| Basic Information | |
|---|---|
| Family ID | F077725 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MEGFVAHKLNEFETGKISRRRLIETLTLAATTAYAADSANAASPR |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 93.16 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 65.81 |
| PF15956 | DUF4760 | 2.56 |
| PF12681 | Glyoxalase_2 | 2.56 |
| PF13356 | Arm-DNA-bind_3 | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF06751 | EutB | 0.85 |
| PF08450 | SGL | 0.85 |
| PF05721 | PhyH | 0.85 |
| PF01738 | DLH | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.85 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.85 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.58 % |
| Unclassified | root | N/A | 3.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104953033 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300004268|Ga0066398_10042983 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005332|Ga0066388_103846721 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005337|Ga0070682_101770166 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005447|Ga0066689_10694183 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005533|Ga0070734_10370114 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005576|Ga0066708_10075140 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300005615|Ga0070702_100619140 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005952|Ga0080026_10210865 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006032|Ga0066696_10557648 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006034|Ga0066656_10507670 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006046|Ga0066652_101035585 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006047|Ga0075024_100609099 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006172|Ga0075018_10284623 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006174|Ga0075014_100894671 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006354|Ga0075021_11120302 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006914|Ga0075436_100735782 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006954|Ga0079219_10183618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1163 | Open in IMG/M |
| 3300007788|Ga0099795_10036486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1725 | Open in IMG/M |
| 3300009090|Ga0099827_11910956 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009100|Ga0075418_10409717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1450 | Open in IMG/M |
| 3300009156|Ga0111538_11920530 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009792|Ga0126374_11030183 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009826|Ga0123355_10626702 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300009826|Ga0123355_10880582 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300010047|Ga0126382_10788634 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010048|Ga0126373_10740829 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300010162|Ga0131853_10867189 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300010329|Ga0134111_10261605 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010359|Ga0126376_12764016 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010360|Ga0126372_10485538 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300010361|Ga0126378_11987415 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010362|Ga0126377_10692319 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300010376|Ga0126381_100030647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6411 | Open in IMG/M |
| 3300010376|Ga0126381_101140759 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300010376|Ga0126381_104147453 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010379|Ga0136449_102832118 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010379|Ga0136449_103936325 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010400|Ga0134122_11365350 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010400|Ga0134122_12390894 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010866|Ga0126344_1450624 | Not Available | 518 | Open in IMG/M |
| 3300011269|Ga0137392_10029313 | All Organisms → cellular organisms → Bacteria | 3972 | Open in IMG/M |
| 3300011444|Ga0137463_1149836 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300012202|Ga0137363_11482065 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012203|Ga0137399_10741010 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012212|Ga0150985_112433631 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012351|Ga0137386_10625120 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012362|Ga0137361_11453831 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012469|Ga0150984_100468000 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012917|Ga0137395_10082736 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300012918|Ga0137396_10871057 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012927|Ga0137416_10581556 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012929|Ga0137404_11003647 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012929|Ga0137404_11026594 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012948|Ga0126375_10018802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3168 | Open in IMG/M |
| 3300012948|Ga0126375_11864845 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012971|Ga0126369_10440788 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300012988|Ga0164306_11063964 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300014968|Ga0157379_11056062 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300015245|Ga0137409_10886183 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300016341|Ga0182035_10561133 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300016404|Ga0182037_11096204 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300016404|Ga0182037_11195693 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016422|Ga0182039_10754419 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR3 | 861 | Open in IMG/M |
| 3300016445|Ga0182038_11658752 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300018007|Ga0187805_10610139 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018071|Ga0184618_10285176 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300018482|Ga0066669_11304530 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300019879|Ga0193723_1155661 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300020580|Ga0210403_10890302 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300021170|Ga0210400_10845620 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300021171|Ga0210405_10988242 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021180|Ga0210396_10640277 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300021181|Ga0210388_10310349 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300021344|Ga0193719_10139190 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300021477|Ga0210398_10179301 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300021860|Ga0213851_1528609 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300022499|Ga0242641_1016569 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300022756|Ga0222622_10600295 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027383|Ga0209213_1070558 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300027535|Ga0209734_1091033 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027663|Ga0208990_1146401 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300027698|Ga0209446_1138622 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027882|Ga0209590_10118593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1605 | Open in IMG/M |
| 3300027907|Ga0207428_11077589 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027908|Ga0209006_10806473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → unclassified Acidocella → Acidocella sp. 20-63-7 | 760 | Open in IMG/M |
| 3300028814|Ga0307302_10081482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1533 | Open in IMG/M |
| 3300028828|Ga0307312_10770089 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300030000|Ga0311337_11944424 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030520|Ga0311372_11281161 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031094|Ga0308199_1192479 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031099|Ga0308181_1077186 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031226|Ga0307497_10228079 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031421|Ga0308194_10157315 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300031543|Ga0318516_10259870 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031708|Ga0310686_106719376 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300031708|Ga0310686_111631932 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031708|Ga0310686_115182786 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031713|Ga0318496_10314880 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031715|Ga0307476_10110809 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300031715|Ga0307476_10851639 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031719|Ga0306917_10055427 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300031719|Ga0306917_10315480 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031720|Ga0307469_11749830 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031798|Ga0318523_10512909 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031859|Ga0318527_10496144 | Not Available | 521 | Open in IMG/M |
| 3300031890|Ga0306925_10059197 | All Organisms → cellular organisms → Bacteria | 4010 | Open in IMG/M |
| 3300031941|Ga0310912_10709963 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031954|Ga0306926_12899921 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032035|Ga0310911_10785241 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032039|Ga0318559_10522122 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032059|Ga0318533_10887678 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032076|Ga0306924_12282134 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032174|Ga0307470_11098907 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032515|Ga0348332_10147233 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049530332 | 3300000364 | Soil | MQGXVXQKLNDFETGKISRRRLIETLTLAATTAYAADNAQAQE |
| Ga0066398_100429832 | 3300004268 | Tropical Forest Soil | MEGFVAHKLAEFEQGKISRRRFIETLTVAATTAYAADRADAAESQGLKA |
| Ga0066388_1038467212 | 3300005332 | Tropical Forest Soil | MEGFVAAKLDEFDRGKISRRRLLEALTLAATTFYATDGAKAQTTAQASGSGIKV |
| Ga0070682_1017701662 | 3300005337 | Corn Rhizosphere | MEGYVAQKLNEFETGKISRRRLIETLTFAATSAYAAGSASAQS |
| Ga0066689_106941831 | 3300005447 | Soil | MEGFVATKLNEFEQGKISRRKLIETLTLAATTVYATGAQAA |
| Ga0070734_103701141 | 3300005533 | Surface Soil | MEGFVAQKLNEFETGKISRRKLIETLTLAATTAAAAD |
| Ga0066708_100751403 | 3300005576 | Soil | MQGFVATKLDEFERGKISRRRLIEALTLTATTAYAA |
| Ga0070702_1006191401 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGYVAQKLNEFETGKISRRRLIETLTFAATSAYAAGSASAQSESPLKAQLINHV |
| Ga0080026_102108651 | 3300005952 | Permafrost Soil | MEGFAAQKLNEFETGKISRRGLIESLTLAATTLYAA |
| Ga0066696_105576482 | 3300006032 | Soil | MQGFVAAKLDEFERGKISRRRLIEALTLIATTAYAADSAKAQKA |
| Ga0066656_105076702 | 3300006034 | Soil | MDGFVAAKLDDFERGKISRRRLIETLTLAATTAYAADN |
| Ga0066652_1010355851 | 3300006046 | Soil | MDGFVASKLDEFDQGKISRRRLIETLTLAATTAYA |
| Ga0075024_1006090991 | 3300006047 | Watersheds | MEGYVATKLDEFDRGRISRRRLIEALTFAATSAAATGSAKA |
| Ga0075018_102846233 | 3300006172 | Watersheds | MEGFAAQKLNEFETGKISRRGLIESLTLAATTLYATDSAKAQADQT |
| Ga0075014_1008946712 | 3300006174 | Watersheds | MEGFAAQKLNEFETGKISRRKLIESLTLAATTLYSADAAKAQ |
| Ga0075021_111203021 | 3300006354 | Watersheds | MEGFAAQKLNEFETGKISRRGLIESLTLAATTLYA |
| Ga0075436_1007357822 | 3300006914 | Populus Rhizosphere | MEGFVAQKLNEFETGKISRRRLIETLTFAATSAYAAGGASAQSETPLKAQLI |
| Ga0079219_101836183 | 3300006954 | Agricultural Soil | MEGFVAQKLNEFETGKISRRRLIEALTLAATSVYAAGSASAG |
| Ga0099795_100364861 | 3300007788 | Vadose Zone Soil | MVMEGFVAHKLAEFEQGKISRRGLIETLTLAATTAYAADRAGAAEQPGLKAALV |
| Ga0099827_119109561 | 3300009090 | Vadose Zone Soil | MEGFVAQKLNEFETGKISRRRLIETLTLAATSAYAAGSASAQSESPLKAQ |
| Ga0075418_104097171 | 3300009100 | Populus Rhizosphere | MEGFVAQKLNEFETGKISRRRLIETLTFAATSAYAAGGASAQ |
| Ga0111538_119205302 | 3300009156 | Populus Rhizosphere | MEAFVAQMLEKFEQGKISRRKLIETLAIAATTIYGS |
| Ga0126374_110301831 | 3300009792 | Tropical Forest Soil | MEGFVATKLDEFDRGRISRRRLIETLTLAATSAYAADAAKAQAPG |
| Ga0123355_106267023 | 3300009826 | Termite Gut | MEGFVAHKLNQYATGKLSRRALIETLTLAATTAYA |
| Ga0123355_108805822 | 3300009826 | Termite Gut | MEGFVAHKLNEYITGKLSRRALIETLTLAATTAYATGANAADQPGI |
| Ga0126382_107886341 | 3300010047 | Tropical Forest Soil | MEGFVANKLAEFDQGKISRRKLIETLTLAATTAYAADRAGAAEQPGLK |
| Ga0126373_107408292 | 3300010048 | Tropical Forest Soil | MEGFVAQKLNEFETGKISRRKLIETLTLAATTVAAADSAKAQADPTLKAQLL |
| Ga0131853_108671891 | 3300010162 | Termite Gut | MEGFVAHQLAEFEQGKISRRKLIETLTLAVTTAYTAERAGAAEQPGLKVALINHI |
| Ga0134111_102616052 | 3300010329 | Grasslands Soil | MEGFVATKLHEFEQGKISRRKLIETLTAAATTLYA |
| Ga0126376_127640162 | 3300010359 | Tropical Forest Soil | MEGFVAQKLNEFETGKISRRRLIETLTLAATSAYAAGSAAAQGESPL |
| Ga0126372_104855383 | 3300010360 | Tropical Forest Soil | MEGFVAHKLAEFEQGKISRRKLIETLTLAATAAYAAGGAGAAESQGL |
| Ga0126378_119874151 | 3300010361 | Tropical Forest Soil | MEGFVAQKLNEFETGKISRRRLIETLTLAATTVAAAGGAKAQADPTLKAQL |
| Ga0126377_106923192 | 3300010362 | Tropical Forest Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATTAYAT |
| Ga0126381_1000306478 | 3300010376 | Tropical Forest Soil | MEGFVAQKLNEFETGKISRRKLIETLTLAATTVAAADSAKAQADPTLKA |
| Ga0126381_1011407593 | 3300010376 | Tropical Forest Soil | MEGYAAQKLNEFETGKISRRALIESLTLAATTLYATGNAAAQAPSPLK |
| Ga0126381_1041474531 | 3300010376 | Tropical Forest Soil | MEGFVAHKLAEFEQGKISRRRLIETLTLAATTAYAADRADAAESQG |
| Ga0136449_1028321182 | 3300010379 | Peatlands Soil | MEAFVAKQLYDFETGKISRRKLIETLAAATTAYAAGTADAAESTGLK |
| Ga0136449_1039363252 | 3300010379 | Peatlands Soil | MEGFVAQKLNEFETGKISRRKLIETLTLAATTVYPAGSAKAQADTTL |
| Ga0134122_113653502 | 3300010400 | Terrestrial Soil | MEGLVAQKLNDFETGKISRRKLIETLTLAATTAYAADSAKAQMINPLKAQL |
| Ga0134122_123908942 | 3300010400 | Terrestrial Soil | MEGFVAQKLNEFETGKISRRRLIETLTLAATTAYAADSARAQDNTL |
| Ga0126344_14506241 | 3300010866 | Boreal Forest Soil | MEGFVAHKLNDYANGKISRRGLIEALTLAATTVYAGSAKAADSPGLKMALINHV |
| Ga0137392_100293137 | 3300011269 | Vadose Zone Soil | MVMEGFVAHQLAEFEQGKISRRRLIETLTLAATAAYGADRAGAAEQPGLK |
| Ga0137463_11498363 | 3300011444 | Soil | MDGFVATKLDEFDRGKISRRKLIETLTLAATTAYAAAPTQAQAQQAP |
| Ga0137363_114820652 | 3300012202 | Vadose Zone Soil | MVMEGFVAHKLAEFEQGKISRRRLIETLTLAATAAYGADRAGAAE |
| Ga0137399_107410102 | 3300012203 | Vadose Zone Soil | MEGFVATKLAEFDQGKISRRRLIEALTLAATTVYATEGAKAQ |
| Ga0150985_1124336312 | 3300012212 | Avena Fatua Rhizosphere | MQGFVAQKLFEFESGKISRRRLIETLTLAATTVYAADKSSAQAQENPLKAQLIN |
| Ga0137386_106251202 | 3300012351 | Vadose Zone Soil | MDGFVATKLDEFERGKISRRRLIETLTLAATTAYAADGASAQ |
| Ga0137361_114538312 | 3300012362 | Vadose Zone Soil | MEGFVATKLDEFDRGKISRRRLIEALTLAATTAYATDGAKAQGS |
| Ga0150984_1004680002 | 3300012469 | Avena Fatua Rhizosphere | MEGFVAQKLNDYATGNMSRRGLIEMLTLAATTAYAGSAKAQ |
| Ga0137395_100827365 | 3300012917 | Vadose Zone Soil | MEGFVATKLDEFDRGRISRRRLIETLTLAATSAYAADGA |
| Ga0137396_108710571 | 3300012918 | Vadose Zone Soil | MQGFVAQKLNDFETGKISRRKLIETLTLAATTTAAAESAQAQESPLK |
| Ga0137416_105815563 | 3300012927 | Vadose Zone Soil | MEGFVAHKLNEFETGKISRRRLIETLTLAATSAYAAGSASAQSESPLKAQLIN |
| Ga0137416_112505082 | 3300012927 | Vadose Zone Soil | MEGFVATKLEEFEQGKLSRRRLIETLTLAASTVYAA |
| Ga0137404_110036471 | 3300012929 | Vadose Zone Soil | MDGFVAHQLDEFTKGRLSRRRLIEMLTLAATTAYATGEAGAQE |
| Ga0137404_110265942 | 3300012929 | Vadose Zone Soil | MEGFAAQKLNEFETGKISRRGLIESLTLAATTLYAADSAK |
| Ga0126375_100188025 | 3300012948 | Tropical Forest Soil | MEGFVAQKLNEFETGKISRRRLIEMLTLAATSAYAVGSASA |
| Ga0126375_118648452 | 3300012948 | Tropical Forest Soil | MEGFVAHKLAEFEQGKISRRKLIETLTLAATTAYMADRAGAAEQPGLK |
| Ga0126369_104407881 | 3300012971 | Tropical Forest Soil | MEGFVAHKLNEYATGKLSRRALIETLTLAATTVYAGGAGAAEQSGIKLALVN |
| Ga0164306_110639642 | 3300012988 | Soil | MEGYVAQKLNEFETGKISRRRLIEALTFAATSAYAAGSASAQSESPLKAQLI |
| Ga0157379_110560622 | 3300014968 | Switchgrass Rhizosphere | MDGFVAHQLDEFTKGRLSRRRLIEMLTLAATTAYATGEAGAQESPLK |
| Ga0137409_108861832 | 3300015245 | Vadose Zone Soil | MEGFVAQKLNDYATGKISRRGLIEMLTLAATSAYAGSAKAQQVPG |
| Ga0182035_105611332 | 3300016341 | Soil | MEGFVATKLDEFDRGRISRRRLIETLTLAATSAYAA |
| Ga0182037_110962042 | 3300016404 | Soil | MEGFVATKLDEFDRGLISRRRLIETLTLAATTAYTTGGAKAE |
| Ga0182037_111956931 | 3300016404 | Soil | MEGFVAHKLAEFEQGKINRRKLIETLTFAATTAYATGSAGAAETQGLKA |
| Ga0182039_107544192 | 3300016422 | Soil | MEGFVAHKLTEFEQGKISRRKLIETLTLAATTAYAADRAGAAGEPSLKAALI |
| Ga0182038_116587521 | 3300016445 | Soil | MEAFVAHKLNEFETGKISRRKLIETLTLAATTAAATSSAEAQNPDPTLKA |
| Ga0187805_106101391 | 3300018007 | Freshwater Sediment | MEGFVAHKLAEFEQGRISRRKLIETLTVAATTAYAADRAGA |
| Ga0184618_102851762 | 3300018071 | Groundwater Sediment | MEGFVAHKLNEFETGKISRRRLIEMLTLAATSAYAAGSASAQSESPL |
| Ga0066669_113045302 | 3300018482 | Grasslands Soil | MEGFVAQRLNDFETGKISSRKLIETLTLAATATSAAGSA |
| Ga0193723_11556611 | 3300019879 | Soil | MDGFVATKLDEFDRGKISRRKLIEALTLAATTAYA |
| Ga0210403_108903022 | 3300020580 | Soil | MEGFVAHTLNEFEQGKISRRKLIETLTLAATTAYAAGSAG |
| Ga0210400_108456202 | 3300021170 | Soil | MEGFVAHKLNEYANGRISRRGLIESLTLAATTLYAGGADAAEQPGVTVALINHVSYT |
| Ga0210405_109882421 | 3300021171 | Soil | MEGFVAHKLNDYANGKISRRGLIETLTLAATTAYAGGAKAADSPGLK |
| Ga0210396_106402773 | 3300021180 | Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATTAYATESAKAE |
| Ga0210388_103103491 | 3300021181 | Soil | MEGFVAHKLNEYANGKISRRGLVETLTLVATTAYAGGAKAADAPGISMALINHIS |
| Ga0193719_101391901 | 3300021344 | Soil | MQGFVAQKLNDFETGKISRRKLIETLTLAATTTAAAKSAQAQESPLKAQ |
| Ga0210398_101793013 | 3300021477 | Soil | MEGFVAHKLNEYANGKISRRGLVETLTLVATTVYAGGAKAADAPGISMA |
| Ga0213851_15286092 | 3300021860 | Watersheds | MEGFVAHQLNAFEQGKISRRKLIETLTFAATSAYATGSAGAAETAGL |
| Ga0242641_10165692 | 3300022499 | Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATTAYATESAKAEGPGLKVALVN |
| Ga0222622_106002952 | 3300022756 | Groundwater Sediment | MDGFVATKLDEFERGKISRRRLIETLTLAATTAYAADGASAQKADP |
| Ga0209213_10705581 | 3300027383 | Forest Soil | MFGFAATKLDEFEQGKISRRKLIETLTLAATTLFAAEGAG |
| Ga0209734_10910331 | 3300027535 | Forest Soil | MEGFVAHKLNEFETGKISRRRLIETLTLAATTAYAADSANAASPRDAAL |
| Ga0208990_11464012 | 3300027663 | Forest Soil | MDGFVAHQLDEFTKGRLSRRRLIEMLTLAATTAYATGEAGAQEQPLK |
| Ga0209446_11386221 | 3300027698 | Bog Forest Soil | MEGFVAHKLNDYANGKISRRGLIEALTLAATTIYAGGAKAADGPGVKVALINHVSYTCPNFKQ |
| Ga0209580_102229581 | 3300027842 | Surface Soil | MEGYVAAKLNEFENGKISRRRLIETLTLAATTVYAADG |
| Ga0209590_101185931 | 3300027882 | Vadose Zone Soil | MEGFVATKLHEFEQGKISRRTLIETLTLAATTLYAAE |
| Ga0207428_110775892 | 3300027907 | Populus Rhizosphere | MEGFVAQKLNEFETGKISRRRLIETLTLAATSAYAAGSASAQSES |
| Ga0209006_108064731 | 3300027908 | Forest Soil | MEGFVAHKLNEFETGKISRRRLIETLTLAATTAYAADSANAASPR |
| Ga0307302_100814821 | 3300028814 | Soil | MEGFVAQKLNEFETGRISRRRLIETLTLAATSAYAAGSASAQGES |
| Ga0307312_107700892 | 3300028828 | Soil | MDGFVATKLDEFERGKISRRRLIETLTLAATTAYA |
| Ga0311337_119444241 | 3300030000 | Fen | MEGFVAHQLDAFTEGKLSRRRLIEMLTLAATTAYATDKAAAQAESPLK |
| Ga0311372_112811611 | 3300030520 | Palsa | MEGFVAQKLHDFENGKISRRRLIETLTLAATTVYAGGAGAAESP |
| Ga0308199_11924792 | 3300031094 | Soil | MEGYVATKLDEFDRGRISRRRLIEALTMAATSVYATGSAKAQ |
| Ga0308181_10771861 | 3300031099 | Soil | MEGFVAHKLNEFETGKISRRRLIETLTLAATSAYAAGSASAQGESPLKAQ |
| Ga0307497_102280791 | 3300031226 | Soil | MEGFVAHKLNEFETGKISRRRLIETLTFAATSAYAAGSASAQGESPLKA |
| Ga0308194_101573151 | 3300031421 | Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATSVYATDSAKAQTAGPPLK |
| Ga0318516_102598701 | 3300031543 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYATGAKAQADATLKAQLV |
| Ga0310686_1067193761 | 3300031708 | Soil | MEGFVATKLDEFDRGKISRRRHIETLTLAATTAYATESAKAEG |
| Ga0310686_1116319322 | 3300031708 | Soil | MEGFVAHKLSEYANGRISRRGLIESLTLAATTLYAGGAKAAEQPGLTVALINH |
| Ga0310686_1151827862 | 3300031708 | Soil | MEGFVAHKLNEYATGKLSRRGLIETLTLAATTAYAGGAKAAEQSG |
| Ga0318496_103148802 | 3300031713 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYA |
| Ga0307476_101108091 | 3300031715 | Hardwood Forest Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATTAYATDGAKAQNSAL |
| Ga0307476_108516392 | 3300031715 | Hardwood Forest Soil | MEGFVAHKLHEYATGKLGRRALIETLTLAATTAYASDVKAAEEPGIKLA |
| Ga0306917_100554275 | 3300031719 | Soil | MEGFVATKLDEFDRGKISRRRLIETLTLAATTAYTTGGAKAEGPALKVALVN |
| Ga0306917_103154803 | 3300031719 | Soil | MEGFVAHKLAEFEQGKINRRKLIETLTFAATTAYATGSAGAAETQGLKAALVN |
| Ga0307469_117498302 | 3300031720 | Hardwood Forest Soil | MQGFVAQKLNDFETGKISRRKLIETLTLAATTAYAADN |
| Ga0318523_105129091 | 3300031798 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYATGAK |
| Ga0318527_104961442 | 3300031859 | Soil | MEGYAAQKLNEFETGKISRRALIESLTLAATTLYATGNAAAQAPS |
| Ga0306925_100591971 | 3300031890 | Soil | MEGFIATKLDEFDRGKISRRHLIESLTLAATTAYATGGAKAEGPAL |
| Ga0310912_107099632 | 3300031941 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYAT |
| Ga0306926_128999212 | 3300031954 | Soil | MEGFVATKLDEFDRGKISRRRLIEALTLAATSACAA |
| Ga0310911_107852411 | 3300032035 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYATSAK |
| Ga0318559_105221221 | 3300032039 | Soil | MEGFVAHQLHEFETGKLSRRALIETLTLAATTLYATGAKAQADAT |
| Ga0318533_108876782 | 3300032059 | Soil | MEGFVATKLDEFDRGRISRRRLIETLTLAATSAFAAD |
| Ga0306924_122821341 | 3300032076 | Soil | MEAFVAHKLNEFETGKISRRKLIETLTLAATTAAATSSAEAQNPDP |
| Ga0307470_110989072 | 3300032174 | Hardwood Forest Soil | MEGFVAHKLNEFETGKISRRRLIETLTLAATSAYAAGSASAQGESPL |
| Ga0348332_101472331 | 3300032515 | Plant Litter | MEGFVAHKLTEFETGKISRRRLIETLTLAATTAYAADSANAASVR |
| ⦗Top⦘ |