| Basic Information | |
|---|---|
| Family ID | F077796 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MENQIPCDNCDWLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 65.81 % |
| % of genes near scaffold ends (potentially truncated) | 26.50 % |
| % of genes from short scaffolds (< 2000 bps) | 89.74 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.214 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 13.89% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF12236 | Head-tail_con | 0.85 |
| PF01041 | DegT_DnrJ_EryC1 | 0.85 |
| PF00145 | DNA_methylase | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.85 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.85 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.85 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.85 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.85 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.47 % |
| Unclassified | root | N/A | 14.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10140911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 905 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10148544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 864 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10269804 | Not Available | 524 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10223527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 513 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10094961 | Not Available | 1140 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10051108 | All Organisms → Viruses | 1823 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10166874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 709 | Open in IMG/M |
| 3300000947|BBAY92_10088474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 827 | Open in IMG/M |
| 3300001450|JGI24006J15134_10059673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1514 | Open in IMG/M |
| 3300001450|JGI24006J15134_10208977 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300001460|JGI24003J15210_10056578 | Not Available | 1283 | Open in IMG/M |
| 3300001472|JGI24004J15324_10045495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1334 | Open in IMG/M |
| 3300001472|JGI24004J15324_10095586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 774 | Open in IMG/M |
| 3300001472|JGI24004J15324_10095621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 773 | Open in IMG/M |
| 3300002483|JGI25132J35274_1079854 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004448|Ga0065861_1177166 | Not Available | 741 | Open in IMG/M |
| 3300004457|Ga0066224_1023125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 509 | Open in IMG/M |
| 3300004460|Ga0066222_1098678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 589 | Open in IMG/M |
| 3300005239|Ga0073579_1385821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 681 | Open in IMG/M |
| 3300005912|Ga0075109_1176294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 681 | Open in IMG/M |
| 3300006026|Ga0075478_10224716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
| 3300006164|Ga0075441_10090109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1182 | Open in IMG/M |
| 3300006735|Ga0098038_1046458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1579 | Open in IMG/M |
| 3300006735|Ga0098038_1166172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 728 | Open in IMG/M |
| 3300006738|Ga0098035_1147479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 801 | Open in IMG/M |
| 3300006750|Ga0098058_1173800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 565 | Open in IMG/M |
| 3300006754|Ga0098044_1072307 | Not Available | 1439 | Open in IMG/M |
| 3300006754|Ga0098044_1078915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1367 | Open in IMG/M |
| 3300006810|Ga0070754_10417211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 586 | Open in IMG/M |
| 3300006916|Ga0070750_10005204 | Not Available | 7068 | Open in IMG/M |
| 3300006919|Ga0070746_10315976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 714 | Open in IMG/M |
| 3300006920|Ga0070748_1274321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 603 | Open in IMG/M |
| 3300006924|Ga0098051_1048367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1180 | Open in IMG/M |
| 3300006928|Ga0098041_1031288 | Not Available | 1734 | Open in IMG/M |
| 3300006929|Ga0098036_1007586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3602 | Open in IMG/M |
| 3300006929|Ga0098036_1220144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 575 | Open in IMG/M |
| 3300006929|Ga0098036_1226900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 566 | Open in IMG/M |
| 3300006929|Ga0098036_1265771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 518 | Open in IMG/M |
| 3300006990|Ga0098046_1046138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1028 | Open in IMG/M |
| 3300007074|Ga0075110_1038608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1181 | Open in IMG/M |
| 3300007276|Ga0070747_1081222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C165 | 1209 | Open in IMG/M |
| 3300007345|Ga0070752_1296122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 618 | Open in IMG/M |
| 3300007346|Ga0070753_1226794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 684 | Open in IMG/M |
| 3300007539|Ga0099849_1098854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1165 | Open in IMG/M |
| 3300009423|Ga0115548_1114444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
| 3300009512|Ga0115003_10603240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 640 | Open in IMG/M |
| 3300010153|Ga0098059_1049488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 1691 | Open in IMG/M |
| 3300010155|Ga0098047_10195112 | Not Available | 777 | Open in IMG/M |
| 3300010368|Ga0129324_10238891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 727 | Open in IMG/M |
| 3300011258|Ga0151677_1026705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 568 | Open in IMG/M |
| 3300012920|Ga0160423_10098116 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300012953|Ga0163179_10941025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 750 | Open in IMG/M |
| 3300017706|Ga0181377_1058725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 719 | Open in IMG/M |
| 3300017719|Ga0181390_1023247 | Not Available | 2003 | Open in IMG/M |
| 3300017721|Ga0181373_1083367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 569 | Open in IMG/M |
| 3300017729|Ga0181396_1123632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 533 | Open in IMG/M |
| 3300017731|Ga0181416_1050095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 984 | Open in IMG/M |
| 3300017732|Ga0181415_1096777 | Not Available | 665 | Open in IMG/M |
| 3300017738|Ga0181428_1146265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 553 | Open in IMG/M |
| 3300017739|Ga0181433_1119744 | Not Available | 631 | Open in IMG/M |
| 3300017740|Ga0181418_1033737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1303 | Open in IMG/M |
| 3300017746|Ga0181389_1169035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 575 | Open in IMG/M |
| 3300017755|Ga0181411_1204831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 553 | Open in IMG/M |
| 3300017756|Ga0181382_1061074 | Not Available | 1069 | Open in IMG/M |
| 3300017758|Ga0181409_1163191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 649 | Open in IMG/M |
| 3300017764|Ga0181385_1082042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 991 | Open in IMG/M |
| 3300017764|Ga0181385_1186194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 627 | Open in IMG/M |
| 3300017765|Ga0181413_1256051 | Not Available | 515 | Open in IMG/M |
| 3300017772|Ga0181430_1075645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 1020 | Open in IMG/M |
| 3300017773|Ga0181386_1149228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 715 | Open in IMG/M |
| 3300017773|Ga0181386_1170812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 660 | Open in IMG/M |
| 3300017781|Ga0181423_1140102 | All Organisms → Viruses → environmental samples → uncultured marine virus | 935 | Open in IMG/M |
| 3300017781|Ga0181423_1160895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 862 | Open in IMG/M |
| 3300017986|Ga0181569_10347012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1022 | Open in IMG/M |
| 3300019725|Ga0193980_1058853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 529 | Open in IMG/M |
| 3300019751|Ga0194029_1015930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1117 | Open in IMG/M |
| 3300019751|Ga0194029_1087468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| 3300021365|Ga0206123_10335985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 635 | Open in IMG/M |
| 3300021371|Ga0213863_10062139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1891 | Open in IMG/M |
| 3300021375|Ga0213869_10023187 | All Organisms → Viruses → Predicted Viral | 3475 | Open in IMG/M |
| 3300021375|Ga0213869_10049557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2192 | Open in IMG/M |
| 3300021378|Ga0213861_10051274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2649 | Open in IMG/M |
| 3300021958|Ga0222718_10406114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 679 | Open in IMG/M |
| 3300021961|Ga0222714_10050645 | Not Available | 2880 | Open in IMG/M |
| 3300022065|Ga0212024_1003781 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300022071|Ga0212028_1066495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 674 | Open in IMG/M |
| 3300022074|Ga0224906_1107007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 820 | Open in IMG/M |
| 3300022074|Ga0224906_1151798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 654 | Open in IMG/M |
| 3300022821|Ga0222673_1004495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 3255 | Open in IMG/M |
| 3300022837|Ga0222711_1027633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 717 | Open in IMG/M |
| 3300022867|Ga0222629_1020237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1019 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10162981 | Not Available | 1093 | Open in IMG/M |
| 3300025048|Ga0207905_1020312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1108 | Open in IMG/M |
| 3300025086|Ga0208157_1023311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1854 | Open in IMG/M |
| 3300025086|Ga0208157_1122309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 603 | Open in IMG/M |
| 3300025108|Ga0208793_1041749 | Not Available | 1458 | Open in IMG/M |
| 3300025110|Ga0208158_1146062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 538 | Open in IMG/M |
| 3300025114|Ga0208433_1150036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 548 | Open in IMG/M |
| 3300025118|Ga0208790_1049225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 1329 | Open in IMG/M |
| 3300025120|Ga0209535_1093029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1103 | Open in IMG/M |
| 3300025120|Ga0209535_1159559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 696 | Open in IMG/M |
| 3300025127|Ga0209348_1043082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1557 | Open in IMG/M |
| 3300025133|Ga0208299_1027435 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300025137|Ga0209336_10001965 | Not Available | 9849 | Open in IMG/M |
| 3300025138|Ga0209634_1080788 | All Organisms → Viruses | 1494 | Open in IMG/M |
| 3300025151|Ga0209645_1141995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 746 | Open in IMG/M |
| 3300025168|Ga0209337_1271942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 634 | Open in IMG/M |
| 3300025543|Ga0208303_1027075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1560 | Open in IMG/M |
| 3300025632|Ga0209194_1070750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 942 | Open in IMG/M |
| 3300025806|Ga0208545_1017174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2509 | Open in IMG/M |
| 3300025853|Ga0208645_1235088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
| 3300027917|Ga0209536_102840823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 563 | Open in IMG/M |
| 3300028125|Ga0256368_1092781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 508 | Open in IMG/M |
| 3300029309|Ga0183683_1025136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1129 | Open in IMG/M |
| 3300029448|Ga0183755_1026714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1779 | Open in IMG/M |
| 3300031519|Ga0307488_10299581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1036 | Open in IMG/M |
| 3300033742|Ga0314858_014885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C165 | 1636 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.19% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.97% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.56% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.71% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.71% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.71% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.85% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.85% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.85% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.85% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019725 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_1-2_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101409111 | 3300000101 | Marine | NCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| DelMOSum2010_101485444 | 3300000101 | Marine | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE* |
| DelMOSum2010_102698041 | 3300000101 | Marine | MENQIPCDNCDWLENESELIETFDNQLLCSPCYIKKEFN |
| DelMOSum2011_102235272 | 3300000115 | Marine | MENQIPCDNCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| DelMOSpr2010_100949616 | 3300000116 | Marine | MENQIPCNNCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| DelMOWin2010_100511087 | 3300000117 | Marine | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTEREE* |
| DelMOWin2010_101668744 | 3300000117 | Marine | NKMENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTEREE* |
| BBAY92_100884744 | 3300000947 | Macroalgal Surface | MEYKIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFNTESEK* |
| JGI24006J15134_100596736 | 3300001450 | Marine | MENQIPCDNCNWLENESKLIETFDNELLCSPCYIKKEFDTENEKTND* |
| JGI24006J15134_102089771 | 3300001450 | Marine | MENQILCDKCDMLENESDLIETVDNQLLCSPCYIKKEFNTESEE* |
| JGI24003J15210_100565784 | 3300001460 | Marine | MKYQKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFETESGEE* |
| JGI24004J15324_100454954 | 3300001472 | Marine | MENQIPCDNCNWLENESKLIETFDNELLCSPCYIKKEFDTENEEAND* |
| JGI24004J15324_100955863 | 3300001472 | Marine | MKYQKYQILCDKCDKLENEDDLIETFDNELLCSPCYIKKEFEIENEANNE* |
| JGI24004J15324_100956213 | 3300001472 | Marine | MINQIQCDKCDILENENDLIETFDNELLCSPCYIKKEFNTESEEV* |
| JGI25132J35274_10798544 | 3300002483 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEEK* |
| Ga0065861_11771664 | 3300004448 | Marine | MENQILCDKCDILENESKLIETFDNELLCSSCYIKKEFDTENDKGE* |
| Ga0066224_10231253 | 3300004457 | Marine | MENQISCDNCDCLENESELIETFDNQLLCSPCYIKKELESEE* |
| Ga0066222_10986781 | 3300004460 | Marine | MENQISCDNCDCLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| Ga0073579_13858213 | 3300005239 | Marine | MENQIPCDNCNWLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| Ga0075109_11762944 | 3300005912 | Saline Lake | MSSIKNQIPCDNCDILEDEDEIIETFENELLCSPCYIKKEFNTESEE* |
| Ga0075478_102247162 | 3300006026 | Aqueous | MENQISCDNCDFLENESELIETFDNELLCSPCYIKKEFNTEREE* |
| Ga0075441_100901095 | 3300006164 | Marine | MTQQIQCNKCDILENENDLIETFDNQLLCSPCYIKKEFNTESEE* |
| Ga0098038_10464584 | 3300006735 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESEDQ* |
| Ga0098038_11661722 | 3300006735 | Marine | MENQIPCDNCDRLENESELIETFDNQLLCSPCYIKKEFNT* |
| Ga0098035_11474791 | 3300006738 | Marine | MKYQIPCDKCDLAEDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI* |
| Ga0098058_11738002 | 3300006750 | Marine | MKYQIPCDKCDLVEDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI* |
| Ga0098044_10723071 | 3300006754 | Marine | MKYQILCDKCDLAEDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI* |
| Ga0098044_10789154 | 3300006754 | Marine | MKYQIPCDKCDLAKDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKKQ* |
| Ga0070754_104172111 | 3300006810 | Aqueous | CDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE* |
| Ga0070750_1000520416 | 3300006916 | Aqueous | MENQIPCDNCDLLENESKLIETFDNELLCSPCYIKKEFNTENEKGE* |
| Ga0070746_103159762 | 3300006919 | Aqueous | MEYQIPCDQCDITEDESELIETFDNKLLCSPCYIKKEFNTESEETNDNTR* |
| Ga0070748_12743211 | 3300006920 | Aqueous | ENQISCDNCDCLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| Ga0098051_10483677 | 3300006924 | Marine | PCDKCDLVEDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI* |
| Ga0098041_10312881 | 3300006928 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESED |
| Ga0098036_10075869 | 3300006929 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESE |
| Ga0098036_12201442 | 3300006929 | Marine | MENQIPCDNCDRLENESELIETFDNQLLCSPCYIKKEFNTEREE* |
| Ga0098036_12269001 | 3300006929 | Marine | QIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESEDQ* |
| Ga0098036_12657713 | 3300006929 | Marine | QIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESEEINE* |
| Ga0098046_10461383 | 3300006990 | Marine | MENQIPCDNCDCLENESELIETFDNQLLCSPCYIKKEFNT* |
| Ga0075110_10386084 | 3300007074 | Saline Lake | MGVLMSSIKNQIPCDNCDILEDEDEIIETFENELLCSPCYIKKEFNTESEE* |
| Ga0070747_10812221 | 3300007276 | Aqueous | PCNNCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE* |
| Ga0070752_12961221 | 3300007345 | Aqueous | ENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE* |
| Ga0070753_12267941 | 3300007346 | Aqueous | NKMENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE* |
| Ga0099849_10988541 | 3300007539 | Aqueous | KMENQILCDKCDMLENKSDLIETVDNQLLCSPCYIKKEFNTESEE* |
| Ga0115548_11144441 | 3300009423 | Pelagic Marine | NQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEV* |
| Ga0115003_106032401 | 3300009512 | Marine | DILENESKLIETFDNELLCSSCYIKKEFDTENEKGE* |
| Ga0098059_10494885 | 3300010153 | Marine | MKYQIPCDKCDLAKDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI* |
| Ga0098047_101951121 | 3300010155 | Marine | DEDKLIETFDNELLCSSCYIKKEFHTKNEEGKKQ* |
| Ga0129324_102388912 | 3300010368 | Freshwater To Marine Saline Gradient | MEYQIPCDQCDITEDESKLIETFDNELLCSSCYIKKEFNTESEI* |
| Ga0151677_10267051 | 3300011258 | Marine | TNRKREIMENQIPCDNCDWLENENELIETFDNQLLCSPCYIKKEFKTESEDQ* |
| Ga0160423_100981165 | 3300012920 | Surface Seawater | MEHEIACDICEQLEKESELIETFDDQLLCNTCYIKKEFGEESEDK* |
| Ga0163179_109410252 | 3300012953 | Seawater | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESED* |
| Ga0181377_10587251 | 3300017706 | Marine | MKYQIPCDNCNLLENESELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0181390_10232476 | 3300017719 | Seawater | MKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFEIENEANNE |
| Ga0181373_10833672 | 3300017721 | Marine | MNNIEYQIPCDKCDITEDESKLIETFDNQLLCSPCYIKKEFNT |
| Ga0181396_11236322 | 3300017729 | Seawater | MKYQILCDKCDKLENEDDLIETFDNELLCSPCYIKKEFEIESEEE |
| Ga0181416_10500955 | 3300017731 | Seawater | MENQIPCDNCNWLENESELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0181415_10967772 | 3300017732 | Seawater | MEYQIPCDQCDTTTGESKLIETFDNELLCSPCYIKKEFNTESEE |
| Ga0181428_11462652 | 3300017738 | Seawater | MEYQIPCDQCDTTKGESKLIETFDNELLCSPCYIKKEF |
| Ga0181433_11197443 | 3300017739 | Seawater | MENQIPCDNCDWLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0181418_10337372 | 3300017740 | Seawater | MKYQKYQILCDKCDKLENEDDLIETFDNELLCSPCYIKKEFETESEEE |
| Ga0181389_11690351 | 3300017746 | Seawater | MKYQILCDKCDKLENENDLIETFDNELLCSPCYIKKEFEIESEEE |
| Ga0181411_12048313 | 3300017755 | Seawater | MENQIPCDNCNWLENESELIETFDNQLLCSPCYIKKEFNTESEEINEV |
| Ga0181382_10610743 | 3300017756 | Seawater | MNNIEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEE |
| Ga0181409_11631912 | 3300017758 | Seawater | MKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0181385_10820422 | 3300017764 | Seawater | MKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFETESEEE |
| Ga0181385_11861941 | 3300017764 | Seawater | KGGCDMNNIEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEE |
| Ga0181413_12560513 | 3300017765 | Seawater | MKYQKYQILCDKCDKLENEDELIETFENELLXSPCYIKKEFETESEEE |
| Ga0181430_10756452 | 3300017772 | Seawater | MENQIPCDNCNWLENKSELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0181386_11492281 | 3300017773 | Seawater | IPCDNCNWLENESELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0181386_11708122 | 3300017773 | Seawater | MENQIPCDNCDWLENESELIETFDNQLLCSPCYIKKSGLS |
| Ga0181423_11401024 | 3300017781 | Seawater | MKYQKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0181423_11608954 | 3300017781 | Seawater | MNNIEYQIPCDKCDITEDENKLIETFDNQLLCSSCYIKQEFKIESEGAI |
| Ga0181569_103470124 | 3300017986 | Salt Marsh | MTYQVLCNQCNITEDEDKLIETFDNQLLCSSCYIKKEFKIESNENENNL |
| Ga0193980_10588532 | 3300019725 | Sediment | MENQISCDNCDFLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0194029_10159304 | 3300019751 | Freshwater | MENQISCDNCDFLENESELIETFDNELLCSPCYIKKEFNTEREE |
| Ga0194029_10874682 | 3300019751 | Freshwater | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0206123_103359851 | 3300021365 | Seawater | NCDCLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0213863_100621394 | 3300021371 | Seawater | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEGE |
| Ga0213869_100231878 | 3300021375 | Seawater | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTEREE |
| Ga0213869_100495573 | 3300021375 | Seawater | MENQIPCNNCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0213861_100512748 | 3300021378 | Seawater | CDCLENESELIETFDNELLCSPCYIKKEFNTEREE |
| Ga0222718_104061142 | 3300021958 | Estuarine Water | MENQIPCDNCDWLENESELIETFDNQLLCSPCYIKKEFNTESEE |
| Ga0222714_100506451 | 3300021961 | Estuarine Water | CNSLEKESYLIETFDNELLCSSCYIKKEFNTESEEK |
| Ga0212024_10037814 | 3300022065 | Aqueous | MENQIPCDNCDLLENESKLIETFDNELLCSPCYIKKEFNTENEKGE |
| Ga0212028_10664953 | 3300022071 | Aqueous | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESKE |
| Ga0224906_11070071 | 3300022074 | Seawater | IELTCNNCNLLENESELIETFDNQLLCSPCYIKKELNTESEE |
| Ga0224906_11517981 | 3300022074 | Seawater | MKYQKYQILCDKCDKLENEDELIETFDNELLCSPCYIKKEFETESGEE |
| Ga0222673_10044959 | 3300022821 | Saline Water | MSSIKNQIPCDNCDILEDEDEIIETFENELLCSPCYIKKEFNTESEE |
| Ga0222711_10276335 | 3300022837 | Saline Water | MGVLMSSIKNQIPCDNCDILEDEDEIIETFENELLCSPCYIKKEFNTESEE |
| Ga0222629_10202371 | 3300022867 | Saline Water | MSSIKNQIPCDNCDILEDEDEIIETFENELLCSPCYIKKEFNTES |
| (restricted) Ga0255048_101629812 | 3300024518 | Seawater | MENQIPCDNCDWLENESELIETFDNQLLCSPCYIKKEFKPESEDQ |
| Ga0207905_10203125 | 3300025048 | Marine | MENQIPCDNCNWLENESKLIETFDNELLCSPCYIKKEFDTENEKTND |
| Ga0208157_10233115 | 3300025086 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYIKQEFKPESEDQ |
| Ga0208157_11223092 | 3300025086 | Marine | MENQIPCDNCDRLENESELIETFDNQLLCSPCYIKKEFNT |
| Ga0208793_10417495 | 3300025108 | Marine | MKYQIPCDKCDLAKDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKKQ |
| Ga0208158_11460622 | 3300025110 | Marine | MEYQIPCDQCDITQDESKLIETFDSQLLCSSCYIKQEFKPESEEINAKNR |
| Ga0208433_11500361 | 3300025114 | Marine | PCDKCDLVEDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI |
| Ga0208790_10492253 | 3300025118 | Marine | MKYQIPCDKCDLAKDEDKLIETFDNELLCSSCYIKKEFHTKNEEGKNEKI |
| Ga0209535_10930293 | 3300025120 | Marine | MINQIQCDKCDILENENDLIETFDNELLCSPCYIKKEFNTESEETNDNTR |
| Ga0209535_11595593 | 3300025120 | Marine | MKYQKYQILCDKCDKLENEDDLIETFDNELLCSPCYIKKEFEIENEANNE |
| Ga0209348_10430824 | 3300025127 | Marine | MSKKNNIKNRKGGIMEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEDQ |
| Ga0208299_10274358 | 3300025133 | Marine | MKYQIPCDKCDLAEDEDKLIETFDNELLCSSCYIKKEFHTK |
| Ga0209336_1000196511 | 3300025137 | Marine | MEYQIPCDQCDTTKGESKLIETFDNELLCSPCYIKKEFNTESEE |
| Ga0209634_10807883 | 3300025138 | Marine | MKNQILCDKCDMLENESDLIETVDNQLLCSPCYIKKEFNTESEE |
| Ga0209645_11419954 | 3300025151 | Marine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYVKQEFKIESEEK |
| Ga0209337_12719423 | 3300025168 | Marine | MINQIQCDKCDILENENDLIETFDNELLCSPCYIKKEFNTESEEV |
| Ga0208303_10270758 | 3300025543 | Aqueous | MEYQIPCDQCDITEDESELIETFDNKLLCSPCYIKKEFNTESEETNDNTR |
| Ga0209194_10707504 | 3300025632 | Pelagic Marine | MENQISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEV |
| Ga0208545_10171748 | 3300025806 | Aqueous | MENQIPCNNCDWLENESELIETFDNQLLCSPCYIKKEFNTE |
| Ga0208645_12350881 | 3300025853 | Aqueous | ISCDNCDCLENESELIETFDNELLCSPCYIKKEFNTESEE |
| Ga0209536_1028408231 | 3300027917 | Marine Sediment | MENQISCDNCDCLENESELIETFDNELLCSSCYIKKEFNTESEI |
| Ga0256368_10927811 | 3300028125 | Sea-Ice Brine | MENQIPCDNCDWLENESKLIETFDNELLCSPCYIKKEFNTENEKGE |
| Ga0183683_10251364 | 3300029309 | Marine | MEYQIPCDQCDVAEDESKLIETFDNQLLCSSCYVKQEFKIESEDQXLLNYLANK |
| Ga0183755_10267147 | 3300029448 | Marine | MSSDKNKIFCDKCNNLEEEDQLICSFDNELLCSPCYIKKEFHEVSDE |
| Ga0307488_102995814 | 3300031519 | Sackhole Brine | MENQILCDKCDILENESKLIETFDNELLCSSCYIKKEFDTENEKGE |
| Ga0314858_014885_176_310 | 3300033742 | Sea-Ice Brine | MEYQIPCDQCDITEDESKLIETFDNQLLCSSCYIKKEFNTESEE |
| ⦗Top⦘ |