Metagenome / Metatranscriptome Family F077829

Overview

Basic Information

• Family ID: F077829
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 117
• Average Sequence Length: 40 residues
• Representative Sequence: MLDPETERKNLLWGWGLFVLFCLIAAGTVAIAFIYLAVD
• Number of Associated Samples: 90
• Number of Associated Scaffolds: 117

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 59.83 %
• % of genes near scaffold ends (potentially truncated): 12.82 %
• % of genes from short scaffolds (< 2000 bps): 92.31 %
• Associated GOLD sequencing projects: 85
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (58.974 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.256 % of family members)
• Environment Ontology (ENVO): Unclassified (32.479 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (49.573 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.24%
  β-sheet: 0.00%
  Coil/Unstructured: 47.76%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF01040	UbiA	38.46
PF01425	Amidase	37.61
PF00115	COX1	1.71
PF14257	DUF4349	0.85
PF12848	ABC_tran_Xtn	0.85
PF13412	HTH_24	0.85
PF05751	FixH	0.85
PF01850	PIN	0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	37.61
COG5456	Nitrogen fixation protein FixH	Inorganic ion transport and metabolism [P]	0.85

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.97 %
Unclassified	root	N/A	41.03 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.97 %
Unclassified	root	N/A	41.03 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.97 %
Unclassified	root	N/A	41.03 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	22.22 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.56 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	22.22 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.71 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	19.66 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.71 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.85 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	17.95 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	1.71 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.85 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.85 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	17.95 %
unclassified Propionibacteriales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales	1.71 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.85 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.85 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.03 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	17.95 %
Propionibacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium	1.71 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.85 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.85 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000364|INPhiseqgaiiFebDRAFT_101248238	Not Available	505
3300000955|JGI1027J12803_106522900	All Organisms → cellular organisms → Bacteria	657
3300000956|JGI10216J12902_101412811	All Organisms → cellular organisms → Bacteria	964
3300000956|JGI10216J12902_125316015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	624
3300002568|C688J35102_117982153	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	520
3300003995|Ga0055438_10180267	Not Available	636
3300004114|Ga0062593_100096094	All Organisms → cellular organisms → Bacteria	2069
3300004114|Ga0062593_100369537	All Organisms → cellular organisms → Bacteria	1265
3300004114|Ga0062593_100595409	All Organisms → cellular organisms → Bacteria	1053
3300004114|Ga0062593_101871392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	662
3300004156|Ga0062589_100529538	All Organisms → cellular organisms → Bacteria	1002
3300004156|Ga0062589_100933110	Not Available	803
3300004157|Ga0062590_101506371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	675
3300004463|Ga0063356_101466655	Not Available	1008
3300004463|Ga0063356_102070698	All Organisms → cellular organisms → Bacteria	863
3300004643|Ga0062591_102761475	Not Available	520
3300005093|Ga0062594_100896457	All Organisms → cellular organisms → Bacteria	837
3300005093|Ga0062594_102352816	Not Available	581
3300005162|Ga0066814_10053919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	669
3300005329|Ga0070683_101061133	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	778
3300005332|Ga0066388_102663148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	912
3300005337|Ga0070682_100152222	All Organisms → cellular organisms → Bacteria	1588
3300005343|Ga0070687_101442956	Not Available	516
3300005365|Ga0070688_101411114	Not Available	565
3300005441|Ga0070700_101913052	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	513
3300005445|Ga0070708_100962324	All Organisms → cellular organisms → Bacteria	801
3300005455|Ga0070663_101580885	All Organisms → cellular organisms → Bacteria	584
3300005529|Ga0070741_10008409	All Organisms → cellular organisms → Bacteria	20720
3300005529|Ga0070741_10336893	All Organisms → cellular organisms → Bacteria	1404
3300005578|Ga0068854_101256300	Not Available	665
3300005719|Ga0068861_102478441	All Organisms → cellular organisms → Bacteria → Proteobacteria	522
3300005764|Ga0066903_100603428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium	1903
3300005764|Ga0066903_102871894	Not Available	934
3300005764|Ga0066903_104567617	Not Available	738
3300005873|Ga0075287_1013215	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	997
3300005937|Ga0081455_10147222	All Organisms → cellular organisms → Bacteria	1820
3300006163|Ga0070715_10740862	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	591
3300006581|Ga0074048_10062192	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	560
3300006581|Ga0074048_12470417	Not Available	609
3300006581|Ga0074048_12879430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	597
3300006755|Ga0079222_10191507	Not Available	1218
3300006852|Ga0075433_10335867	All Organisms → cellular organisms → Bacteria	1336
3300006903|Ga0075426_10793969	All Organisms → cellular organisms → Bacteria	712
3300009098|Ga0105245_11428879	Not Available	742
3300009098|Ga0105245_11608395	Not Available	701
3300009098|Ga0105245_11900939	All Organisms → cellular organisms → Bacteria	648
3300009137|Ga0066709_100928949	Not Available	1270
3300009137|Ga0066709_103096169	Not Available	608
3300009174|Ga0105241_10612190	Not Available	985
3300010362|Ga0126377_10243024	All Organisms → cellular organisms → Bacteria	1749
3300010362|Ga0126377_12653151	Not Available	576
3300010371|Ga0134125_10163872	All Organisms → cellular organisms → Bacteria	2478
3300010396|Ga0134126_10155390	All Organisms → cellular organisms → Bacteria	2769
3300010403|Ga0134123_12276855	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	605
3300012189|Ga0137388_11218494	All Organisms → cellular organisms → Bacteria	690
3300012204|Ga0137374_10490247	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	956
3300012212|Ga0150985_112753275	Not Available	593
3300012358|Ga0137368_10543087	All Organisms → cellular organisms → Bacteria	744
3300012469|Ga0150984_122665067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	700
3300012899|Ga0157299_10312131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	525
3300012955|Ga0164298_10422632	Not Available	868
3300012955|Ga0164298_10580848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	765
3300012960|Ga0164301_11713563	Not Available	525
3300012971|Ga0126369_12880439	Not Available	563
3300012989|Ga0164305_10765769	All Organisms → cellular organisms → Bacteria	797
3300013297|Ga0157378_13139928	Not Available	513
3300014326|Ga0157380_12221657	Not Available	613
3300014745|Ga0157377_10667228	Not Available	750
3300014968|Ga0157379_10317310	All Organisms → cellular organisms → Bacteria	1422
3300014968|Ga0157379_11742849	Not Available	611
3300014969|Ga0157376_10109883	Not Available	2425
3300015371|Ga0132258_12033825	All Organisms → cellular organisms → Bacteria	1445
3300015371|Ga0132258_12433852	All Organisms → cellular organisms → Bacteria	1311
3300015372|Ga0132256_101083024	Not Available	916
3300015372|Ga0132256_102370171	All Organisms → cellular organisms → Bacteria	634
3300017792|Ga0163161_11377580	All Organisms → cellular organisms → Bacteria	615
3300017792|Ga0163161_11658382	Not Available	565
3300017944|Ga0187786_10067308	All Organisms → cellular organisms → Bacteria	1126
3300017944|Ga0187786_10530506	Not Available	540
3300017966|Ga0187776_10893548	Not Available	645
3300017974|Ga0187777_10026923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium	3678
3300017974|Ga0187777_10895542	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	638
3300019361|Ga0173482_10112819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1005
3300019361|Ga0173482_10247547	Not Available	757
3300019361|Ga0173482_10291046	All Organisms → cellular organisms → Bacteria	714
3300019362|Ga0173479_10218777	Not Available	816
3300022756|Ga0222622_10257276	All Organisms → cellular organisms → Bacteria	1185
3300023077|Ga0247802_1056611	Not Available	628
3300024232|Ga0247664_1004819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3070
3300024245|Ga0247677_1073181	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	508
3300024325|Ga0247678_1056691	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	638
3300024331|Ga0247668_1047001	Not Available	879
3300025901|Ga0207688_10099866	Not Available	1675
3300025908|Ga0207643_10545583	Not Available	744
3300025922|Ga0207646_11145401	Not Available	683
3300025927|Ga0207687_10424756	All Organisms → cellular organisms → Bacteria	1097
3300025927|Ga0207687_11367256	Not Available	609
3300025933|Ga0207706_11011873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	698
3300025961|Ga0207712_11997295	Not Available	519
3300026035|Ga0207703_11664663	Not Available	614
3300026067|Ga0207678_10032549	All Organisms → cellular organisms → Bacteria	4544
3300026078|Ga0207702_10343968	All Organisms → cellular organisms → Bacteria	1425
3300026118|Ga0207675_101826327	All Organisms → cellular organisms → Bacteria	627
3300027787|Ga0209074_10254996	Not Available	683
3300027821|Ga0209811_10094190	All Organisms → cellular organisms → Bacteria	1070
3300028381|Ga0268264_10730853	All Organisms → cellular organisms → Bacteria	985
3300028587|Ga0247828_11031305	Not Available	540
3300028589|Ga0247818_11086181	Not Available	568
3300028796|Ga0307287_10320997	All Organisms → cellular organisms → Bacteria	585
3300030336|Ga0247826_10685560	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	794
3300030336|Ga0247826_11016785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	659
3300031716|Ga0310813_11155103	Not Available	712
3300031965|Ga0326597_11879981	Not Available	558
3300032013|Ga0310906_10788873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	670
3300032180|Ga0307471_101290147	All Organisms → cellular organisms → Bacteria	893
3300032770|Ga0335085_10127896	All Organisms → cellular organisms → Bacteria	3229
3300033551|Ga0247830_11407325	Not Available	557

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.38%
Host-Associated	Host-Associated	31.62%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	66.67%
Plants	Host-Associated → Plants	31.62%
Aquatic	Environmental → Aquatic	1.71%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.95%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.68%
Marine	Environmental → Aquatic → Marine	0.85%
Sediment	Environmental → Aquatic → Sediment	0.85%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	49.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.82%
Loam	Environmental → Terrestrial → Soil → Loam	11.11%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.11%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.98%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.56%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.85%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	11.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.11%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.84%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.98%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.13%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.27%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.56%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.85%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	8.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.13%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.42%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.56%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.71%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.71%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.71%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.71%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.71%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.71%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.85%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.85%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.85%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.85%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300003995	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005162	Soil and rhizosphere microbial communities from Laval, Canada - mgLAB	Environmental
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005873	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301	Environmental
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental
3300024232	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05	Environmental
3300024245	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18	Environmental
3300024325	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19	Environmental
3300024331	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09	Environmental
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1012482381	3300000364	Soil	MLDPEIERKNXLWAWGLFVVFCLIAAGTIAIGFIYLAVD*
JGI1027J12803_1065229001	3300000955	Soil	KETEHKNMLWGWGLFVLFCLIAAGTFAVAFIYLAVD*
JGI10216J12902_1014128112	3300000956	Soil	MLDPETERKNMLWAWGLLVVFCLIAAGAFAIGFIYLAVD*
JGI10216J12902_1253160152	3300000956	Soil	MLDPETERKNMLWGWGMFVLFLLLFAGTAAVAFIYLAVD*
C688J35102_1179821531	3300002568	Soil	MLERETERRNMLWGWGLFVLFLLIAAGTVAIAFIYLSVD*
Ga0055438_101802672	3300003995	Natural And Restored Wetlands	MLDAETERKNMLLGWGLFVLFVLIAAGTVAIAFIYLGVD*
Ga0062593_1000960942	3300004114	Soil	MLDPETERKNLLWGWGLFVLFCLIAAGTIAIGFIYLAVD*
Ga0062593_1003695372	3300004114	Soil	MLDKETEHKNMLWGWGLFVLFCLIGAGTVAVAFIYLAVD*
Ga0062593_1005954092	3300004114	Soil	MPDPETEHKNLLWGWGLFVLFCLLAAGTLAIAFIYLAVD*
Ga0062593_1018713922	3300004114	Soil	MLDRETERKNMLWGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0062589_1005295382	3300004156	Soil	MPDPETEHKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD*
Ga0062589_1009331102	3300004156	Soil	MLEPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0062590_1015063712	3300004157	Soil	MLDPEIERKNLLWGWGLFVLFCLIAAGTFAIAFIYLAVD*
Ga0063356_1014666551	3300004463	Arabidopsis Thaliana Rhizosphere	MLDPEIERKNVLWGWGLFVVFCLIAAGTIAIGFIYLAVD*
Ga0063356_1020706982	3300004463	Arabidopsis Thaliana Rhizosphere	MLDPEIERKNLLWGWGLFVFFCLIAAGTFAIAFIYLAVD*
Ga0062591_1027614752	3300004643	Soil	MLDPETEHRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0062594_1008964572	3300005093	Soil	MLDPETERKNMLWGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0062594_1023528162	3300005093	Soil	MLDHEVERRNLVLGWGLFVLFCLLAAGTFAVAFIYLAVD*
Ga0066814_100539192	3300005162	Soil	MLDPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0070683_1010611331	3300005329	Corn Rhizosphere	MLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD*
Ga0066388_1026631482	3300005332	Tropical Forest Soil	VNLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD*
Ga0070682_1001522221	3300005337	Corn Rhizosphere	MLDPETERRNLLWGWGLFVLFCLLALGTFAIAFIYLAVD*
Ga0070687_1014429561	3300005343	Switchgrass Rhizosphere	MLDHEVERRNLVLGWGLFVLFCLLAASTFAVAFIYLAVD*
Ga0070688_1014111142	3300005365	Switchgrass Rhizosphere	MLDPGTERRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0070700_1019130522	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MLDKETERKNLLWGWGLFVLFVLIAAGTMAVAFIYLSLD*
Ga0070708_1009623242	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MLDPETERKNLLWGWGLFVLFLLLFAGTAAVAFIYLAVD*
Ga0070663_1015808852	3300005455	Corn Rhizosphere	MLDPETERKNMLWGWGLFVLFCLIGAGTVAIAFIYLAVD*
Ga0070741_100084093	3300005529	Surface Soil	MLDPETERRNLLWGWGLFVFALLLAAGTVAIAFIYLAVD*
Ga0070741_103368932	3300005529	Surface Soil	MLDPETERKNLLLGWGLFVLFCLLAAGTVAIAFIYLAVD*
Ga0068854_1012563001	3300005578	Corn Rhizosphere	PETEHKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD*
Ga0068861_1024784412	3300005719	Switchgrass Rhizosphere	MLDPETERKNLLWGWGLFVLFCLLALGTFAIAFIYLAVD*
Ga0066903_1006034283	3300005764	Tropical Forest Soil	PPEIERKNTLWAWGLFVVFCLIAAGTIAIGFIYLAVD*
Ga0066903_1028718942	3300005764	Tropical Forest Soil	MLPPEIERKNTLWAWGLFVVFCLIAAGTIAIGFIYLAVD*
Ga0066903_1045676171	3300005764	Tropical Forest Soil	MLDPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLSVD*
Ga0075287_10132152	3300005873	Rice Paddy Soil	VLDPETERKNLLWGWGLFVLFVLIAAGTVAIAFIYLAVD*
Ga0081455_101472222	3300005937	Tabebuia Heterophylla Rhizosphere	MLDPEIERKNMLWAWGLFVVFCLIAAGTIAIGFIYLAVD*
Ga0070715_107408622	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MLDPETERRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0074048_100621921	3300006581	Soil	MLDPEIERKNLLWGWGLFVLFCLIAAGTFAIAFVYLAVD*
Ga0074048_124704172	3300006581	Soil	MLGPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0074048_128794302	3300006581	Soil	VLDKETERKNMLWGWGLFVLFCLIGAGTVAVAFIYLAVA*
Ga0079222_101915072	3300006755	Agricultural Soil	MLDPETERKNMLWGWTLFAIFVLIAAGTLAVAFIYLAVD*
Ga0075433_103358672	3300006852	Populus Rhizosphere	MLDPEIERKNMLWAWGLFVVFCLIAAGTLAIGFIYLAVD*
Ga0075426_107939692	3300006903	Populus Rhizosphere	MLDSETERKNLLWGWGLFVLFCLLALGTFAIAFIYLAVD*
Ga0105245_114288792	3300009098	Miscanthus Rhizosphere	MLDPETERKNLLWGWGLVVLFCLLALGTFAIAFIYLAVD*
Ga0105245_116083952	3300009098	Miscanthus Rhizosphere	VLDKETEHKNMLWGWGLFVLFCLIGAGTVAVAFIYLAVD*
Ga0105245_119009392	3300009098	Miscanthus Rhizosphere	MLDPETERKNMLWGWGLFVLFCLIAAGTIAIAFIYLAVD*
Ga0066709_1009289492	3300009137	Grasslands Soil	MTEHEIEQKNLALAWGLVVLFLLLMAGTVAVAFIYLAAD*
Ga0066709_1030961692	3300009137	Grasslands Soil	MTEHDRELERRNLALAWGLVVLFLLLFGGTIAVAFIYLAVD*
Ga0105241_106121902	3300009174	Corn Rhizosphere	MPDPETKHKNLLWGWGLFVLFCLLAAGTFAVAFIYLAVD*
Ga0126377_102430242	3300010362	Tropical Forest Soil	MLDPETERKNLLWGWGIFVLFCVLALGTFAIAFIYLAVD*
Ga0126377_126531512	3300010362	Tropical Forest Soil	VILDPETERKNLLWGWGIFVLFCLLAAGTFAIAFIYLAVD*
Ga0134125_101638722	3300010371	Terrestrial Soil	MLEPETERKNMLWGWGLFVLFLLIAAGTFAIAFIYLAVD*
Ga0134126_101553903	3300010396	Terrestrial Soil	MLDHEVERRNLVLGWGLFVLFCLIAAGTFAVAFIYLAVD*
Ga0134123_122768552	3300010403	Terrestrial Soil	PETEHRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0137388_112184942	3300012189	Vadose Zone Soil	MLDPETERKNLLWGWGLFVLFLFLFAGTAAVAFIYLAVD*
Ga0137374_104902472	3300012204	Vadose Zone Soil	MLDPETERKNMLLGWGLFVVFALIAAGTIAVAFIYLAVD*
Ga0150985_1127532752	3300012212	Avena Fatua Rhizosphere	MLERETERRNMLWGWGLFVFFLLIAAGTVAIAFIYLAVD*
Ga0137368_105430872	3300012358	Vadose Zone Soil	MLDPETERKNMLLGWGLFVVFALIAAGTIAIAFIYLAVD*
Ga0150984_1226650672	3300012469	Avena Fatua Rhizosphere	MLDKETERKNMLWGWGLFVLFCLIAAGTFAIAFIYLAVD*
Ga0157299_103121312	3300012899	Soil	MLDKETEHKNMLWGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0164298_104226322	3300012955	Soil	MLDPETERRNLLWGWGLFVLFCLLSLGTFAIAFIYLAVD*
Ga0164298_105808481	3300012955	Soil	RADLRLRSDRRGGLMLDPETERRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0164301_117135632	3300012960	Soil	MLDKETEHKHMLWGWGLFVLFCLIGAGTVAVAFIYLAVD*
Ga0126369_128804392	3300012971	Tropical Forest Soil	MLDPETERKNLLLGWGLFVLFCLIAAGTLAIGFIYLAVD*
Ga0164305_107657692	3300012989	Soil	ETERRNLLWGWGLFVLFCLLALGTFAIAFIYLAVD*
Ga0157378_131399282	3300013297	Miscanthus Rhizosphere	RSDRRGGLMLDPETEHRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD*
Ga0157380_122216572	3300014326	Switchgrass Rhizosphere	MLDPKTERRNMLLGWGLFVLFCLIGAGTVAIAFIYLAVD*
Ga0157377_106672281	3300014745	Miscanthus Rhizosphere	MLDPETERRNLLWGWGLFVLFCLLAAGTLAIAFIYLAVD*
Ga0157379_103173103	3300014968	Switchgrass Rhizosphere	DLPLRRTGRGGLMLDPETERKNMLWGWGLFVLFCLIGAGTVAIAFIYLAVD*
Ga0157379_117428491	3300014968	Switchgrass Rhizosphere	MPDPETERKNLLWGWGLVVLFCLLALGTFAIAFIYLAVD*
Ga0157376_101098833	3300014969	Miscanthus Rhizosphere	MLDHEVERRNLVLGWGLFVLFYLLAAGTFAVAFIYLAVD*
Ga0132258_120338252	3300015371	Arabidopsis Rhizosphere	MLDPETERKNLLWAWGLFVVFCLIAAATIAIGFIYLAVD*
Ga0132258_124338522	3300015371	Arabidopsis Rhizosphere	MLDPETEHKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD*
Ga0132256_1010830241	3300015372	Arabidopsis Rhizosphere	MLDPETEHKNLLWGWGLFVLFCLLALGTFAIAFVYLAVD*
Ga0132256_1023701712	3300015372	Arabidopsis Rhizosphere	MERKNILWGWLLFLFFLVLLGGTVAVAFIYDAVLP*
Ga0163161_113775802	3300017792	Switchgrass Rhizosphere	MPDPETEHKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD
Ga0163161_116583821	3300017792	Switchgrass Rhizosphere	LRLRSDRRGGLMLEPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0187786_100673082	3300017944	Tropical Peatland	MLDAETERKNMLLGWGLFVLFVLIAAGTVAIAFIYLSVD
Ga0187786_105305061	3300017944	Tropical Peatland	MPHSEIERKNLLWAWGLFIVFCLIAAGTIAIGFIYLAVD
Ga0187776_108935482	3300017966	Tropical Peatland	MLDPEIERKNLLWAWGLFVVFCLIAAGTIAIAFIYLAVD
Ga0187777_100269232	3300017974	Tropical Peatland	VHVDPETHRKNMLLGWGLFVLFVLIAAGTFAIAFIYLSVD
Ga0187777_108955421	3300017974	Tropical Peatland	MDPEIERKNLLWAWGLFVVFCLIAAGTIAIGFIYLAVD
Ga0173482_101128192	3300019361	Soil	MLDPETEHRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0173482_102475471	3300019361	Soil	MLDPGTERRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0173482_102910462	3300019361	Soil	MLDKETEHKNMLWGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0173479_102187772	3300019362	Soil	MLDPETERRNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0222622_102572762	3300022756	Groundwater Sediment	MLDPGTERKNLLWGWGLFVLFCLIAAGTFAIAFIYLAVD
Ga0247802_10566112	3300023077	Soil	MLEPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0247664_10048192	3300024232	Soil	MLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD
Ga0247677_10731812	3300024245	Soil	VMLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD
Ga0247678_10566912	3300024325	Soil	GRGRVMLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD
Ga0247668_10470012	3300024331	Soil	MLDPETERKNLLWGWGLFVLFCLIAAGTLAIGFIYL
Ga0207688_100998663	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MLDHEVERRNLVLGWGLFVLFCLLAAGTFAVAFIYLAVD
Ga0207643_105455832	3300025908	Miscanthus Rhizosphere	VLDKETERKNLLWGWGLFVLFVLIAAGTMAVAFIYLSLD
Ga0207646_111454012	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MLDPETERKNLLWGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0207687_104247562	3300025927	Miscanthus Rhizosphere	MLDKENERKNLLWGWGLFVLFVLIAAGTMAVAFIYLSLD
Ga0207687_113672561	3300025927	Miscanthus Rhizosphere	MLDPETERKNMLLGWGLFVLFCLIAAGTAAVAFIYLAVD
Ga0207706_110118732	3300025933	Corn Rhizosphere	VMLDPETERKNLLWGWGLFVLFCLLALGTFAIAFIYLAVD
Ga0207712_119972952	3300025961	Switchgrass Rhizosphere	LMLEPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0207703_116646632	3300026035	Switchgrass Rhizosphere	MLDPETERRNMLLGWGLFVLFCLIAAGTVAIAFMYLAVD
Ga0207678_100325496	3300026067	Corn Rhizosphere	MLDPETERRNLLWGWGLFVLFCLIAAGTLAIGFIYLAVD
Ga0207702_103439682	3300026078	Corn Rhizosphere	MLDPETEHKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD
Ga0207675_1018263272	3300026118	Switchgrass Rhizosphere	MPDPETEHKNLLWGWGLFVLFCLLAAGTLAIAFIYLAVD
Ga0209074_102549962	3300027787	Agricultural Soil	MLDPETERKNMLWGWTLFAIFVLIAAGTLAVAFIYLAVD
Ga0209811_100941902	3300027821	Surface Soil	MLDPETERKNMLLGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0268264_107308532	3300028381	Switchgrass Rhizosphere	MLDPETERKNLLWGWGLFVLFCLLAAGTFAIAFIYLAVD
Ga0247828_110313051	3300028587	Soil	MLDPETERKNLLWGWGLFVLFCLLALGTFAIAFVSLAVD
Ga0247818_110861812	3300028589	Soil	MLDPETERKNMLLGWGLFVFFCLIAAGTVAIAFIYLAVD
Ga0307287_103209972	3300028796	Soil	MLDPETERKNMLWGWGLFVLFLLLFAGTAAVAFIYLAVD
Ga0247826_106855601	3300030336	Soil	CRRRHLMLDPETERKNLLWAWGLFVVFCLIAAGTIAIGFIYLAVD
Ga0247826_110167852	3300030336	Soil	MLDPETERKNMLWGWGLFVLFCLIAAGTVAIAFIYLAVD
Ga0310813_111551032	3300031716	Soil	VLDKETERKNMLWGWGLFVVFCLIAAGTIAVAFIYLSVD
Ga0326597_118799812	3300031965	Soil	MLDRETERRNLALGWGLFALFVVLAAGTFAIAFIYLAAD
Ga0310906_107888732	3300032013	Soil	MLDPETERKNLLWAWGLFVVFCLIAAGTIAIGFIYLAVD
Ga0307471_1012901472	3300032180	Hardwood Forest Soil	MPDPETERKNLLWGWGVFVLFLLLLAGSVAVAFIYLAVD
Ga0335085_101278962	3300032770	Soil	VHVDPETHRKNMLLGWGLFVLFVLIAAGTVAIAFIYLSVD
Ga0247830_114073252	3300033551	Soil	MLDPETERKNLLWGWGLFVLFCLLALGTFAIAFIYLAVD