| Basic Information | |
|---|---|
| Family ID | F077735 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLRAIMDISARAISLADRPQRAIRVTSVRMRREDRSSISSRPLADLGR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.11 % |
| % of genes near scaffold ends (potentially truncated) | 81.20 % |
| % of genes from short scaffolds (< 2000 bps) | 94.02 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.359 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (14.530 % of family members) |
| Environment Ontology (ENVO) | Unclassified (15.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.573 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 46.15 |
| PF04392 | ABC_sub_bind | 2.56 |
| PF01548 | DEDD_Tnp_IS110 | 1.71 |
| PF13495 | Phage_int_SAM_4 | 0.85 |
| PF00536 | SAM_1 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF01266 | DAO | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF12773 | DZR | 0.85 |
| PF02656 | DUF202 | 0.85 |
| PF01895 | PhoU | 0.85 |
| PF12594 | DUF3764 | 0.85 |
| PF07750 | GcrA | 0.85 |
| PF02566 | OsmC | 0.85 |
| PF13565 | HTH_32 | 0.85 |
| PF09234 | DUF1963 | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF11972 | HTH_13 | 0.85 |
| PF00582 | Usp | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 47.86 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.56 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.85 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.85 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.85 |
| COG3878 | Uncharacterized conserved protein YwqG, DUF1963 family | Function unknown [S] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.36 % |
| Unclassified | root | N/A | 25.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10189342 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1005604 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1011470 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300000912|JGI12032J12867_1003425 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300000956|JGI10216J12902_101705624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300001177|JGI12634J13548_1002027 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300001396|JGI20175J14863_1024069 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300001407|JGI20192J14887_1001559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3461 | Open in IMG/M |
| 3300001417|JGI20196J14858_1015142 | Not Available | 646 | Open in IMG/M |
| 3300002073|JGI24745J21846_1017817 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300002568|C688J35102_120525118 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300003659|JGI25404J52841_10019108 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300004009|Ga0055437_10072611 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300004081|Ga0063454_100652434 | Not Available | 781 | Open in IMG/M |
| 3300004463|Ga0063356_101061511 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300005165|Ga0066869_10109286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300005175|Ga0066673_10057660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1979 | Open in IMG/M |
| 3300005175|Ga0066673_10360052 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005179|Ga0066684_10216700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1244 | Open in IMG/M |
| 3300005179|Ga0066684_10324138 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005184|Ga0066671_10800681 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005186|Ga0066676_10699883 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005294|Ga0065705_11152794 | Not Available | 511 | Open in IMG/M |
| 3300005332|Ga0066388_106672886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 2S1 | 581 | Open in IMG/M |
| 3300005332|Ga0066388_108762922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
| 3300005344|Ga0070661_101383136 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005364|Ga0070673_100047115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3352 | Open in IMG/M |
| 3300005435|Ga0070714_100903426 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005436|Ga0070713_100485980 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300005436|Ga0070713_101014999 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005436|Ga0070713_101900328 | Not Available | 577 | Open in IMG/M |
| 3300005451|Ga0066681_10150004 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300005537|Ga0070730_10957213 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005540|Ga0066697_10111838 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300005560|Ga0066670_10136444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
| 3300005713|Ga0066905_100902253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 773 | Open in IMG/M |
| 3300005764|Ga0066903_101202910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0182 | 1407 | Open in IMG/M |
| 3300005764|Ga0066903_101424572 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300005764|Ga0066903_104526796 | Not Available | 741 | Open in IMG/M |
| 3300005902|Ga0075273_10123418 | Not Available | 528 | Open in IMG/M |
| 3300005983|Ga0081540_1036560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2616 | Open in IMG/M |
| 3300006047|Ga0075024_100132231 | Not Available | 1122 | Open in IMG/M |
| 3300006047|Ga0075024_100298723 | Not Available | 789 | Open in IMG/M |
| 3300006047|Ga0075024_100298806 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006047|Ga0075024_100907002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
| 3300006051|Ga0075364_10326247 | Not Available | 1045 | Open in IMG/M |
| 3300006057|Ga0075026_100457804 | Not Available | 727 | Open in IMG/M |
| 3300006059|Ga0075017_100193900 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300006059|Ga0075017_100216185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1391 | Open in IMG/M |
| 3300006102|Ga0075015_100067216 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300006102|Ga0075015_100316506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 862 | Open in IMG/M |
| 3300006102|Ga0075015_100970460 | Not Available | 519 | Open in IMG/M |
| 3300006172|Ga0075018_10114985 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300006172|Ga0075018_10233416 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300006172|Ga0075018_10326223 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006172|Ga0075018_10423930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300006173|Ga0070716_100871999 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006174|Ga0075014_100059362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1671 | Open in IMG/M |
| 3300006175|Ga0070712_100225576 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300006175|Ga0070712_100553501 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006354|Ga0075021_10659308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 670 | Open in IMG/M |
| 3300006573|Ga0074055_11585548 | Not Available | 516 | Open in IMG/M |
| 3300006795|Ga0075520_1068075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1669 | Open in IMG/M |
| 3300006847|Ga0075431_100315412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 1577 | Open in IMG/M |
| 3300006864|Ga0066797_1271423 | Not Available | 592 | Open in IMG/M |
| 3300007258|Ga0099793_10369704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 2S1 | 702 | Open in IMG/M |
| 3300007788|Ga0099795_10449443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300010038|Ga0126315_11175491 | Not Available | 520 | Open in IMG/M |
| 3300010043|Ga0126380_10156647 | Not Available | 1467 | Open in IMG/M |
| 3300010043|Ga0126380_11189401 | Not Available | 656 | Open in IMG/M |
| 3300010047|Ga0126382_11965863 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010360|Ga0126372_11020878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300010375|Ga0105239_11116065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 908 | Open in IMG/M |
| 3300010376|Ga0126381_102185719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300012683|Ga0137398_10155615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1486 | Open in IMG/M |
| 3300012902|Ga0157291_10264545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300014165|Ga0181523_10260804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300014495|Ga0182015_10148395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1595 | Open in IMG/M |
| 3300016341|Ga0182035_11564054 | Not Available | 594 | Open in IMG/M |
| 3300016357|Ga0182032_11963745 | Not Available | 513 | Open in IMG/M |
| 3300016422|Ga0182039_12077134 | Not Available | 523 | Open in IMG/M |
| 3300016445|Ga0182038_12027934 | Not Available | 521 | Open in IMG/M |
| 3300017970|Ga0187783_10537267 | Not Available | 847 | Open in IMG/M |
| 3300018006|Ga0187804_10296484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300018044|Ga0187890_10677169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 582 | Open in IMG/M |
| 3300018468|Ga0066662_12324419 | Not Available | 563 | Open in IMG/M |
| 3300021170|Ga0210400_10254238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1437 | Open in IMG/M |
| 3300021178|Ga0210408_10386532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1115 | Open in IMG/M |
| 3300025549|Ga0210094_1078585 | Not Available | 609 | Open in IMG/M |
| 3300025864|Ga0209429_10346992 | Not Available | 558 | Open in IMG/M |
| 3300025899|Ga0207642_10491146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 750 | Open in IMG/M |
| 3300025910|Ga0207684_11605202 | Not Available | 527 | Open in IMG/M |
| 3300026325|Ga0209152_10166474 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300027882|Ga0209590_10200557 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300027894|Ga0209068_10734559 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028784|Ga0307282_10588785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300028807|Ga0307305_10428657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 596 | Open in IMG/M |
| 3300028819|Ga0307296_10109530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1482 | Open in IMG/M |
| 3300028879|Ga0302229_10159925 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300030007|Ga0311338_10612683 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300030494|Ga0310037_10115892 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300031344|Ga0265316_10165778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1650 | Open in IMG/M |
| 3300031572|Ga0318515_10783283 | Not Available | 503 | Open in IMG/M |
| 3300031744|Ga0306918_11283744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300031753|Ga0307477_10367040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 989 | Open in IMG/M |
| 3300031753|Ga0307477_10978483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 556 | Open in IMG/M |
| 3300031777|Ga0318543_10492456 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031890|Ga0306925_12196641 | Not Available | 513 | Open in IMG/M |
| 3300031912|Ga0306921_12152562 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032059|Ga0318533_10223491 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300032205|Ga0307472_101318287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | 696 | Open in IMG/M |
| 3300033004|Ga0335084_10027379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5821 | Open in IMG/M |
| 3300033158|Ga0335077_10608278 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300033402|Ga0326728_10394310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 | 1187 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 14.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.13% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001177 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 | Environmental | Open in IMG/M |
| 3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001407 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101893422 | 3300000567 | Peatlands Soil | PLIGAFLLWAIMDISAHAISLADGLNRAKWVTSVRKRREDRSSISSHPLADLGG* |
| KanNP_Total_noBrdU_T14TCDRAFT_10056041 | 3300000596 | Soil | LELDGLLAIMDISARAISLADRPQRAIWVTSVRTRREDRTSISSHPLADLGR* |
| AF_2010_repII_A10DRAFT_10114701 | 3300000816 | Forest Soil | IMDISAPAISLAVRPQWAIWVTSVRMRREDRSSIRFHPLADLGG* |
| JGI12032J12867_10034251 | 3300000912 | Forest Soil | LEHVLRAIMDISAHAISLAEGLNGAIRVTSVRMRREDRSSIIVHPLADSGG* |
| JGI10216J12902_1017056241 | 3300000956 | Soil | LELGGLLAIMENSALAISLADRPQRAIWVTSVRMRR |
| JGI12634J13548_10020271 | 3300001177 | Forest Soil | RSLLELFLLPTIMDISARAVSLADRPQRAIRVTRVRMRREDRSSISTYPLADLGG* |
| JGI20175J14863_10240692 | 3300001396 | Arctic Peat Soil | RVVLRAIMDISARAISLAEGLERAIWVISXRMRREDRTSISFHPLADLGR* |
| JGI20192J14887_10015591 | 3300001407 | Arctic Peat Soil | ISARAFSLADRPQRAIRVTSVRMRREDRSSISSYPLADLGG* |
| JGI20196J14858_10151421 | 3300001417 | Arctic Peat Soil | IRSLIGAVLLRTIMDISARAVSLSDRPQWASWVTSVRMRREDRSSISSHPLADLGG* |
| JGI24745J21846_10178172 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | VLHQCMRSLIGVGLLQTIMDISARAFSLADRPQRAIWVTSVRMRREDRSSISSHPLADLGR* |
| C688J35102_1205251181 | 3300002568 | Soil | RTIMDISARAFSLPDRPQRVIWVTSVRKRREDRSSISSYPLADLGE* |
| JGI25404J52841_100191082 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LEHVLLLAIMGISARAISLADRPQRAIRVTSVRKRREDRTSISSHPLADLGG* |
| Ga0055437_100726112 | 3300004009 | Natural And Restored Wetlands | SAHAISLPARPQWAIWVTSVRMRREDRTSIPIYPLADLGG* |
| Ga0063454_1006524342 | 3300004081 | Soil | VLRTIMDISARAFSLPDRPQRVIWVTSVRKRREDRSSISSYPLADLGE* |
| Ga0063356_1010615113 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDISAPAASLADRPQRAIWVTSVRKRREDRTSISSQSLADLGMTG |
| Ga0066869_101092862 | 3300005165 | Soil | MRSLIGVGLLQTIMDISARAFSLADRPQRAIWVTSVRMRREDRSSISSHPLADLGR* |
| Ga0066673_100576602 | 3300005175 | Soil | MDISAQTSSFAERPQRAMWVTSVRMRWEDQTSISSHLLADLGG* |
| Ga0066673_103600521 | 3300005175 | Soil | VLRAIMDISARAISLAERPLGAIWVTSVRTRREDRTSISCYLLADLGG* |
| Ga0066684_102167001 | 3300005179 | Soil | MDISAQASSLAERPQRAMWVTSVRMRWEDQTSISSHLLADLGG* |
| Ga0066684_103241383 | 3300005179 | Soil | LERVVLRAIMDISAPAISLADRPQRAIRVTSVRMRREDRSSISSRPLADLGR* |
| Ga0066671_108006812 | 3300005184 | Soil | LEPFVLRAIMGISARATSLAEGPQGAIGVTSVRMRREDRSSISF* |
| Ga0066676_106998833 | 3300005186 | Soil | MLRAIMDISARAISLADRPQRAIRVTSVRVRREDRSSISFHPLADLGG* |
| Ga0065705_111527941 | 3300005294 | Switchgrass Rhizosphere | MLLAIMENSARAISLADRPQRAIRVTSVRTRREDPTSISSHPLADLGR* |
| Ga0066388_1066728861 | 3300005332 | Tropical Forest Soil | MLLAIMDISARASSLADRPQRAMRVTSVRMRREDRTSISSHPLADLGR* |
| Ga0066388_1087629222 | 3300005332 | Tropical Forest Soil | MDISARAISLGEGLNQAIWVTSVRIRREDRSSIVVSNPLADLGRRESGYV |
| Ga0070661_1013831361 | 3300005344 | Corn Rhizosphere | MDISAPAASLADRPQWAIWVTSVRMRREDRTSISSQSLADL |
| Ga0070673_1000471155 | 3300005364 | Switchgrass Rhizosphere | MDISARAFSLADRPQRAIWVTSVRMRREDRSSISSHPLADLGR* |
| Ga0070714_1009034262 | 3300005435 | Agricultural Soil | LEPFVPRAIMDISAPAISLAVRPQWAIWVTSVRMRREDRSSISFYPLADLGR* |
| Ga0070713_1004859803 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LERVVLRAIMDISARAISLTDRPQRAIWVTSVRMRREDRTTISSHPLADL |
| Ga0070713_1010149992 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PFVPRAIMDISAPAISLAVRPQWAIWVTSVRMRREDRSSISFYPLADLGR* |
| Ga0070713_1019003282 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVVVLLAIMDISARAVSLPDRPQRAIRVTSFRMRREDRTSISSHPLADLGR* |
| Ga0066681_101500042 | 3300005451 | Soil | VLRAIMDISARAISLAVRPQRAIWVTSVRKRREDRSSISFSFFADLGR* |
| Ga0070730_109572132 | 3300005537 | Surface Soil | LILERVMLRATMDISAHAISLRPGLDRANRVTSIRTHREDRSSISSYPLADLVGG* |
| Ga0066697_101118381 | 3300005540 | Soil | MDISARAISLAVRPQRAIWVTSVRKRREDRSSISSYPLADLGE* |
| Ga0066670_101364441 | 3300005560 | Soil | VLRAIMDISARAISLADRPQRAIRVTSVRMRREDRSSISSRPLADLGR* |
| Ga0066905_1009022532 | 3300005713 | Tropical Forest Soil | VLRAIMDISARATSLADRPQRAIRVTSVRMRREDRSSISFYPLADLGR* |
| Ga0066903_1012029104 | 3300005764 | Tropical Forest Soil | VLQAIMDISARAISLAVRPQWAIGVTRVRMRREDRSSISF |
| Ga0066903_1014245722 | 3300005764 | Tropical Forest Soil | MLRAIMDISARAISLAEGLERAIGVTSVRMRREDRSTIVVHPLADLGR* |
| Ga0066903_1045267962 | 3300005764 | Tropical Forest Soil | LELFVLRAIMGISARAISLADRPQRAMWVTRVRMRR |
| Ga0075273_101234182 | 3300005902 | Rice Paddy Soil | IGAVLPATMDISARAISLPDRPHRAIWVTSVRTRREDRSSISSHPLADLGRN* |
| Ga0081540_10365603 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LELDLLLAIMDISARAISLPDRSQRTIWVTSARMRREDRASTSYPLADLGKYSIGRF* |
| Ga0075024_1001322311 | 3300006047 | Watersheds | VLRAIMDISARAISLADRPQRAIRVTSVRMRREDRT |
| Ga0075024_1002987231 | 3300006047 | Watersheds | MLRATMDISAHAISLTPGLDRANRATSIRTHREDRSSISSYPLADLVGG* |
| Ga0075024_1002988062 | 3300006047 | Watersheds | LERFVLLAIMDISAPASSLSEDLNWASRVTSVRMRREDRTSISSHP |
| Ga0075024_1009070021 | 3300006047 | Watersheds | MLRAIMDISARATSLTDRPQWAMWVTSFRMRREDRTSISSYPLADLGG* |
| Ga0075364_103262472 | 3300006051 | Populus Endosphere | SLLAIMDISAGAISLAERPDRAIWVTSVRTRREDRISISSRSLADLGR* |
| Ga0075026_1004578042 | 3300006057 | Watersheds | MDISAQASSLAERPQRTIWVTSVRMRREDRTSISSHLLADLGG* |
| Ga0075017_1001939001 | 3300006059 | Watersheds | LERFVLLATMDISARAVSLADRPQWAIWVTSVRMRREDR |
| Ga0075017_1002161851 | 3300006059 | Watersheds | SLLERVVLRAIMDISARAISLADRPQRAIRVTSVRMRREDRTSISSHPLADLGG* |
| Ga0075015_1000672162 | 3300006102 | Watersheds | LERFVLLATMDISARAVSLADRPQWAIWVTSVRMRRE |
| Ga0075015_1003165062 | 3300006102 | Watersheds | VLLATMDISARAVSLADRPQWAIWVTSVRMRREDRSSISFHLLADLG |
| Ga0075015_1009704602 | 3300006102 | Watersheds | LAERPQRTIWVTSVRMRREDRTSISFHPLADLGG* |
| Ga0075018_101149851 | 3300006172 | Watersheds | VLLAIMDISARAISLPDRPQRAIRVTSVRRRREDRTSISSHP |
| Ga0075018_102334161 | 3300006172 | Watersheds | AIMDISARAFSLADRPQRAIRVTSVRMRREDRSSISSHPLADLGG* |
| Ga0075018_103262232 | 3300006172 | Watersheds | MERVVLRAIMDISARAISLADRPQRAIRVTSVRMRREDRTSISSHSLADLGR* |
| Ga0075018_104239301 | 3300006172 | Watersheds | VLTTPLCLEPFVPRAIMDISAPAISLAVRPQWAIWVTSVRMRREDRSSISF |
| Ga0070716_1008719992 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LERVVLRAIMDISARAISLTDRPQRAIWVTSVRMRREDRTSISSHPLADLGR* |
| Ga0075014_1000593623 | 3300006174 | Watersheds | PLIGRVVLRAIMDISAPAISLPDGLERAIWVTSVRMRREDRTSISS* |
| Ga0070712_1002255762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLCLEPFVPRAIMDISAPAISLAVRPQWAIWVTSVRMRREDRSSISFYPLADLGR* |
| Ga0070712_1005535011 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRATMDISARTSSLPERPQRTIWVTSVRMRREDRTSVSSHPLADLGG* |
| Ga0075021_106593081 | 3300006354 | Watersheds | VLRAIMDISARAISLADRPQRAIWVTSVRMRREDR |
| Ga0074055_115855482 | 3300006573 | Soil | LLAIMGISAPAILLAERPRRAIWVTSVRKRREDRISISSRSLADLGN* |
| Ga0075520_10680751 | 3300006795 | Arctic Peat Soil | LRTIMDISARAFSLADRPQRAIRVTSVRMRREDRSSISSYPLADLGG* |
| Ga0075431_1003154122 | 3300006847 | Populus Rhizosphere | MLRAIMDISARAISLPDRRQRANWVTSVRMRREDRSSISSHPLADLGK* |
| Ga0066797_12714232 | 3300006864 | Soil | DISARAVSLSDRPQWASWVTSVRMRREDRSSISTYPLADLGG* |
| Ga0099793_103697041 | 3300007258 | Vadose Zone Soil | VLLAIMGSSAHAISLAGRPQRAIWVTSSHMRREDRSSIS |
| Ga0099795_104494432 | 3300007788 | Vadose Zone Soil | MDISARAVSLSDRPQWASWVTSVRMRREDRSSISSHPLADL |
| Ga0126315_111754911 | 3300010038 | Serpentine Soil | MDISARAVSLADRPQRAIRVTSVRMRREDRTSISSQSLADLGMT |
| Ga0126380_101566471 | 3300010043 | Tropical Forest Soil | VLRAIMDISARAFSLADRPQAGAIRVTRVRMRREDRSSISFHPLADLGRKTGTMSSLPPD |
| Ga0126380_111894011 | 3300010043 | Tropical Forest Soil | MGLPAIMENSAPASSLADRPQRAIRVTRVRMRREDRTSISSHPLADLGR |
| Ga0126382_119658631 | 3300010047 | Tropical Forest Soil | LLRATMGISARATSLADRPEQAIRVTSARTRREDRSSISFESLADLGVSVA |
| Ga0126372_110208781 | 3300010360 | Tropical Forest Soil | VLRAIMDTSARAISLAVRPQRAIWVTSVRMRREDRSSISFSS |
| Ga0126378_120146351 | 3300010361 | Tropical Forest Soil | MDISAQASSLAERPQRAIRVTSVRVRREDRTSILS |
| Ga0105239_111160651 | 3300010375 | Corn Rhizosphere | MRSLIGVGLLQTIMDISARAFSLADRPQRAIWVTSVRMRREDRSSISSHP |
| Ga0126381_1021857191 | 3300010376 | Tropical Forest Soil | VLRAIMDISAHAFFLADRPQAGAIWVTRVRMRREDRSSISFHP |
| Ga0137398_101556153 | 3300012683 | Vadose Zone Soil | VLRTIMDISARAFSLADRPQRAIWVTSVRMRREDRSSISTYPLA |
| Ga0157291_102645451 | 3300012902 | Soil | MDISAPVASLADRPQRAIWVTSVRKRREDRTSISSQSLADLGKTGIAVPVINY |
| Ga0181523_102608041 | 3300014165 | Bog | VLLATMDISAHAVSLAVRPRWAIGVTSVRMRREDRSSISFH |
| Ga0182015_101483953 | 3300014495 | Palsa | LRAIMDISARAFSLADRPQRAIRVTSVRKRREDRTSISTYPLADLGG* |
| Ga0182035_115640541 | 3300016341 | Soil | MDISAQASSLADRPQRTIRVTSVRMRREDRTSISSHLLADLG |
| Ga0182032_119637451 | 3300016357 | Soil | MDISARGNSLTDRPQRAIWVTSVRMRREDRTSISCDDALVFF |
| Ga0182039_120771341 | 3300016422 | Soil | VLRAIMGISARAISLPERPQRAVGVISARMRREDQSSISF |
| Ga0182038_120279341 | 3300016445 | Soil | VLRAIMDISALAFSLADRPQRAIRVTRVRKRRDDR |
| Ga0187783_105372671 | 3300017970 | Tropical Peatland | MGISALANSLGERPQRTIWVTSVRMRREDRTSIPSHPFADLGGYASEA |
| Ga0187804_102964842 | 3300018006 | Freshwater Sediment | MDISAQANSLVERPQRTIWVTSVRVRREDRTSISFHPLADLGRQL |
| Ga0187890_106771692 | 3300018044 | Peatland | MLLASMHISAHAVSLADRPQWAIRVTSVRMRREDRSSISFHLLADLGGE |
| Ga0066662_123244191 | 3300018468 | Grasslands Soil | VLRAIMGISARATSLAEGPQGAIGVTSVRMRREDRSSIS |
| Ga0210400_102542381 | 3300021170 | Soil | GLCVERVVLRAIMDISARAISLTDRPQPAIWVTSVRMRREDRTSISSHPLADLGR |
| Ga0210408_103865324 | 3300021178 | Soil | VLLATMDISAHAISLADRPQWAIRVTSVRTCREDRSSISFYPL |
| Ga0210094_10785851 | 3300025549 | Natural And Restored Wetlands | MLLAIMDISAHAISLPARPQWAIWVTSVRMRREDRTSIPIH |
| Ga0209429_103469921 | 3300025864 | Arctic Peat Soil | MGISARAISLADRPQRAIWVTSVRMRREDRSSISSYLLA |
| Ga0207642_104911461 | 3300025899 | Miscanthus Rhizosphere | MRSLIGVGLLQTIMDISARAFSLADRPQRAIWVTSVRMRREDRSSISSHPLADLGR |
| Ga0207684_116052021 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ISLADGPQRAIWVTSVRVRREDRSSISSYPLADLGG |
| Ga0209152_101664742 | 3300026325 | Soil | KQTFLKSVGMSLELVVLRTIMDISARAFSLPDRPQRVIWVTSVRKRREDRSSISSYPLADLGE |
| Ga0209590_102005571 | 3300027882 | Vadose Zone Soil | ERFVLLAIMDISARAISLADRPHWAIRVTSVRMRREDRSSISSHPLADLGR |
| Ga0209068_107345592 | 3300027894 | Watersheds | MLLATMDISARAVSLADRPQWAIWVTSVRMRREDR |
| Ga0307282_105887851 | 3300028784 | Soil | VLRTIMDISARAFSLPDRPQRVIWVTSVRKRREDRSS |
| Ga0307305_104286572 | 3300028807 | Soil | VLRAIMDISARAISLTDRPQRAIWVTSVRMRREDRT |
| Ga0307296_101095301 | 3300028819 | Soil | VLRAIMDISARAISLTDRPQRAIWVTSVRMRREDRTSISSHPLAD |
| Ga0302229_101599251 | 3300028879 | Palsa | RAIMDISARAFSLADRPQRAIRVTSVRKRREDRTSISTYPLADLGG |
| Ga0311338_106126831 | 3300030007 | Palsa | LRTIMDISARATSLADRPQRAIRVTSVRMRREDRSSISTYPLADLGG |
| Ga0310037_101158921 | 3300030494 | Peatlands Soil | EHVVLRAIMDISARAISLADRPQRAIRVTSVRMRREDRTSISSHPLADLGR |
| Ga0265316_101657784 | 3300031344 | Rhizosphere | LLRTIMDISARAISLTDRPQRAIWVTSVRTRSEDR |
| Ga0318515_107832832 | 3300031572 | Soil | VLRAIMGISARAISLPERPQRAVGVISARMRREDQSSISFLI |
| Ga0306918_112837442 | 3300031744 | Soil | MLRAIMGISARAISLAVRPQRAVGVTSARMRREDRSS |
| Ga0307477_103670401 | 3300031753 | Hardwood Forest Soil | MLLAIMDISARATSLAERSQLDHYRVTSVRMRREDRTSISSHLS |
| Ga0307477_109784831 | 3300031753 | Hardwood Forest Soil | MDISAQASSLAERPQRTVWVTSVRMRREDRTSISSHPLADLGGILFSN |
| Ga0318509_101669602 | 3300031768 | Soil | LKLRAVMDISAQASSLAERPQRAIRVTSVRVRREDRTSIMS |
| Ga0318543_104924561 | 3300031777 | Soil | VLRAIMDISARAISLADRPQGAIWVTGVRMRREYRSSIS |
| Ga0306925_121966411 | 3300031890 | Soil | VPLAIMDISAPAISLAVRPQWAIWVTSVRMRREDRSS |
| Ga0318520_101806192 | 3300031897 | Soil | LELTLRAVMDISAQASSLAERPQRAIRVTSVRVRREDRTSILS |
| Ga0306921_121525621 | 3300031912 | Soil | VLRAIMGISARATSLPERPQGAIWVTSVRMHREDRSSISFL |
| Ga0318533_102234911 | 3300032059 | Soil | LKLRAVMDISAQAISLPERPQRTIWVTSFRMRREDRTSISSYPLADLGG |
| Ga0307472_1013182872 | 3300032205 | Hardwood Forest Soil | VLLAIMDISAHAISLPNRPQRAIWVTSARMRQKDRT |
| Ga0335084_100273791 | 3300033004 | Soil | VLLAIMDISARASSLPDRPQRAIWVTSVRMRREDPTSISSH |
| Ga0335077_106082781 | 3300033158 | Soil | RAIMDISAHAISLADRPQRAKGVTSARTRREDRLSISV |
| Ga0326728_103943101 | 3300033402 | Peat Soil | VLLATMDISARAVSLADRPQWAIRVTRVRMRREDRSSISFHLL |
| ⦗Top⦘ |