAVVVIGVLGYLIEKKGAKEGNEDKT
Ga0207689_100302005	3300025942	Miscanthus Rhizosphere	MVGSTDVLIVSLIAVGSVVLVGLLGYLIEKKGAQEGNEDK
Ga0207689_101194952	3300025942	Miscanthus Rhizosphere	MVGWTDVLIVSLIAIGSVVVVGLLGFLIEKKGAEDR
Ga0207703_102634822	3300026035	Switchgrass Rhizosphere	MVGLLDVVFVTLLAIGAAVLIGVLGYLIDKTGADQ
Ga0209580_104220482	3300027842	Surface Soil	MVGSTDIVIVSLIAIGSVVLVGVLGYLIEKKGSQDGGEDK
Ga0209517_1000253428	3300027854	Peatlands Soil	MVGPVDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGNAGRERDK
Ga0209168_100466473	3300027986	Surface Soil	MVGLKDVVIVSLIAIGAVVLIGVLGYLIEKKGAQEGNEDK
Ga0268264_100471946	3300028381	Switchgrass Rhizosphere	MVGATDVLIVSLIAIGSVVLVGLLGYLIEKKGAQEGNEDR
Ga0265338_101467013	3300028800	Rhizosphere	MVGLLDVVFVTLLAIGAAVLIGVLGYLIDKTGAEDR
Ga0222749_101887692	3300029636	Soil	MVGPTDVLIVTLLAIGAAVLVGILGYLIEKKGTEDQ
Ga0222749_103035752	3300029636	Soil	MLLALIVSLIAIGAVVLVGVLGYLIEHGLKGAEDK
Ga0170834_1020038482	3300031057	Forest Soil	VGWTDVVIVSLIAVGSVVLVGILGYLIEKNGAEDK
Ga0170823_174295311	3300031128	Forest Soil	MVGPVDIVIVSLIAVGAVVLIGVLGYFMDKSGEERK
Ga0170818_1022498931	3300031474	Forest Soil	MVGWTDIVIVSLIAIGSVVLIGVLGYLIEKKGAQEGNK
Ga0170818_1043929052	3300031474	Forest Soil	MVGPIDVLIVSLLAIGAVVVIGILGYLIEKKGTEDK
Ga0265313_100058532	3300031595	Rhizosphere	MVGLTDVVIVSLIAIGAVVLIGVLGYLIETKGAREGNEDK
Ga0310813_115710052	3300031716	Soil	MVGLADVVIVSLIAIGAVVLIGVLGYFMDKSGEERQ
Ga0307468_1019930931	3300031740	Hardwood Forest Soil	MVGPTDVVIVSLLAIGAVVLIGVLGYLIEKKGTEEGNEDK
Ga0308175_1001654953	3300031938	Soil	MVGWTDVAIVSLIAVASVVLVGVLGYLIDKTGGQMDDGAEEDRR
Ga0310909_115158711	3300031947	Soil	MAGWTDAVIVTLIAIGSTVLIGVLGYLIEKSSDETG
Ga0311301_103145632	3300032160	Peatlands Soil	MFGLLDVVLVTLIAIGSVVLVGILGYLIEKKGADK
Ga0311301_128349822	3300032160	Peatlands Soil	MVGLTDIVIVSLLAVGSTVLVGILGYLIDKKATQEGNEDQ
Ga0310810_100695343	3300033412	Soil	MVGFTDVVIVSLIALGAVVLVGVLGYLIEKGTQEGNQDK
Ga0316628_1040174572	3300033513	Soil	MVGLLDVVFVTLIAISAAVLVGILGYLIDKTGAEDK
Ga0326723_0605906_193_315	3300034090	Peat Soil	MVGWTDVVIVSLIAIGSVVLVGILGYLIEKKGAQEGNEDK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign