NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077752

Metagenome / Metatranscriptome Family F077752

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077752
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 36 residues
Representative Sequence MTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA
Number of Associated Samples 87
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.34 %
% of genes near scaffold ends (potentially truncated) 19.66 %
% of genes from short scaffolds (< 2000 bps) 82.05 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere
(18.803 % of family members)
Environment Ontology (ENVO) Unclassified
(45.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.171 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF04024PspC 52.99
PF13561adh_short_C2 16.24
PF00664ABC_membrane 6.84
PF01553Acyltransferase 5.13
PF00578AhpC-TSA 4.27
PF13453zf-TFIIB 2.56
PF07715Plug 1.71
PF06035Peptidase_C93 1.71
PF01189Methyltr_RsmB-F 0.85
PF03841SelA 0.85
PF08837DUF1810 0.85
PF02325YGGT 0.85
PF00106adh_short 0.85
PF01435Peptidase_M48 0.85
PF00005ABC_tran 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 1.71
COG014416S rRNA C967 or C1407 C5-methylase, RsmB/RsmF familyTranslation, ribosomal structure and biogenesis [J] 0.85
COG0762Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT familyPosttranslational modification, protein turnover, chaperones [O] 0.85
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig556147Not Available532Open in IMG/M
2228664021|ICCgaii200_c0599050Not Available502Open in IMG/M
3300000559|F14TC_101019546Not Available811Open in IMG/M
3300000956|JGI10216J12902_101619635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3438Open in IMG/M
3300000956|JGI10216J12902_107132452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium1211Open in IMG/M
3300000956|JGI10216J12902_110726337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum737Open in IMG/M
3300002074|JGI24748J21848_1046672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.560Open in IMG/M
3300005293|Ga0065715_10153001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1708Open in IMG/M
3300005543|Ga0070672_100001248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi15651Open in IMG/M
3300005543|Ga0070672_102066009Not Available513Open in IMG/M
3300005548|Ga0070665_100603228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1111Open in IMG/M
3300005618|Ga0068864_100173396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1968Open in IMG/M
3300005719|Ga0068861_100553931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1048Open in IMG/M
3300005844|Ga0068862_100232610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1673Open in IMG/M
3300005844|Ga0068862_100628383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1034Open in IMG/M
3300006169|Ga0082029_1416956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi3511Open in IMG/M
3300006755|Ga0079222_11092716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas699Open in IMG/M
3300006845|Ga0075421_100003729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas18292Open in IMG/M
3300006846|Ga0075430_101528573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas548Open in IMG/M
3300006865|Ga0073934_10000092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas258329Open in IMG/M
3300006865|Ga0073934_10217020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1285Open in IMG/M
3300006969|Ga0075419_11315085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007537Open in IMG/M
3300007004|Ga0079218_11063059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas820Open in IMG/M
3300007004|Ga0079218_11773809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales689Open in IMG/M
3300009094|Ga0111539_10524435Not Available1380Open in IMG/M
3300009095|Ga0079224_103533395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae622Open in IMG/M
3300009100|Ga0075418_11590862Not Available710Open in IMG/M
3300009147|Ga0114129_10718928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1282Open in IMG/M
3300009153|Ga0105094_10298786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi927Open in IMG/M
3300009156|Ga0111538_10084756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi4032Open in IMG/M
3300009156|Ga0111538_10780220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1210Open in IMG/M
3300009162|Ga0075423_10386388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1469Open in IMG/M
3300009162|Ga0075423_12031124Not Available623Open in IMG/M
3300009174|Ga0105241_10440772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1150Open in IMG/M
3300009610|Ga0105340_1216894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas810Open in IMG/M
3300009610|Ga0105340_1501277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae543Open in IMG/M
3300009840|Ga0126313_11275775Not Available607Open in IMG/M
3300009840|Ga0126313_11334946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300010037|Ga0126304_11216937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725517Open in IMG/M
3300010364|Ga0134066_10149746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales732Open in IMG/M
3300011333|Ga0127502_11143629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas648Open in IMG/M
3300011333|Ga0127502_11358582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi554Open in IMG/M
3300011993|Ga0120182_1000480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1443Open in IMG/M
3300012022|Ga0120191_10068338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725665Open in IMG/M
3300012043|Ga0136631_10206063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum769Open in IMG/M
3300012469|Ga0150984_122179375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi835Open in IMG/M
3300012984|Ga0164309_10128766All Organisms → cellular organisms → Bacteria → Proteobacteria1649Open in IMG/M
3300014326|Ga0157380_10023442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi4655Open in IMG/M
3300014326|Ga0157380_10489689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1191Open in IMG/M
3300015371|Ga0132258_10372754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi3537Open in IMG/M
3300017792|Ga0163161_11091025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas686Open in IMG/M
3300018067|Ga0184611_1090118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1058Open in IMG/M
3300018072|Ga0184635_10204369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae787Open in IMG/M
3300018081|Ga0184625_10345115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi774Open in IMG/M
3300018429|Ga0190272_11911590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300018465|Ga0190269_10120817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1313Open in IMG/M
3300018465|Ga0190269_10920982Not Available648Open in IMG/M
3300018476|Ga0190274_10123125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2124Open in IMG/M
3300018476|Ga0190274_10431975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1290Open in IMG/M
3300018476|Ga0190274_12498157Not Available614Open in IMG/M
3300018476|Ga0190274_12552844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae608Open in IMG/M
3300018481|Ga0190271_10221776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1902Open in IMG/M
3300019356|Ga0173481_10851292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725509Open in IMG/M
3300025310|Ga0209172_10002179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas36188Open in IMG/M
3300025310|Ga0209172_10156663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1241Open in IMG/M
3300025901|Ga0207688_10031444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2930Open in IMG/M
3300025911|Ga0207654_10424389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi928Open in IMG/M
3300025912|Ga0207707_10121768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2281Open in IMG/M
3300025923|Ga0207681_10253369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1375Open in IMG/M
3300025930|Ga0207701_10281472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1447Open in IMG/M
3300025932|Ga0207690_10852413All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025972|Ga0207668_11353283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi641Open in IMG/M
3300026095|Ga0207676_10450448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1213Open in IMG/M
3300027036|Ga0207467_1002508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1244Open in IMG/M
3300027364|Ga0209967_1030495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas806Open in IMG/M
3300027543|Ga0209999_1056369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi745Open in IMG/M
3300027665|Ga0209983_1004495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2929Open in IMG/M
3300027907|Ga0207428_10149512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1778Open in IMG/M
3300027909|Ga0209382_10001372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas38534Open in IMG/M
3300028040|Ga0247704_1017043All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300028379|Ga0268266_10544908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1111Open in IMG/M
3300028608|Ga0247819_10039475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2200Open in IMG/M
3300028608|Ga0247819_10217624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1035Open in IMG/M
3300030499|Ga0268259_10114355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi615Open in IMG/M
3300031477|Ga0314812_102998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1216Open in IMG/M
3300031479|Ga0314809_11830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1187Open in IMG/M
3300031548|Ga0307408_100040594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi3295Open in IMG/M
3300031548|Ga0307408_100049135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3028Open in IMG/M
3300031548|Ga0307408_100178481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1701Open in IMG/M
3300031548|Ga0307408_100674606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas926Open in IMG/M
3300031548|Ga0307408_100836280Not Available838Open in IMG/M
3300031548|Ga0307408_100908362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae806Open in IMG/M
3300031548|Ga0307408_101444579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300031731|Ga0307405_10198794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1454Open in IMG/M
3300031824|Ga0307413_10023647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi3333Open in IMG/M
3300031824|Ga0307413_10215362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1398Open in IMG/M
3300031852|Ga0307410_10049945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2810Open in IMG/M
3300031852|Ga0307410_10658098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi879Open in IMG/M
3300031854|Ga0310904_10213606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1171Open in IMG/M
3300031903|Ga0307407_10253565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. AX61207Open in IMG/M
3300031911|Ga0307412_11257881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi665Open in IMG/M
3300031943|Ga0310885_10255014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum890Open in IMG/M
3300031995|Ga0307409_102677802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → Caenibius tardaugens → Caenibius tardaugens NBRC 16725527Open in IMG/M
3300032004|Ga0307414_10036186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi3293Open in IMG/M
3300032004|Ga0307414_10300267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1358Open in IMG/M
3300032004|Ga0307414_10414534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1173Open in IMG/M
3300032004|Ga0307414_10513954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1062Open in IMG/M
3300032004|Ga0307414_10731240Not Available898Open in IMG/M
3300032005|Ga0307411_11048489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300032012|Ga0310902_10759817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi657Open in IMG/M
3300032013|Ga0310906_10731785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas693Open in IMG/M
3300032017|Ga0310899_10116665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1100Open in IMG/M
3300032075|Ga0310890_10671850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas809Open in IMG/M
3300032126|Ga0307415_102278040Not Available531Open in IMG/M
3300032211|Ga0310896_10306870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi822Open in IMG/M
3300033412|Ga0310810_10165519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2550Open in IMG/M
3300033419|Ga0316601_101933398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi595Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere18.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.26%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.27%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil3.42%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.71%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.71%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011993Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027036Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028040Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-W_NEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031477Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031479Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_006706902124908045SoilMFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIA
ICCgaii200_059905022228664021SoilMSFSFLDTRQLAVSLAGAFITSLLFVSAATSLPIA
F14TC_10101954633300000559SoilMTFSFLDTRQLAVSVAGAFITXLLFVSAATSLPIA*
JGI10216J12902_10161963543300000956SoilMTFSFLDSRQLAVSLAGAFITSLLFVSAAASLPIA*
JGI10216J12902_10713245223300000956SoilMTFSFLETRQLATSLAAALITSLLFVSAATSLPIA*
JGI10216J12902_11072633723300000956SoilMTFSFVDARQLAVSLAGAFVTSLLFISAAGSLPIA*
JGI24748J21848_104667213300002074Corn, Switchgrass And Miscanthus RhizosphereKKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0065715_1015300153300005293Miscanthus RhizosphereSKKGVFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA*
Ga0070672_10000124843300005543Miscanthus RhizosphereMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0070672_10206600923300005543Miscanthus RhizosphereMTYTIIDTRQLVLSIAGALFTSLIFVSAATSLPIV*
Ga0070665_10060322823300005548Switchgrass RhizosphereMTYSFLDSRQLAASLAGAFITSLLFVSAATSLPIA*
Ga0068864_10017339653300005618Switchgrass RhizosphereMTFSNLDTRQLAVSFAGAFITSLLFVSAATSLPIA*
Ga0068861_10055393123300005719Switchgrass RhizosphereMSFSFIDPRQLVVTLGGALFMSLLFVSAATSLPLA*
Ga0068862_10023261023300005844Switchgrass RhizosphereMTFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0068862_10062838333300005844Switchgrass RhizosphereMTFSFLESRQLAASLAGAFLTSLLFVSAATSLPIA*
Ga0082029_141695653300006169Termite NestMTFSFVDTRQLVVSLGAALITSLMFVSAATSLPIA*
Ga0079222_1109271633300006755Agricultural SoilMTFSFLDTRQLATSLAAALITSLLFVSAATSLPIA*
Ga0075421_100003729273300006845Populus RhizosphereMTFSFVDSRQLIVSLAGAFITSLLFVSAATSLPIA*
Ga0075430_10152857323300006846Populus RhizosphereMTFSFLESRQLVVSLAGAFITSLLFVSAATSLPIA*
Ga0073934_100000921313300006865Hot Spring SedimentMTFSFVDSRHIAASLAGAFITSLLFISAAASLPIA*
Ga0073934_1021702023300006865Hot Spring SedimentMTFSFVDSRQLVASLAGAFITSLLFVSAATSLPIA*
Ga0075419_1131508523300006969Populus RhizosphereMTFSFLDSRQLAVSLAGAFITSLLFISAATSLPIA*
Ga0079218_1106305933300007004Agricultural SoilMFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIA*
Ga0079218_1177380923300007004Agricultural SoilMTFSFVDSRQLAVSLAGAFITSLLFISAAGSVSIA*
Ga0111539_1052443533300009094Populus RhizosphereMFSFVDTRQIAVSLAGAFITSLLFVSAATSLPIA*
Ga0079224_10353339523300009095Agricultural SoilMSFSFIDPRQLVISLAGALFTSLMLVSATASLPIA*
Ga0075418_1159086223300009100Populus RhizosphereMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0114129_1071892813300009147Populus RhizosphereMTFSFVDTRQLAVSLAGAFITSMLFISAATSLPIA*
Ga0105094_1029878643300009153Freshwater SedimentMTFSFVESRQLAASLAGAFITSLLFVSAATSLPIA*
Ga0111538_1008475613300009156Populus RhizosphereMTYSFLDGRQLAVSLAGAFVTSLLFVSAATSLPIA*
Ga0111538_1078022043300009156Populus RhizosphereMFFSFIETRQIAVSLAGALITSLLFVSAATSLPIA*
Ga0075423_1038638823300009162Populus RhizosphereMTNSLLDVRQLAVSLAGAFITSLLFVSAATSMPIA*
Ga0075423_1203112413300009162Populus RhizosphereMTFSFVDSRQLAVSLAGAFVTSLLFVSAATSLPLA*
Ga0105241_1044077233300009174Corn RhizosphereMTNSLLDVRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0105340_121689433300009610SoilMTFSFIETRQLYVSLAAALITSLLFVSAATSLPIA*
Ga0105340_150127723300009610SoilMSFSFIDPRQLVITLGGALFTSLLFVSAATSLPLA*
Ga0126313_1127577523300009840Serpentine SoilMTFSFVDSRQLAVSLAGAFVTSMLFISAAASLPIA*
Ga0126313_1133494613300009840Serpentine SoilMTYSFLDTRQLAASLAGAFITSILFVSAATSLSIA*
Ga0126304_1121693723300010037Serpentine SoilMTFSFLDTRQLAVSLTGAFITSVLFVSAATSLPIA*
Ga0134066_1014974623300010364Grasslands SoilMSFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0127502_1114362913300011333SoilRLKMTYSSIDPRQLVVSLAGAMFTSLLFISAAGSLPIA*
Ga0127502_1135858233300011333SoilIEMTFSFLDNRQLASSLAAALITSLQFVSAATSLPIA*
Ga0120182_100048023300011993TerrestrialMTFSFLDSRQLAVSLAGAFVTSMLFVSAATSLPIA*
Ga0120191_1006833823300012022TerrestrialMTFSFLDSRQLAVSLAGAFVTSLLFVSAATSLPIA*
Ga0136631_1020606313300012043Polar Desert SandMTFSFLDSRQLAVSFAGAFLTAMLFVSAAIGPLPIV*
Ga0150984_12217937513300012469Avena Fatua RhizosphereKGSIQMSFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA*
Ga0164309_1012876613300012984SoilMTFSFVDTRQLAASLAGAFVTSLLFVSAAVGPLPIF*
Ga0157380_1002344243300014326Switchgrass RhizosphereMTFSFLDSRQIAASLAGAFVTSLLFVSAATSLPIA*
Ga0157380_1048968943300014326Switchgrass RhizosphereVRKREYLEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA*
Ga0132258_1037275443300015371Arabidopsis RhizosphereMTFSFLDSRQIAVSLAGAFITSLLFVSAATSLPIA*
Ga0163161_1109102523300017792Switchgrass RhizosphereMTYTIIDTRQLVLSIAGALFTSLIFVSAATSLPIV
Ga0184611_109011823300018067Groundwater SedimentMSFSFIDPRQLVITLGGALFTSLMFISAATSLPLA
Ga0184635_1020436923300018072Groundwater SedimentMTFSFLETRQLATSLAAALITSLLFVSAATSLPIA
Ga0184625_1034511513300018081Groundwater SedimentMTFSFVDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0190272_1191159023300018429SoilMSFSFLDSRQLAVSLAGAFVTSLLFVSAATSLPIA
Ga0190269_1012081743300018465SoilMTFSFVDSRHIAASLAGAFITSLLFISAATSLPIA
Ga0190269_1092098213300018465SoilMTFSFLDSRQLAVSRAGAFITSMLFVSAATSLPIA
Ga0190274_1012312543300018476SoilMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0190274_1043197523300018476SoilMTFSFLDTRQLATSLAGALITSLLFISAATSLPIA
Ga0190274_1249815713300018476SoilMTFSFIETRQLYVSLAAALVTSLLFVSAATSLPIA
Ga0190274_1255284413300018476SoilMSFSFIDPRQLVITLGGALFASLMFISAATSLPLA
Ga0190271_1022177613300018481SoilMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA
Ga0173481_1085129223300019356SoilMTFSFVDSRQLAVSLAGAFVTSLLFVSAATSLPLA
Ga0209172_10002179273300025310Hot Spring SedimentMTFSFVDSRHIAASLAGAFITSLLFISAAASLPIA
Ga0209172_1015666323300025310Hot Spring SedimentMTFSFVDSRQLVASLAGAFITSLLFVSAATSLPIA
Ga0207688_1003144433300025901Corn, Switchgrass And Miscanthus RhizosphereMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0207654_1042438923300025911Corn RhizosphereMTNSLLDVRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0207707_1012176823300025912Corn RhizosphereMTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA
Ga0207681_1025336933300025923Switchgrass RhizosphereMSFSFIDPRQLVVTLGGALFMSLLFVSAATSLPLA
Ga0207701_1028147223300025930Corn, Switchgrass And Miscanthus RhizosphereMFFSFIETRQIAVSLAGALITSLLFVSAATSLPIA
Ga0207690_1085241343300025932Corn RhizosphereGSKKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0207668_1135328333300025972Switchgrass RhizosphereMTFSFLDSRQVAVSLAGAFITSLLFVSAATSLPIA
Ga0207676_1045044813300026095Switchgrass RhizosphereMTFSNLDTRQLAVSFAGAFITSLLFVSAATSLPIA
Ga0207467_100250813300027036SoilGSPKGRYQMTFSFIDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0209967_103049533300027364Arabidopsis Thaliana RhizosphereMLFSFVDPRQLVVTLVGALFTSFIVVSAATSLPIA
Ga0209999_105636913300027543Arabidopsis Thaliana RhizosphereMTYSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA
Ga0209983_100449523300027665Arabidopsis Thaliana RhizosphereMTYSFLDARQLAVSLAGAFITSLLFVSAATSLSIA
Ga0207428_1014951223300027907Populus RhizosphereMFFSFVDTRQIAVSLAGAFITSLLFVSAATSLPIA
Ga0209382_10001372133300027909Populus RhizosphereMTFSFVDSRQLIVSLAGAFITSLLFVSAATSLPIA
Ga0247704_101704323300028040SoilMPYSSIDPRQLFVSLTGALFTSLLLVSAATSLPIA
Ga0268266_1054490823300028379Switchgrass RhizosphereMTYSFLDSRQLAASLAGAFITSLLFVSAATSLPIA
Ga0247819_1003947513300028608SoilLKKGVFEMTYSFLDGRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0247819_1021762413300028608SoilMSFSFIDPRQLVITLGGALFTSLLFVSAATSLPLA
Ga0268259_1011435513300030499AgaveMTNSLLDVRQLAVSLAGAFITSMLFVSAATSLPIA
Ga0314812_10299843300031477SoilFEKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA
Ga0314809_1183013300031479SoilEKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA
Ga0307408_10004059453300031548RhizosphereMTFSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA
Ga0307408_10004913543300031548RhizosphereMFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIV
Ga0307408_10017848133300031548RhizosphereMTYSFLDTRQLAVSLAGAFVTAMLFVSAATSLPIA
Ga0307408_10067460613300031548RhizosphereKGSNTMFYSSIDPRQLVVSLTGALFTSLLFVSAATSLPIV
Ga0307408_10083628013300031548RhizosphereMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLSIA
Ga0307408_10090836223300031548RhizosphereMTFSFVDSRQLAVSLAGAFITSMLFVSAATSLPLA
Ga0307408_10144457923300031548RhizosphereMTFSFVDSRQLAVSLAGAFITSLLFISAAGSVSIA
Ga0307405_1019879423300031731RhizosphereMTFSFVDSRQLAVSLAGAFITSLLFISAATSLPIA
Ga0307413_1002364713300031824RhizosphereKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0307413_1021536233300031824RhizosphereMTYSFLDTRQLAVSLAGAFITAMLFVSAATSLPIA
Ga0307410_1004994523300031852RhizosphereMTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA
Ga0307410_1065809843300031852RhizosphereKGVSKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0310904_1021360623300031854SoilMTFSFVDARQLAVSLAAALFTSLVFVSAATSLPIA
Ga0307407_1025356513300031903RhizosphereMTYSFLDTRQLAASLAGAFITSILFVSAATSLSIA
Ga0307412_1125788133300031911RhizosphereGRYQMTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA
Ga0310885_1025501413300031943SoilMTFSFLDSRQIIGSLAGAFVTSLLFVSAATSLPIA
Ga0307409_10267780213300031995RhizosphereMTFSFLDSRQLAVSLAGAFITAMLFVSAATSLPIA
Ga0307414_1003618613300032004RhizosphereGDTKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLPIA
Ga0307414_1030026713300032004RhizosphereKMTFSFLDSRQLAVSLAGAFITSLLFVSAATSLSIA
Ga0307414_1041453453300032004RhizosphereMSFSFVDTRQLAVSLAGAFVTSLLFVSAATSLPIA
Ga0307414_1051395423300032004RhizosphereMTYSFLDTRQLAVSLAGAFITSLLFVSAATSLPLA
Ga0307414_1073124043300032004RhizosphereMTFSFVDNRQLAVSLAGAFITSLLFISAAGSLPIA
Ga0307411_1104848943300032005RhizosphereQKGRYQMTYSFLDTRQLAVSLAGAFVTSLLFVSAAIGPLPIA
Ga0310902_1075981713300032012SoilVQKGRCKMTFSFLDTRQLAVSLAGAFITSLLFVSAATSLSIA
Ga0310906_1073178543300032013SoilNKMTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA
Ga0310899_1011666513300032017SoilMSFSIIDPRQLVVTLGGALFMSLLFVSAATSLPLA
Ga0310890_1067185023300032075SoilMTFSFLDSRQVAASLAGAFITSLLFVSAATSLPIA
Ga0307415_10227804013300032126RhizosphereMTYSFLDSRQLAASLAGAFITSLLFVSAATSLPLA
Ga0310896_1030687043300032211SoilKMTFSFVDTRQLAVSLAAALFTSLVFVSAATSLPIA
Ga0310810_1016551933300033412SoilMTMTNLDTRALAVSLAGAFITSLLFVSAAIGPLQFA
Ga0316601_10193339823300033419SoilMTFSFVDSRQLAASLAGAFITSLLFVSAATSLPIA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.