Basic Information | |
---|---|
Family ID | F077714 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 41 residues |
Representative Sequence | MRSNGYISPLQTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 25.64 % |
% of genes near scaffold ends (potentially truncated) | 44.44 % |
% of genes from short scaffolds (< 2000 bps) | 58.12 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.650 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (9.402 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.043 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.863 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00202 | Aminotran_3 | 42.74 |
PF04138 | GtrA | 17.95 |
PF01066 | CDP-OH_P_transf | 7.69 |
PF03473 | MOSC | 4.27 |
PF00857 | Isochorismatase | 3.42 |
PF12867 | DinB_2 | 3.42 |
PF02744 | GalP_UDP_tr_C | 2.56 |
PF04542 | Sigma70_r2 | 1.71 |
PF03023 | MurJ | 1.71 |
PF00326 | Peptidase_S9 | 0.85 |
PF01592 | NifU_N | 0.85 |
PF00510 | COX3 | 0.85 |
PF08240 | ADH_N | 0.85 |
PF07726 | AAA_3 | 0.85 |
PF00012 | HSP70 | 0.85 |
PF00156 | Pribosyltran | 0.85 |
PF07681 | DoxX | 0.85 |
PF08281 | Sigma70_r4_2 | 0.85 |
PF01436 | NHL | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 7.69 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 7.69 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 7.69 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 3.42 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.42 |
COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.71 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.71 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.71 |
COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.71 |
COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 1.71 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.85 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.85 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.65 % |
Unclassified | root | N/A | 27.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2032320006|FACEOR_FYWIORV02G3202 | Not Available | 500 | Open in IMG/M |
3300000567|JGI12270J11330_10003621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11041 | Open in IMG/M |
3300000567|JGI12270J11330_10106057 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300000567|JGI12270J11330_10184121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 733 | Open in IMG/M |
3300000567|JGI12270J11330_10279231 | Not Available | 527 | Open in IMG/M |
3300001356|JGI12269J14319_10003193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 15465 | Open in IMG/M |
3300001356|JGI12269J14319_10003648 | All Organisms → cellular organisms → Bacteria | 14386 | Open in IMG/M |
3300001356|JGI12269J14319_10149809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300001546|JGI12659J15293_10019116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1820 | Open in IMG/M |
3300001593|JGI12635J15846_10000172 | All Organisms → cellular organisms → Bacteria | 49467 | Open in IMG/M |
3300001661|JGI12053J15887_10262819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 854 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100106117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2635 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100283921 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101316156 | Not Available | 614 | Open in IMG/M |
3300004080|Ga0062385_10039423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1964 | Open in IMG/M |
3300004080|Ga0062385_10433687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 794 | Open in IMG/M |
3300004091|Ga0062387_100078320 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300004091|Ga0062387_100905753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 668 | Open in IMG/M |
3300004091|Ga0062387_100996732 | Not Available | 642 | Open in IMG/M |
3300004092|Ga0062389_103017649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 629 | Open in IMG/M |
3300004635|Ga0062388_102161978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 578 | Open in IMG/M |
3300005178|Ga0066688_10086576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1891 | Open in IMG/M |
3300005468|Ga0070707_100038588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4563 | Open in IMG/M |
3300005518|Ga0070699_100941113 | Not Available | 792 | Open in IMG/M |
3300005537|Ga0070730_10259860 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300005569|Ga0066705_10279502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300005591|Ga0070761_10066248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2046 | Open in IMG/M |
3300005610|Ga0070763_10426680 | Not Available | 749 | Open in IMG/M |
3300005712|Ga0070764_10082532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1694 | Open in IMG/M |
3300005994|Ga0066789_10005376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5650 | Open in IMG/M |
3300006052|Ga0075029_100088754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1842 | Open in IMG/M |
3300006059|Ga0075017_100705993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 776 | Open in IMG/M |
3300006102|Ga0075015_100642485 | Not Available | 625 | Open in IMG/M |
3300006102|Ga0075015_100998956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 512 | Open in IMG/M |
3300006162|Ga0075030_100015790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6557 | Open in IMG/M |
3300006162|Ga0075030_100024709 | All Organisms → cellular organisms → Bacteria | 5151 | Open in IMG/M |
3300006172|Ga0075018_10427045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 678 | Open in IMG/M |
3300006174|Ga0075014_100516850 | Not Available | 671 | Open in IMG/M |
3300006354|Ga0075021_10040786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2664 | Open in IMG/M |
3300006354|Ga0075021_10578874 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009089|Ga0099828_10003360 | All Organisms → cellular organisms → Bacteria | 11181 | Open in IMG/M |
3300009143|Ga0099792_10624967 | Not Available | 689 | Open in IMG/M |
3300009518|Ga0116128_1001404 | All Organisms → cellular organisms → Bacteria | 10659 | Open in IMG/M |
3300009519|Ga0116108_1006316 | All Organisms → cellular organisms → Bacteria | 4920 | Open in IMG/M |
3300009547|Ga0116136_1037974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 1419 | Open in IMG/M |
3300009624|Ga0116105_1013249 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → unclassified Candidatus Brocadia → Candidatus Brocadia sp. | 1688 | Open in IMG/M |
3300009639|Ga0116122_1011710 | All Organisms → cellular organisms → Bacteria | 3304 | Open in IMG/M |
3300009683|Ga0116224_10229990 | Not Available | 886 | Open in IMG/M |
3300009762|Ga0116130_1019794 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
3300010341|Ga0074045_10292559 | Not Available | 1069 | Open in IMG/M |
3300010343|Ga0074044_10008271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8105 | Open in IMG/M |
3300010379|Ga0136449_100208893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3696 | Open in IMG/M |
3300012096|Ga0137389_11582193 | Not Available | 551 | Open in IMG/M |
3300012202|Ga0137363_10032443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3620 | Open in IMG/M |
3300012923|Ga0137359_10063287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3226 | Open in IMG/M |
3300014156|Ga0181518_10000996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 29942 | Open in IMG/M |
3300014169|Ga0181531_10048850 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
3300014638|Ga0181536_10155839 | Not Available | 1194 | Open in IMG/M |
3300014657|Ga0181522_10001747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12932 | Open in IMG/M |
3300015193|Ga0167668_1070567 | Not Available | 696 | Open in IMG/M |
3300017823|Ga0187818_10012626 | All Organisms → cellular organisms → Bacteria | 3618 | Open in IMG/M |
3300017823|Ga0187818_10015200 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
3300017928|Ga0187806_1109399 | Not Available | 888 | Open in IMG/M |
3300017931|Ga0187877_1002700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15445 | Open in IMG/M |
3300017938|Ga0187854_10005799 | All Organisms → cellular organisms → Bacteria | 8745 | Open in IMG/M |
3300017940|Ga0187853_10125829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 1243 | Open in IMG/M |
3300017943|Ga0187819_10003120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8861 | Open in IMG/M |
3300017943|Ga0187819_10032650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3074 | Open in IMG/M |
3300017959|Ga0187779_10394257 | Not Available | 901 | Open in IMG/M |
3300017972|Ga0187781_10000386 | All Organisms → cellular organisms → Bacteria | 31368 | Open in IMG/M |
3300018034|Ga0187863_10026464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3477 | Open in IMG/M |
3300018038|Ga0187855_10062707 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
3300018040|Ga0187862_10504186 | Not Available | 728 | Open in IMG/M |
3300018047|Ga0187859_10004393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8524 | Open in IMG/M |
3300018057|Ga0187858_10162004 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300018086|Ga0187769_10491590 | Not Available | 926 | Open in IMG/M |
3300018089|Ga0187774_10385457 | Not Available | 847 | Open in IMG/M |
3300019256|Ga0181508_1216261 | Not Available | 603 | Open in IMG/M |
3300019284|Ga0187797_1080991 | Not Available | 509 | Open in IMG/M |
3300019284|Ga0187797_1765906 | Not Available | 881 | Open in IMG/M |
3300020582|Ga0210395_10704652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 755 | Open in IMG/M |
3300021405|Ga0210387_10311816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1385 | Open in IMG/M |
3300021407|Ga0210383_10027570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4749 | Open in IMG/M |
3300021478|Ga0210402_10000028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 129909 | Open in IMG/M |
3300021478|Ga0210402_10584709 | Not Available | 1035 | Open in IMG/M |
3300021478|Ga0210402_11008557 | Not Available | 759 | Open in IMG/M |
3300022533|Ga0242662_10156449 | Not Available | 693 | Open in IMG/M |
3300025473|Ga0208190_1000448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17118 | Open in IMG/M |
3300025480|Ga0208688_1048985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300025507|Ga0208188_1000688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18211 | Open in IMG/M |
3300025527|Ga0208714_1002658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4920 | Open in IMG/M |
3300025576|Ga0208820_1075060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 877 | Open in IMG/M |
3300027110|Ga0208488_1080353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 529 | Open in IMG/M |
3300027394|Ga0209904_1000398 | All Organisms → cellular organisms → Bacteria | 4077 | Open in IMG/M |
3300027565|Ga0209219_1005555 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300027570|Ga0208043_1055458 | Not Available | 1148 | Open in IMG/M |
3300027587|Ga0209220_1176945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300027605|Ga0209329_1070266 | Not Available | 756 | Open in IMG/M |
3300027643|Ga0209076_1051270 | Not Available | 1168 | Open in IMG/M |
3300027645|Ga0209117_1085296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300027815|Ga0209726_10035732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3736 | Open in IMG/M |
3300027846|Ga0209180_10001204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12841 | Open in IMG/M |
3300027879|Ga0209169_10004817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7816 | Open in IMG/M |
3300027882|Ga0209590_10316654 | Not Available | 1003 | Open in IMG/M |
3300027905|Ga0209415_11150430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 500 | Open in IMG/M |
3300027911|Ga0209698_10047933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3766 | Open in IMG/M |
3300028869|Ga0302263_10202333 | Not Available | 791 | Open in IMG/M |
3300029917|Ga0311326_10100197 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300031524|Ga0302320_10175893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3143 | Open in IMG/M |
3300031718|Ga0307474_10019108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4980 | Open in IMG/M |
3300031754|Ga0307475_10546389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
3300031823|Ga0307478_10725068 | Not Available | 833 | Open in IMG/M |
3300032782|Ga0335082_10394827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1248 | Open in IMG/M |
3300032805|Ga0335078_10003585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23089 | Open in IMG/M |
3300032829|Ga0335070_10009809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11208 | Open in IMG/M |
3300032829|Ga0335070_10681047 | Not Available | 962 | Open in IMG/M |
3300033402|Ga0326728_10006874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30076 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 9.40% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.40% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.40% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.84% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.27% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.71% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACEORE_2985050 | 2032320006 | Soil | FEGPPRSERDIMLLAAMRSNGSISGMCWIEGRACPRRYLSMLPSHVRANLFGSD |
JGI12270J11330_100036216 | 3300000567 | Peatlands Soil | MRSNGYISLIGACWIEGRACPRRYLSFLPSHVRANLFGCD* |
JGI12270J11330_101060572 | 3300000567 | Peatlands Soil | MLIVTMRSKGYISPLQTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
JGI12270J11330_101841212 | 3300000567 | Peatlands Soil | MRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCDNFLSYLLLS |
JGI12270J11330_102792311 | 3300000567 | Peatlands Soil | TRDIMFIVTMRSNGYISLFQECWIEGGACPRRYLSVLPSHVRANLFGSD* |
JGI12269J14319_100031936 | 3300001356 | Peatlands Soil | MFIVTMRSNGYISLFQECWIEGGACPRRYLSVLPSHVRANLFGSD* |
JGI12269J14319_100036488 | 3300001356 | Peatlands Soil | MRSNGYISPLGTXWIEGRACPRRYLSVXPSHVRANLFGSD* |
JGI12269J14319_101498092 | 3300001356 | Peatlands Soil | MRSDGHVSPLQTCWIEGRACPRRYLSLLPSHVRANLFGGD* |
JGI12659J15293_100191163 | 3300001546 | Forest Soil | MRCNGFIPPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD* |
JGI12635J15846_1000017251 | 3300001593 | Forest Soil | MLAAMRSNGYISLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
JGI12053J15887_102628192 | 3300001661 | Forest Soil | MFAAAMRSNGYIPLLRTCWVEGRACPRRYLSVLPSHVRANLFGSD* |
JGIcombinedJ26739_1001061172 | 3300002245 | Forest Soil | MLLKGSIPSMCWIEGRACPRRYLSVLPSHVRANLFGSD* |
JGIcombinedJ26739_1002839211 | 3300002245 | Forest Soil | PTQDIMFVAAMRSNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
JGIcombinedJ26739_1013161561 | 3300002245 | Forest Soil | PIVMRCNGFIPPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0062385_100394232 | 3300004080 | Bog Forest Soil | MSVVAMRSNGYISLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0062385_104336872 | 3300004080 | Bog Forest Soil | MRSNRYISPLQTCWIEGRACPRRYLSVLPSHARANLFGSD* |
Ga0062387_1000783202 | 3300004091 | Bog Forest Soil | MRSNRDISPLQTCWIEGLACPRRYLSVLPSRVRANLFGSD* |
Ga0062387_1009057532 | 3300004091 | Bog Forest Soil | MRSHGYIPLLMTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0062387_1009967322 | 3300004091 | Bog Forest Soil | RDQSRDILSIVTMRSTGYISPLQTCWIEGLACPRRYLSVLPSHVRANLFGSD* |
Ga0062389_1030176491 | 3300004092 | Bog Forest Soil | MRSNPYISLETCWVEGRACPRRYLSILPSRVRANLFGSD* |
Ga0062388_1021619781 | 3300004635 | Bog Forest Soil | MRSNGYISPFQACWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0066688_100865762 | 3300005178 | Soil | MRSNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0070707_1000385881 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLAAMRSNGSISGMCWIEGRACPRRYLSMLPSHVRANLFGSD* |
Ga0070699_1009411131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIMHSNGSISRMCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0070730_102598602 | 3300005537 | Surface Soil | MRSNGYISLETCWINGRACPRRYLSVLPSHVRANLFGSD* |
Ga0066705_102795022 | 3300005569 | Soil | MHSNGSISRMCWVEGGACPRRYLSVLPSNVRANLFGSD* |
Ga0070761_100662483 | 3300005591 | Soil | MRCNGYIPPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0070763_104266802 | 3300005610 | Soil | SNGYISLLRTCWIEGRACPRRYLSVLPSHARANLFGSD* |
Ga0070764_100825322 | 3300005712 | Soil | MRSKNYISPLQTCWIEGRACPRRYLSVLPSHARANLFGSD* |
Ga0066789_100053767 | 3300005994 | Soil | MFVAAMRSNGYISPLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075029_1000887542 | 3300006052 | Watersheds | MRSNGSISRLRLCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075017_1007059931 | 3300006059 | Watersheds | MRSNGYISPLQTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075015_1006424852 | 3300006102 | Watersheds | VIMRSSGSISRLRMCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075015_1009989562 | 3300006102 | Watersheds | MRLKGSISGMCWVEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075030_1000157906 | 3300006162 | Watersheds | MRLNGSISGMCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075030_1000247096 | 3300006162 | Watersheds | MRTNGSISRICWIKGLACPRRYLSLLPSHVRANLFGSD* |
Ga0075018_104270452 | 3300006172 | Watersheds | MRSNGSNSGLRICWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075014_1005168502 | 3300006174 | Watersheds | DILLVAAMRSKGYISPLQACWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075021_100407863 | 3300006354 | Watersheds | MLSNGSNSGLRICWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0075021_105788742 | 3300006354 | Watersheds | MTIVAMRSKNSISRETCWIEGRACPRRYLSVLPSRMRANLFGD* |
Ga0099828_1000336013 | 3300009089 | Vadose Zone Soil | MHSNGSISRMCWVEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0099792_106249671 | 3300009143 | Vadose Zone Soil | NGSISRMCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0116128_10014047 | 3300009518 | Peatland | MLAVAMRFNGYISLLQTCWIEGRACPRRYLSVLPSRVRANLFGSD* |
Ga0116108_10063166 | 3300009519 | Peatland | MSVAAMHSNVYISPFQACWIEGRACPRRYLSVLPSHVRANLFGCD* |
Ga0116136_10379741 | 3300009547 | Peatland | MLAVAMRFNGYISLLQTCWIEGRACPRRYLSLLPSNVRANLFGSD* |
Ga0116105_10132492 | 3300009624 | Peatland | MRRNGYISPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0116122_10117102 | 3300009639 | Peatland | MRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD* |
Ga0116224_102299902 | 3300009683 | Peatlands Soil | AMRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD* |
Ga0116130_10197941 | 3300009762 | Peatland | LFLVAMRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD* |
Ga0074045_102925591 | 3300010341 | Bog Forest Soil | NGSISRICWIKGLACPRRYLSLLPSHVRANLFGSD* |
Ga0074044_100082717 | 3300010343 | Bog Forest Soil | MRVKAHIPLLQACWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0136449_1002088935 | 3300010379 | Peatlands Soil | MRSNGYISPLQTCWIEGRACPRRYLSVLPSHVRANLFG |
Ga0137389_115821931 | 3300012096 | Vadose Zone Soil | IMHSNGSISRMCWVEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0137363_100324434 | 3300012202 | Vadose Zone Soil | MSVAAMRSNGYIPLLRSCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0137359_100632874 | 3300012923 | Vadose Zone Soil | MRSNGYIPLLRSCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0181518_1000099627 | 3300014156 | Bog | MRLSIYIPILQACWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0181531_100488501 | 3300014169 | Bog | PPENTGYNRIVIMRLPSSILAMCWIEGRACPRRYLSVLPSRVRANLFGSD* |
Ga0181536_101558391 | 3300014638 | Bog | NGYISLLQTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0181522_1000174714 | 3300014657 | Bog | MRLKGSISDMSWVEGRACPRRYLSVLPSNVRANLFGSD* |
Ga0167668_10705672 | 3300015193 | Glacier Forefield Soil | YIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD* |
Ga0187818_100126262 | 3300017823 | Freshwater Sediment | MRSNGYISLLQECWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0187818_100152002 | 3300017823 | Freshwater Sediment | MHPNGSISRMCWIEGRACPRRYLCVLPSHVRANLFGSD |
Ga0187806_11093992 | 3300017928 | Freshwater Sediment | AMRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD |
Ga0187877_10027005 | 3300017931 | Peatland | MLAVAMRFNGYISLLQTCWIEGRACPRRYLSVLPSRVRANLFGSD |
Ga0187854_100057993 | 3300017938 | Peatland | MSVAAMHSNVYISPFQACWIEGRACPRRYLSVLPSHVRANLFGCD |
Ga0187853_101258291 | 3300017940 | Peatland | GDIMLAVAMRFNGYISLLQTCWIEGRACPRRYLSLLPSNVRANLFGSD |
Ga0187819_100031208 | 3300017943 | Freshwater Sediment | MRSNGYISLLQECWIKGRACPRRYLSVLPSHVRANLFGSD |
Ga0187819_100326503 | 3300017943 | Freshwater Sediment | MRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD |
Ga0187779_103942572 | 3300017959 | Tropical Peatland | GYISLLQECWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0187781_1000038623 | 3300017972 | Tropical Peatland | MRSCGSNSLRICWIEGLACPRRYLHFLPSRMRANLFGD |
Ga0187863_100264642 | 3300018034 | Peatland | MSLVMRSKGYNSPLRSSWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0187855_100627073 | 3300018038 | Peatland | MRWTGYISPLQTCWIEGLACPRRYLSVLPSHVRANLFGSD |
Ga0187862_105041862 | 3300018040 | Peatland | VAMRSNGYISLIGACWIEGRACPRRYLSVLPSHVRANLFGCD |
Ga0187859_100043934 | 3300018047 | Peatland | MFLVMRRNGYISPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0187858_101620042 | 3300018057 | Peatland | TGDIMLAVAMRFNGYISLLQTCWIEGRACPRRYLSLLPSNVRANLFGSD |
Ga0187769_104915902 | 3300018086 | Tropical Peatland | MRSNGSIPGICWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0187774_103854572 | 3300018089 | Tropical Peatland | AVAMRSNGSISRLQLCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0181508_12162611 | 3300019256 | Peatland | QSSILAMCWIEGRACPRRYLSVLPSRVRANLFGSD |
Ga0187797_10809911 | 3300019284 | Peatland | NGSIPGICWIEGRACPRRYLSVLPSHVRANLFGSY |
Ga0187797_17659061 | 3300019284 | Peatland | SKGSIAVRICWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0210395_107046521 | 3300020582 | Soil | MRCNGYIPPLGSSWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0210387_103118162 | 3300021405 | Soil | AGYNGTSDMRLTGSNSLPGMCWIEGRACPRRYLSVLPSRVRANLFGSD |
Ga0210383_100275703 | 3300021407 | Soil | MSIAAMRSKGYISPLQTCWIEGRACPRRYLSVLPSHARANLFGSD |
Ga0210402_1000002850 | 3300021478 | Soil | MRTNGSISRMCWIEGRACPRRYLCVLPSNVRANLFGSD |
Ga0210402_105847092 | 3300021478 | Soil | NGSISRMCWIEGRACPRRYLCVLPSNMRAGLFGSD |
Ga0210402_110085572 | 3300021478 | Soil | LMLLKDSISGLCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0242662_101564492 | 3300022533 | Soil | SNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0208190_10004483 | 3300025473 | Peatland | MRSKSSIPAMCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0208688_10489853 | 3300025480 | Peatland | MLAVAMRFNGYISLLQTCWIEGRACPRRYLSVLPSRVRANLFG |
Ga0208188_100068813 | 3300025507 | Peatland | MLAVAMRFNGYISLLQTCWIEGRACPRRYLSLLPSNVRANLFGSD |
Ga0208714_10026583 | 3300025527 | Arctic Peat Soil | MMLAAMRSNGHISLEICWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0208820_10750601 | 3300025576 | Peatland | MHSNVYISPFQACWIEGRACPRRYLSVLPSHVRANLF |
Ga0208488_10803531 | 3300027110 | Forest Soil | MRSNGYISLLRTCWIEGRACPRRYLSVLPSHARANLFGSD |
Ga0209904_10003985 | 3300027394 | Thawing Permafrost | MLIIAMRSNSYISLLQECWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209219_10055554 | 3300027565 | Forest Soil | MRSNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0208043_10554582 | 3300027570 | Peatlands Soil | NGYISLIGACWIEGRACPRRYLSFLPSHVRANLFGCD |
Ga0209220_11769452 | 3300027587 | Forest Soil | MFTAAMRSNGYISLLRTCWVEGRACPRRYLSVLPSHVRANL |
Ga0209329_10702661 | 3300027605 | Forest Soil | AAMRSNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209076_10512701 | 3300027643 | Vadose Zone Soil | VTMRSNGYIPLLRSCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209117_10852962 | 3300027645 | Forest Soil | MSEAAMRSNGYISLLRTCWIEGRACPRRYLSVLPSHVRANLFGS |
Ga0209726_100357325 | 3300027815 | Groundwater | MRSNGSISRMCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209180_100012042 | 3300027846 | Vadose Zone Soil | MHSNGSISRMCWVEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209169_100048172 | 3300027879 | Soil | MRSKNYISPLQTCWIEGRACPRRYLSVLPSHARANLFGSD |
Ga0209590_103166541 | 3300027882 | Vadose Zone Soil | FVVAMRSNGYIPLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0209415_111504302 | 3300027905 | Peatlands Soil | MFIVAMRSNGYISVIGTCWIEGRACPRRYLSVLPSHVRAN |
Ga0209698_100479334 | 3300027911 | Watersheds | MRLNGSISGMCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0302263_102023331 | 3300028869 | Fen | PLAAMRPNGSISRMCWVEGRACPRRYLCVLPSHVRANLFGSD |
Ga0311326_101001971 | 3300029917 | Bog | AAMRMNGYISPFPTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0302320_101758932 | 3300031524 | Bog | MRWNGYIPLFQACWIEGRACPRRYLSLLPSHVRANLFGD |
Ga0307474_100191082 | 3300031718 | Hardwood Forest Soil | MSVAAMRSNGYISLLRTCWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0307475_105463892 | 3300031754 | Hardwood Forest Soil | MPVAAMRSNGYISLLRTCWVEGRACPRRYLSVLPSHVRANLFGS |
Ga0307478_107250681 | 3300031823 | Hardwood Forest Soil | FFMRSKGSISGLCWIEGRACPRRYLSVLPSNVRANLFGSD |
Ga0335082_103948271 | 3300032782 | Soil | MRSNGSISRMCWIEGRACPRRYLCVLPSNMRAGLFGS |
Ga0335078_1000358518 | 3300032805 | Soil | MRSQGPISANGWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0335070_100098095 | 3300032829 | Soil | MRSKGSISANGWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0335070_106810471 | 3300032829 | Soil | NCGYNQGVNLRSNGSISRLRICWIEGRACPRRYLSVLPSHVRANLFGSD |
Ga0326728_100068749 | 3300033402 | Peat Soil | MRSLGSNSLRICWIEGRACPRRYLRLLPSRMRANLFGD |
⦗Top⦘ |