| Basic Information | |
|---|---|
| Family ID | F077758 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRARTRR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.80 % |
| % of genes near scaffold ends (potentially truncated) | 27.35 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.282 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.513 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF05697 | Trigger_N | 49.57 |
| PF12729 | 4HB_MCP_1 | 31.62 |
| PF04234 | CopC | 7.69 |
| PF05698 | Trigger_C | 3.42 |
| PF05425 | CopD | 1.71 |
| PF02203 | TarH | 0.85 |
| PF12697 | Abhydrolase_6 | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 52.99 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 7.69 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.71 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 1.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.28 % |
| Unclassified | root | N/A | 48.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_118725718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 589 | Open in IMG/M |
| 3300004479|Ga0062595_101747363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 588 | Open in IMG/M |
| 3300004643|Ga0062591_101046190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 781 | Open in IMG/M |
| 3300005327|Ga0070658_10418803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1152 | Open in IMG/M |
| 3300005327|Ga0070658_10597251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 957 | Open in IMG/M |
| 3300005334|Ga0068869_100722479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 851 | Open in IMG/M |
| 3300005347|Ga0070668_102268429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 502 | Open in IMG/M |
| 3300005441|Ga0070700_100040576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2850 | Open in IMG/M |
| 3300005548|Ga0070665_101208914 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005718|Ga0068866_10145257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1367 | Open in IMG/M |
| 3300005718|Ga0068866_10273797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1043 | Open in IMG/M |
| 3300006169|Ga0082029_1208893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 526 | Open in IMG/M |
| 3300006169|Ga0082029_1404175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 613 | Open in IMG/M |
| 3300006169|Ga0082029_1443546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 576 | Open in IMG/M |
| 3300006804|Ga0079221_10570354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 755 | Open in IMG/M |
| 3300006844|Ga0075428_101589167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 684 | Open in IMG/M |
| 3300006876|Ga0079217_10480482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 765 | Open in IMG/M |
| 3300006876|Ga0079217_10927845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 625 | Open in IMG/M |
| 3300006894|Ga0079215_11168590 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006894|Ga0079215_11301474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 561 | Open in IMG/M |
| 3300007004|Ga0079218_11826681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 682 | Open in IMG/M |
| 3300007004|Ga0079218_12105591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 650 | Open in IMG/M |
| 3300007004|Ga0079218_13662086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 522 | Open in IMG/M |
| 3300009147|Ga0114129_12281536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 650 | Open in IMG/M |
| 3300009148|Ga0105243_10866079 | Not Available | 896 | Open in IMG/M |
| 3300009176|Ga0105242_12008366 | Not Available | 621 | Open in IMG/M |
| 3300009177|Ga0105248_11256831 | Not Available | 837 | Open in IMG/M |
| 3300009553|Ga0105249_11970941 | Not Available | 657 | Open in IMG/M |
| 3300009789|Ga0126307_10311199 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300009789|Ga0126307_10408597 | Not Available | 1095 | Open in IMG/M |
| 3300009789|Ga0126307_10946259 | Not Available | 696 | Open in IMG/M |
| 3300009789|Ga0126307_11176582 | Not Available | 620 | Open in IMG/M |
| 3300009840|Ga0126313_10025347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4003 | Open in IMG/M |
| 3300009840|Ga0126313_10191742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
| 3300009840|Ga0126313_10619701 | Not Available | 873 | Open in IMG/M |
| 3300009840|Ga0126313_11600758 | Not Available | 542 | Open in IMG/M |
| 3300010036|Ga0126305_10485051 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300010039|Ga0126309_10280324 | Not Available | 956 | Open in IMG/M |
| 3300010039|Ga0126309_10419338 | Not Available | 806 | Open in IMG/M |
| 3300010039|Ga0126309_10478890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300010040|Ga0126308_10035876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 2802 | Open in IMG/M |
| 3300010040|Ga0126308_10454579 | Not Available | 861 | Open in IMG/M |
| 3300010040|Ga0126308_11241214 | Not Available | 528 | Open in IMG/M |
| 3300010042|Ga0126314_10891026 | Not Available | 657 | Open in IMG/M |
| 3300010044|Ga0126310_10956464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300010045|Ga0126311_11004677 | Not Available | 682 | Open in IMG/M |
| 3300010166|Ga0126306_11130592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 642 | Open in IMG/M |
| 3300010399|Ga0134127_10957008 | Not Available | 914 | Open in IMG/M |
| 3300010399|Ga0134127_12391421 | Not Available | 608 | Open in IMG/M |
| 3300012186|Ga0136620_10519469 | Not Available | 504 | Open in IMG/M |
| 3300012897|Ga0157285_10123166 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012908|Ga0157286_10090485 | Not Available | 878 | Open in IMG/M |
| 3300012951|Ga0164300_10122104 | Not Available | 1179 | Open in IMG/M |
| 3300012986|Ga0164304_10828759 | Not Available | 717 | Open in IMG/M |
| 3300014326|Ga0157380_12519279 | Not Available | 580 | Open in IMG/M |
| 3300014488|Ga0182001_10492748 | Not Available | 561 | Open in IMG/M |
| 3300015077|Ga0173483_10374887 | Not Available | 722 | Open in IMG/M |
| 3300015373|Ga0132257_100732180 | Not Available | 1231 | Open in IMG/M |
| 3300015374|Ga0132255_104184040 | Not Available | 612 | Open in IMG/M |
| 3300017787|Ga0183260_10002551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 15038 | Open in IMG/M |
| 3300017792|Ga0163161_10931079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 738 | Open in IMG/M |
| 3300018061|Ga0184619_10263412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 792 | Open in IMG/M |
| 3300018422|Ga0190265_10081901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2958 | Open in IMG/M |
| 3300018422|Ga0190265_10300881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1674 | Open in IMG/M |
| 3300018422|Ga0190265_13037716 | Not Available | 560 | Open in IMG/M |
| 3300018422|Ga0190265_13349255 | Not Available | 535 | Open in IMG/M |
| 3300018429|Ga0190272_10719101 | Not Available | 903 | Open in IMG/M |
| 3300018432|Ga0190275_10166190 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300018432|Ga0190275_11434157 | Not Available | 767 | Open in IMG/M |
| 3300018432|Ga0190275_12000934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 658 | Open in IMG/M |
| 3300018469|Ga0190270_10372089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1309 | Open in IMG/M |
| 3300018469|Ga0190270_10477048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300018481|Ga0190271_13182840 | Not Available | 550 | Open in IMG/M |
| 3300018910|Ga0193598_1031736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1309 | Open in IMG/M |
| 3300018939|Ga0193593_1171378 | Not Available | 516 | Open in IMG/M |
| 3300019377|Ga0190264_10662179 | Not Available | 761 | Open in IMG/M |
| 3300019377|Ga0190264_11244214 | Not Available | 623 | Open in IMG/M |
| 3300020005|Ga0193697_1121505 | Not Available | 607 | Open in IMG/M |
| 3300020181|Ga0196958_10014008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2244 | Open in IMG/M |
| 3300020181|Ga0196958_10220419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 681 | Open in IMG/M |
| 3300021184|Ga0196959_10142137 | Not Available | 582 | Open in IMG/M |
| 3300021415|Ga0193694_1020174 | Not Available | 920 | Open in IMG/M |
| 3300022756|Ga0222622_10835266 | Not Available | 674 | Open in IMG/M |
| 3300024430|Ga0196962_10035419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 1500 | Open in IMG/M |
| 3300025899|Ga0207642_10129151 | Not Available | 1316 | Open in IMG/M |
| 3300025901|Ga0207688_10095510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1711 | Open in IMG/M |
| 3300025901|Ga0207688_10578809 | Not Available | 707 | Open in IMG/M |
| 3300025925|Ga0207650_11594239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300025935|Ga0207709_10294115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1205 | Open in IMG/M |
| 3300025938|Ga0207704_11036160 | Not Available | 695 | Open in IMG/M |
| 3300026035|Ga0207703_11476069 | Not Available | 654 | Open in IMG/M |
| 3300026121|Ga0207683_10101306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2571 | Open in IMG/M |
| 3300026121|Ga0207683_11975304 | Not Available | 532 | Open in IMG/M |
| 3300027909|Ga0209382_11847599 | Not Available | 586 | Open in IMG/M |
| 3300028589|Ga0247818_10322543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1030 | Open in IMG/M |
| 3300028592|Ga0247822_10820933 | Not Available | 759 | Open in IMG/M |
| 3300028596|Ga0247821_10568398 | Not Available | 728 | Open in IMG/M |
| 3300028597|Ga0247820_10248291 | Not Available | 1149 | Open in IMG/M |
| 3300028608|Ga0247819_11030778 | Not Available | 522 | Open in IMG/M |
| 3300028881|Ga0307277_10030981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2130 | Open in IMG/M |
| 3300030336|Ga0247826_11243054 | Not Available | 598 | Open in IMG/M |
| 3300031548|Ga0307408_102209736 | Not Available | 532 | Open in IMG/M |
| 3300031731|Ga0307405_11949553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300031731|Ga0307405_12148175 | Not Available | 502 | Open in IMG/M |
| 3300031852|Ga0307410_10437529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1064 | Open in IMG/M |
| 3300031901|Ga0307406_10384339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1108 | Open in IMG/M |
| 3300031903|Ga0307407_10621005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 807 | Open in IMG/M |
| 3300031911|Ga0307412_10941579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300031938|Ga0308175_100118497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2478 | Open in IMG/M |
| 3300031939|Ga0308174_11643283 | Not Available | 552 | Open in IMG/M |
| 3300031996|Ga0308176_12069572 | Not Available | 608 | Open in IMG/M |
| 3300032004|Ga0307414_10305984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1347 | Open in IMG/M |
| 3300032080|Ga0326721_10293968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 903 | Open in IMG/M |
| 3300032080|Ga0326721_10298184 | Not Available | 897 | Open in IMG/M |
| 3300032080|Ga0326721_11021281 | Not Available | 529 | Open in IMG/M |
| 3300033551|Ga0247830_11503199 | Not Available | 539 | Open in IMG/M |
| 3300034000|Ga0334918_037436 | Not Available | 681 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 16.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.42% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 2.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018910 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018939 | Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1187257182 | 3300002568 | Soil | MRSRLAARFYTGPAGHLVAGIADWAELLARWKWSQMVSHFKRGPSGR* |
| Ga0062595_1017473631 | 3300004479 | Soil | MRSRLLARFYTGPAGHLVAGVADWAELLVRWKWSQMVSRFKRAPTRR* |
| Ga0062591_1010461902 | 3300004643 | Soil | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRARTRR* |
| Ga0070658_104188032 | 3300005327 | Corn Rhizosphere | VRSRLAARFYTGPLGHLVAGVADWAELLVRWKCSRLVSRFKRARTRR* |
| Ga0070658_105972511 | 3300005327 | Corn Rhizosphere | VRSRLAARYYTGPVGHLVAGIADWGELLARWKWSQLVSRFKRARSRR* |
| Ga0068869_1007224791 | 3300005334 | Miscanthus Rhizosphere | VRSRLAARFYTGPIGHLVAGVADWAELLVRWKCSRLVSRFKRARTRR* |
| Ga0070668_1022684291 | 3300005347 | Switchgrass Rhizosphere | SEAMAQSLYKPRGMRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQMVSRFKRARTRR |
| Ga0070700_1000405764 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQMVSRFKRARTRR* |
| Ga0070665_1012089142 | 3300005548 | Switchgrass Rhizosphere | MRSRLAARFYTGPTGHFVAGVADWAELLARWKWSQLVSRFKRARTRR* |
| Ga0068866_101452571 | 3300005718 | Miscanthus Rhizosphere | LGHLVAGVADWAELLVRWKCSRLVSRFKRARTRR* |
| Ga0068866_102737971 | 3300005718 | Miscanthus Rhizosphere | VRSRLAARYYTGPVGHLVAGIADWGELLVRWKWSRLVSRFKRARTGR* |
| Ga0082029_12088931 | 3300006169 | Termite Nest | SRLAARYYTGPLGHLVAGIADWGELLVRWKCSRLVSRFKRARTRR* |
| Ga0082029_14041752 | 3300006169 | Termite Nest | MRSRLLARYYTGPLGHLVAGVADWAELLARWTWQRLRERFKARGPRR* |
| Ga0082029_14435462 | 3300006169 | Termite Nest | VRSRLAARFYTGPLGHLVAGVADWGELLVRWQWSRVRERFKRTPHTPRG* |
| Ga0079221_105703542 | 3300006804 | Agricultural Soil | MRSRLLARFYTGPAGHLVAGLADWAELLVRWKWSRLVSHFKRTDTGR* |
| Ga0075428_1015891672 | 3300006844 | Populus Rhizosphere | VRSRLAARFYTGPVGHLVAGVADWAELLARWKWAQMRERYRRARAGR* |
| Ga0079217_104804822 | 3300006876 | Agricultural Soil | MAVSLYKPLVVRSRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFKRGGTGR* |
| Ga0079217_109278452 | 3300006876 | Agricultural Soil | VRSRLAARFYTGPVGHLAAGIADWAGLLARWQWSRARERYRRARTRRDPARET |
| Ga0079215_111685902 | 3300006894 | Agricultural Soil | VRSRLAARFYTGPLGHLVAGVADWGELLARWKWSQLAARFKRGRTRR* |
| Ga0079215_113014742 | 3300006894 | Agricultural Soil | SRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFKRGGTGR* |
| Ga0079218_118266812 | 3300007004 | Agricultural Soil | VVVRSRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFKRGGTGR* |
| Ga0079218_121055912 | 3300007004 | Agricultural Soil | MALPLYKPVPVRSRLAARFYTGPVGHLAAGIADWAGLLARWQWSRARERYRR |
| Ga0079218_136620862 | 3300007004 | Agricultural Soil | VRSRLAARFYTGPVGHLVAGVADWAELLARWKWAQARERYRRARVRR* |
| Ga0114129_122815362 | 3300009147 | Populus Rhizosphere | VRSRLAARYYTGPLGHLVAGVADWAELLARWKWSQLASDFKHRRTGR* |
| Ga0105243_108660791 | 3300009148 | Miscanthus Rhizosphere | LYKPRGMRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRARTRR* |
| Ga0105242_120083661 | 3300009176 | Miscanthus Rhizosphere | VRSRLAARYYTGPVGHLVAGIADWGELLVRWKWSRLVSRFKRAPTG |
| Ga0105248_112568312 | 3300009177 | Switchgrass Rhizosphere | VRSRLAARFYTGPLGHLVAGVADWAELLVRWKCSRLVSRFKR |
| Ga0105249_119709412 | 3300009553 | Switchgrass Rhizosphere | FYTGPAGHFVAGVADWAELLARWKWSQMVSRFKRARTRR* |
| Ga0126307_103111992 | 3300009789 | Serpentine Soil | LAIAQPLYKPAYVRSRLAARYYTGPLGHLVAGVADWAELLARWKWSQVRARFERDA* |
| Ga0126307_104085972 | 3300009789 | Serpentine Soil | VTVRSRLAARFYTGRAGHLVAGVADCAELLARWKWSQTVDRFKRARSPR* |
| Ga0126307_109462591 | 3300009789 | Serpentine Soil | VRSRLAARFYTGPLGHLVAGIADWGELLVRWKWSRARERFRHTPSGR* |
| Ga0126307_111765822 | 3300009789 | Serpentine Soil | VRSRLAARFYTGRAGHLVAGVADWAELLARWKWAQMVDRFKPARSRR* |
| Ga0126313_100253476 | 3300009840 | Serpentine Soil | YKGVLVRSRLAARFYTGPVGHLVAGVADWAELLARWKWSQLMDRFKRARSRR* |
| Ga0126313_101917422 | 3300009840 | Serpentine Soil | VRSRLAARYYTGPLGHLVAGVADWAELLARWKWSQVRARFERDA* |
| Ga0126313_106197011 | 3300009840 | Serpentine Soil | VRSRLAARFYTGPAGHLVAGVADWAALLARWKWSQMKERLEQARARR* |
| Ga0126313_116007582 | 3300009840 | Serpentine Soil | MAPSLYKPFPVRSRLAARFYTGPVGHLVAGIADWAELLARWKWSQTVDRFKRARSRR* |
| Ga0126305_104850512 | 3300010036 | Serpentine Soil | VRSRLVARFYTGPAGHLVAGLADWGELLARWKWSRMRERLERARRRR* |
| Ga0126309_102803242 | 3300010039 | Serpentine Soil | MGHPLYKPVVVRSRLAARFYTGPAGHLVAGVADWAELLARWKWSRMKERLEQARARR* |
| Ga0126309_104193381 | 3300010039 | Serpentine Soil | VRSRLAARYYTGPLGHLVAGVADCAELLARWKWSRLVSRFKRARTGR* |
| Ga0126309_104788902 | 3300010039 | Serpentine Soil | VRSRLAARFYTGPAGHLVAGVADWAELLARWKWSQMKERLEQARARR* |
| Ga0126308_100358762 | 3300010040 | Serpentine Soil | VRSRLAARFYTGRAGHLVAGVADWAELLARWKWAQMVDRFKRARSRR* |
| Ga0126308_104545792 | 3300010040 | Serpentine Soil | MRSRLAARYYTGPIGHLVAGAVDWGELLVRWKWSQMRARSKRARSRR* |
| Ga0126308_112412142 | 3300010040 | Serpentine Soil | MRSRLLARYYTGPLGHLVAGIADWAELLARWKWSQMTGRFKRARSRR* |
| Ga0126314_108910262 | 3300010042 | Serpentine Soil | VRSRLAARFYTGPVGHLVAGLADWAELLARWKWSHAVGRFKRARTRR* |
| Ga0126310_109564641 | 3300010044 | Serpentine Soil | MGSRLIARFYTGPVGHLIAGVADWAELLVRWKWSQLMARFRHARSGR* |
| Ga0126311_110046771 | 3300010045 | Serpentine Soil | PRVRSRLAARFYTGPMGHLVAGIADWAALLIRWKWAATADRHKLRRTRR* |
| Ga0126306_111305922 | 3300010166 | Serpentine Soil | VRSRLLARFYTGPLGHLVAGVADWAALLARWNAEKLRERLKRR* |
| Ga0134127_109570081 | 3300010399 | Terrestrial Soil | MRSRLLARFYTGPAGHLVAGVADWAQLLVRWKWSQMVSRFKR |
| Ga0134127_123914211 | 3300010399 | Terrestrial Soil | RLAARFYTGPVGHLVAGIADWGELLVRWKWSRLVSRFKRARTGR* |
| Ga0136620_105194691 | 3300012186 | Polar Desert Sand | VRSRLAARFYTGPLGHLVAGVADWAEMIARWQWPRLRARLSRRSRASR |
| Ga0157285_101231662 | 3300012897 | Soil | MRSRLAARFYTGPVGHLVAGIADWGELLARWKWSQLVSRFKRARSRR* |
| Ga0157286_100904851 | 3300012908 | Soil | VRSRLAARFYTGPLGHLVAGVADWAELLVRWKCSRLVSRFK |
| Ga0164300_101221042 | 3300012951 | Soil | VRSRLVARYYTGPLGHLVAGIADWAELLARWKWSQLVSRFKRTPTRR* |
| Ga0164304_108287592 | 3300012986 | Soil | MRSRLLARFYTGPAGHLVAGVFDWAELLARWKWSQMVSRVKRTPTRR* |
| Ga0157380_125192791 | 3300014326 | Switchgrass Rhizosphere | GPTGHFVAGVADWAELLARWKWSQLVSRFKRARTRR* |
| Ga0182001_104927481 | 3300014488 | Soil | VRERLAARFYTGPVGHLVAGVADWAELLARWKWAQLMSRFKRADASR* |
| Ga0173483_103748871 | 3300015077 | Soil | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLRERWRR* |
| Ga0132257_1007321802 | 3300015373 | Arabidopsis Rhizosphere | VRSRLAARYYTGPLGHLVAGVADWAELLVRWKCSRLVSRFKRARTRR* |
| Ga0132255_1041840401 | 3300015374 | Arabidopsis Rhizosphere | AGHFVAGVADWAELLARWKWSQLVSRFKRAPTRR* |
| Ga0183260_1000255113 | 3300017787 | Polar Desert Sand | VRSRLAARFYTGPLGHLVAGVADWAELLARWQWSRLRARFKRTA |
| Ga0163161_109310792 | 3300017792 | Switchgrass Rhizosphere | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRARTRR |
| Ga0184619_102634122 | 3300018061 | Groundwater Sediment | MRSRLLARFYTGPAGHLVAGIADWAELLVRWKWSQMVSRFKRAPTRR |
| Ga0190265_100819012 | 3300018422 | Soil | VRSRLLARFYTGPLGHLIAGAADWAGLLARWKWSQLRERVTRERPRR |
| Ga0190265_103008812 | 3300018422 | Soil | MRSRLLARYYTGPLGHLVAGVADWAELLARWNWHRLRERFKARRSGR |
| Ga0190265_130377162 | 3300018422 | Soil | MAVSLYKPLVVRSRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFKRSGTGR |
| Ga0190265_133492551 | 3300018422 | Soil | VDVRSRLAARFYTGPTGHLVAGIADWAELLARWKWSRTVDRFKRARSRR |
| Ga0190272_107191012 | 3300018429 | Soil | VRSRLAARYYTGPLGHLVAGVADWAELLARWKWSRLVSRFKRAPTRR |
| Ga0190275_101661902 | 3300018432 | Soil | MSLPLYKPVVVRSRLAARFYTGPAGHLVAGVADWAELLARWKWSQLVDRFKAARRRGE |
| Ga0190275_114341571 | 3300018432 | Soil | MAVSLYKPLVVRSRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFKRGGTGR |
| Ga0190275_120009342 | 3300018432 | Soil | MAVSLYKPVVVRSRLAARFYTGPIGHLVAGTADWAELLARWKWSQVVSRFKRDGTGR |
| Ga0190270_103720892 | 3300018469 | Soil | MRSRLAARFYTGPAGHLVAGIADWAELLARWNWSRMVSRFERARSRR |
| Ga0190270_104770483 | 3300018469 | Soil | SRLAARYYTGPLGHLVAGVADWAELLARWKWSQLVSRFKCAPMRRQAGP |
| Ga0190271_131828401 | 3300018481 | Soil | VRSRLAARYYTGPLGHLVAGIADWAELLARWKWSQLVARFKRARSSR |
| Ga0193598_10317362 | 3300018910 | Soil | MRSRLLARYYTGPLGHLVAGVADWAGLLSRWQYARLRERLKRARGRS |
| Ga0193593_11713782 | 3300018939 | Soil | MRSRLLARYYTGPLGHLVAGVADWAGLLSRWQYARLRERLKRARG |
| Ga0190264_106621792 | 3300019377 | Soil | MAFSLYKPHSVRSRLAARFYTGPVGHFVAGVADWAELLARWKWSQMVSRFKRRRASR |
| Ga0190264_112442141 | 3300019377 | Soil | VTVVLTSGAAMAHSLYKPRGMRSRLLARFYTGPLGHFVAGIADWAELLARWNADRLRERLRRR |
| Ga0193697_11215051 | 3300020005 | Soil | VRSRIAARYYTGPLGHLVAGIADWAELLARWKCSQLVSRF |
| Ga0196958_100140082 | 3300020181 | Soil | MALPLYKPVPVRSRLAARFYTGPVGHLVAGIADWAELLARWKWSRARERYRRARARR |
| Ga0196958_102204191 | 3300020181 | Soil | VRRRLLARYYTGPVGHLVAGVADWAGLLARWKASQAIGRLKRARRGR |
| Ga0196959_101421372 | 3300021184 | Soil | VRSRLLARYYTGPVGHLVAGIADWAEMLARWHWERLRERYTLRRSGR |
| Ga0193694_10201741 | 3300021415 | Soil | MRSRLLARYYTGRAGHLVAGIADWAELLARWRWSRAVSRFKRSPMSR |
| Ga0222622_108352662 | 3300022756 | Groundwater Sediment | VRSRLAARFYTGPAGHLVAGIADWAELLARWKWSQLMSRFKRTRSSR |
| Ga0196962_100354192 | 3300024430 | Soil | VRSRLLARFYTGPLGHLVAGVLDWGELLARWKAQQLRERLRRRAAARR |
| Ga0207642_101291512 | 3300025899 | Miscanthus Rhizosphere | VRSRLAARYYTGPLGHLVAGIADWAELLARWKWSQLVSRFKRTPTRR |
| Ga0207688_100955102 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQMVSRFKRARTRR |
| Ga0207688_105788092 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSRLAARFYTGPLGHLVAGVADWAELLVRWKCSRLVSRFKRARTRR |
| Ga0207650_115942392 | 3300025925 | Switchgrass Rhizosphere | VRSRLAARFYTGPVGHLVAGIADWGELLARWKWSQLVSRFKRARSRR |
| Ga0207709_102941151 | 3300025935 | Miscanthus Rhizosphere | QSLYKPRGMRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQMVSRFKRARTRR |
| Ga0207704_110361602 | 3300025938 | Miscanthus Rhizosphere | VRSRLAARYYTGPVGHLVAGIADWGELLVRWKWSRLVSRFKRAPTGR |
| Ga0207703_114760691 | 3300026035 | Switchgrass Rhizosphere | RSRLAARYYTGPVGHLVAGIADWGELLVRWKWSRLVSRFKRARTRR |
| Ga0207683_101013064 | 3300026121 | Miscanthus Rhizosphere | VRSRLAARYYTGPLGHLVAGIADWAELLTRWKWSQLVSRFKRTRTRR |
| Ga0207683_119753041 | 3300026121 | Miscanthus Rhizosphere | MRSRLAARFYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRAHTRR |
| Ga0209382_118475992 | 3300027909 | Populus Rhizosphere | VRSRLAARFYTGPVGHLVAGVADWAELLARWKWAQMRERYRRARAGR |
| Ga0247818_103225432 | 3300028589 | Soil | FYTGPAGHFVAGVADWAELLARWKWSQLVSRFKRARTRR |
| Ga0247822_108209332 | 3300028592 | Soil | VRSRLAARYYTGPLGHLVAGIADWAELLARWKWSQLVSRFKQASTRR |
| Ga0247821_105683981 | 3300028596 | Soil | MRSRLAARFYTGPTGHFVAGVADWAELLARWKWSQLVSRFKRA |
| Ga0247820_102482912 | 3300028597 | Soil | MRSRLAARFYTGPTGHFVAGVADWAELLARWKWSQLVSRFKRARTRR |
| Ga0247819_110307782 | 3300028608 | Soil | YKPRGMRSRLAARFYTGPTGHFVAGVADWGELLARWKWSQLVSRFKRARTRR |
| Ga0307277_100309812 | 3300028881 | Soil | MRSRLLARFYTGPVGHLVAGVADWAELLVRWKWARMASRFKRTRSRR |
| Ga0247826_112430542 | 3300030336 | Soil | MRSKLLARFYTGPVGHLVAGVADWAELLARWKWSQTVSRFKRGRSRR |
| Ga0307408_1022097362 | 3300031548 | Rhizosphere | VRSRLAARFYTGPAGHLVAGIADWAELLTRWKWSQLVSRFKHARSRR |
| Ga0307405_119495532 | 3300031731 | Rhizosphere | VRSRLAARFYTGPLGHLVAGVADWAELLARWKWAQVRERYRRA |
| Ga0307405_121481751 | 3300031731 | Rhizosphere | MAISLYKPSLVRSWLAARFYTGPLGHLVAGIADWAELLIRWK |
| Ga0307410_104375292 | 3300031852 | Rhizosphere | VRSRLAARFYTGPVGHLVAGIADWAGLLARWKWSQLVGRFKRAHARR |
| Ga0307406_103843392 | 3300031901 | Rhizosphere | VRSRLAARFYTGPLGHLVAGIADWGTLLARWKWSRLLSRFKRARTRR |
| Ga0307407_106210051 | 3300031903 | Rhizosphere | VRSRLAARYYTGPLGHLVAGIADWGELLVRWKGSQLVSRFKRARTRR |
| Ga0307412_109415791 | 3300031911 | Rhizosphere | VRSRLAARFYTGPLGHLVAGVADWAELLTRWKWSQLVSRFKRAGTRR |
| Ga0308175_1001184972 | 3300031938 | Soil | VRSRLAARYYTGPLGHLVAGIADWGELLVRWKGSQLVSLFKRARTRR |
| Ga0308174_116432832 | 3300031939 | Soil | MRSRLAARFYTGAAGHLVAGIADWAELLARWKWSQMVSRFKREPPGREPGP |
| Ga0308176_120695722 | 3300031996 | Soil | ARYYTGPVGHLVAGIADWGELLVRWKWSQLVSRFKRARSRR |
| Ga0307414_103059841 | 3300032004 | Rhizosphere | ARFYTGPVGHLVAGIADWAGLLARWKWSQLVGRFKRAHARR |
| Ga0326721_102939682 | 3300032080 | Soil | VRSRLAARFYTGPLGHLVAGIADWGELLVRWKWSRVRERFRRASSGR |
| Ga0326721_102981841 | 3300032080 | Soil | MTHPLYKHGFVRSRLAARFYTGPAGHLVAGVADWAELLARWKWSQLKDRFKRTPR |
| Ga0326721_110212811 | 3300032080 | Soil | MAVSLYKPLVVRSRLAARFYTGPTGHLVAGAADWAELLVRWKWSQMVSRFK |
| Ga0247830_115031991 | 3300033551 | Soil | VRSRLAARYYTGPLGHLVAGIADWAELLARWKWSQLVSRFKRTPARR |
| Ga0334918_037436_536_670 | 3300034000 | Hypolithic Biocrust | MPSRLLARFYTGPIGHLVAGIADWAEVLARWGYERLRERARARR |
| ⦗Top⦘ |