NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077689

Metagenome / Metatranscriptome Family F077689

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077689
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 42 residues
Representative Sequence VTISQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Number of Associated Samples 106
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.71 %
% of genes near scaffold ends (potentially truncated) 96.58 %
% of genes from short scaffolds (< 2000 bps) 89.74 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(24.786 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.573 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13419HAD_2 8.55
PF00005ABC_tran 6.84
PF12730ABC2_membrane_4 3.42
PF04909Amidohydro_2 3.42
PF08450SGL 2.56
PF12679ABC2_membrane_2 2.56
PF07883Cupin_2 1.71
PF136224HBT_3 1.71
PF08241Methyltransf_11 1.71
PF12802MarR_2 1.71
PF01740STAS 0.85
PF03029ATP_bind_1 0.85
PF01909NTP_transf_2 0.85
PF03435Sacchrp_dh_NADP 0.85
PF00067p450 0.85
PF02016Peptidase_S66 0.85
PF13738Pyr_redox_3 0.85
PF01450IlvC 0.85
PF07721TPR_4 0.85
PF07690MFS_1 0.85
PF12867DinB_2 0.85
PF03466LysR_substrate 0.85
PF01906YbjQ_1 0.85
PF00266Aminotran_5 0.85
PF05762VWA_CoxE 0.85
PF13280WYL 0.85
PF12833HTH_18 0.85
PF06628Catalase-rel 0.85
PF04341DUF485 0.85
PF12680SnoaL_2 0.85
PF00583Acetyltransf_1 0.85
PF03551PadR 0.85
PF00501AMP-binding 0.85
PF00196GerE 0.85
PF13091PLDc_2 0.85
PF13530SCP2_2 0.85
PF00106adh_short 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 2.56
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 2.56
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 1.71
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.85
COG0753CatalaseInorganic ion transport and metabolism [P] 0.85
COG1100GTPase SAR1 family domainGeneral function prediction only [R] 0.85
COG1619Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling)Cell wall/membrane/envelope biogenesis [M] 0.85
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.85
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.85
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.85
COG2124Cytochrome P450Defense mechanisms [V] 0.85
COG2229Signal recognition particle receptor subunit beta, a GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.85
COG3162Uncharacterized membrane protein, DUF485 familyFunction unknown [S] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.76 %
UnclassifiedrootN/A16.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005332|Ga0066388_103781333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300005338|Ga0068868_100090471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2464Open in IMG/M
3300005435|Ga0070714_100585495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1070Open in IMG/M
3300005439|Ga0070711_101441805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300005533|Ga0070734_10121793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1524Open in IMG/M
3300005541|Ga0070733_10367526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces955Open in IMG/M
3300005614|Ga0068856_102605626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300005618|Ga0068864_100902947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia872Open in IMG/M
3300006173|Ga0070716_100256490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1194Open in IMG/M
3300006175|Ga0070712_101353021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300006175|Ga0070712_102036941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300006176|Ga0070765_100027537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4365Open in IMG/M
3300006237|Ga0097621_100496818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1104Open in IMG/M
3300006578|Ga0074059_11573506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales501Open in IMG/M
3300006804|Ga0079221_10178477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis1141Open in IMG/M
3300007076|Ga0075435_100036074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3927Open in IMG/M
3300009101|Ga0105247_10115905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1730Open in IMG/M
3300009522|Ga0116218_1441218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura580Open in IMG/M
3300009525|Ga0116220_10056386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1641Open in IMG/M
3300009824|Ga0116219_10718548Not Available546Open in IMG/M
3300010043|Ga0126380_10932013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300010360|Ga0126372_11294870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii757Open in IMG/M
3300010371|Ga0134125_10594774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1223Open in IMG/M
3300010373|Ga0134128_11678379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK699Open in IMG/M
3300010376|Ga0126381_100725664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Tu60711423Open in IMG/M
3300010379|Ga0136449_101509252Not Available1028Open in IMG/M
3300010379|Ga0136449_104241243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300010396|Ga0134126_10182339All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis2524Open in IMG/M
3300010876|Ga0126361_10098452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii850Open in IMG/M
3300012957|Ga0164303_10145986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1245Open in IMG/M
3300012960|Ga0164301_11340821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii582Open in IMG/M
3300012971|Ga0126369_11898809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300013105|Ga0157369_10936333All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300014325|Ga0163163_11059438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii874Open in IMG/M
3300014501|Ga0182024_10492075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300014657|Ga0181522_10429220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii792Open in IMG/M
3300014657|Ga0181522_11008885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300016319|Ga0182033_10037975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3148Open in IMG/M
3300016341|Ga0182035_11461487Not Available615Open in IMG/M
3300017924|Ga0187820_1240710Not Available578Open in IMG/M
3300017942|Ga0187808_10373802Not Available649Open in IMG/M
3300017955|Ga0187817_10925404Not Available558Open in IMG/M
3300017995|Ga0187816_10376580All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300020580|Ga0210403_10838275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii729Open in IMG/M
3300020581|Ga0210399_11404157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae545Open in IMG/M
3300020582|Ga0210395_10923941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300020583|Ga0210401_10282058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1521Open in IMG/M
3300020583|Ga0210401_10892265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii748Open in IMG/M
3300021170|Ga0210400_10683743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300021171|Ga0210405_11151595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. HH130629-09577Open in IMG/M
3300021181|Ga0210388_10029912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4464Open in IMG/M
3300021181|Ga0210388_11293869All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300021401|Ga0210393_10704532Not Available823Open in IMG/M
3300021402|Ga0210385_10125261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1817Open in IMG/M
3300021404|Ga0210389_10663926Not Available818Open in IMG/M
3300021405|Ga0210387_10234216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1602Open in IMG/M
3300021406|Ga0210386_11397652All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300021407|Ga0210383_10895108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii756Open in IMG/M
3300021433|Ga0210391_11535521Not Available510Open in IMG/M
3300021474|Ga0210390_10164588All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300021478|Ga0210402_10310979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1459Open in IMG/M
3300021478|Ga0210402_11825979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300022529|Ga0242668_1100819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii586Open in IMG/M
3300024325|Ga0247678_1010528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1343Open in IMG/M
3300024331|Ga0247668_1061614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii759Open in IMG/M
3300024331|Ga0247668_1112008All Organisms → cellular organisms → Bacteria → Terrabacteria group553Open in IMG/M
3300025898|Ga0207692_10185583All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300025906|Ga0207699_10008117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5165Open in IMG/M
3300025906|Ga0207699_11483982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300025912|Ga0207707_10154523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2006Open in IMG/M
3300025914|Ga0207671_10856571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis719Open in IMG/M
3300025915|Ga0207693_11221023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300025929|Ga0207664_10045003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3459Open in IMG/M
3300025932|Ga0207690_10778330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300025944|Ga0207661_11444415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii631Open in IMG/M
3300027684|Ga0209626_1101735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300027795|Ga0209139_10158121All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300027853|Ga0209274_10216146Not Available977Open in IMG/M
3300027855|Ga0209693_10152028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300027895|Ga0209624_10395745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300027908|Ga0209006_10357868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1236Open in IMG/M
3300028789|Ga0302232_10050552Not Available2208Open in IMG/M
3300028906|Ga0308309_10411352All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300029943|Ga0311340_11105079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300029943|Ga0311340_11212299Not Available607Open in IMG/M
3300030007|Ga0311338_11897243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii533Open in IMG/M
3300030503|Ga0311370_10458464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1579Open in IMG/M
3300030520|Ga0311372_12433915All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300030580|Ga0311355_11619150Not Available555Open in IMG/M
3300031234|Ga0302325_11841112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii756Open in IMG/M
3300031525|Ga0302326_10380981Not Available2199Open in IMG/M
3300031564|Ga0318573_10609908Not Available587Open in IMG/M
3300031681|Ga0318572_10787148All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031718|Ga0307474_10571216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia890Open in IMG/M
3300031723|Ga0318493_10158861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 12411174Open in IMG/M
3300031744|Ga0306918_10121155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1896Open in IMG/M
3300031782|Ga0318552_10335122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300031782|Ga0318552_10729427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii506Open in IMG/M
3300031796|Ga0318576_10334341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300031798|Ga0318523_10558735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii565Open in IMG/M
3300031819|Ga0318568_10269434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25411055Open in IMG/M
3300031823|Ga0307478_10541131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii972Open in IMG/M
3300031833|Ga0310917_10990808Not Available564Open in IMG/M
3300031896|Ga0318551_10116084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1438Open in IMG/M
3300031942|Ga0310916_11664401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300031946|Ga0310910_10396855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300031946|Ga0310910_10776073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300031947|Ga0310909_10744865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300032066|Ga0318514_10361353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300032076|Ga0306924_12105554Not Available578Open in IMG/M
3300032094|Ga0318540_10034655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2204Open in IMG/M
3300032770|Ga0335085_10456403Not Available1469Open in IMG/M
3300032783|Ga0335079_11780877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300032896|Ga0335075_11374129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii598Open in IMG/M
3300032898|Ga0335072_11091617Not Available721Open in IMG/M
3300033134|Ga0335073_10655437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1159Open in IMG/M
3300034199|Ga0370514_114429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066388_10378133323300005332Tropical Forest SoilRVLSVTIGQHNTHLWSAWPQFAVTVIYAAVLLAAGGYLFRKRDA*
Ga0068868_10009047113300005338Miscanthus RhizosphereFFPDAAGRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0070714_10058549523300005435Agricultural SoilLSVTVGPSNPHLWSAWPQFLVTAIWAVVLVGVGGYLFRKRDA*
Ga0070711_10144180523300005439Corn, Switchgrass And Miscanthus RhizosphereVISVTVGGGNDHLWSAWPQFLVTVIWAVVLVGVGGYLFRKRDA*
Ga0070734_1012179323300005533Surface SoilSVTIGDNANPHLWSAWPQLGVTALWAAALLAAGAYLFPKRDA*
Ga0070733_1036752623300005541Surface SoilNANQHLWSAWPQLGVTALWALALVAAGAWLFRKRDA*
Ga0068856_10260562613300005614Corn RhizosphereFFPDAAGRVLSVTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGAYLFRKRDA*
Ga0068864_10090294723300005618Switchgrass RhizosphereHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0070716_10025649013300006173Corn, Switchgrass And Miscanthus RhizosphereSATVGQSNEHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA*
Ga0070712_10135302113300006175Corn, Switchgrass And Miscanthus RhizosphereAANQVVSVTIGNNTNPHLWSAWPQLGVTALWAAALVGAGAYLFRKRDA*
Ga0070712_10203694123300006175Corn, Switchgrass And Miscanthus RhizosphereGQHNPHLWSAWPQFGVTLVYAAVLLGIGSYLFRKRDA*
Ga0070765_10002753713300006176SoilVSVTIGNNANAHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA*
Ga0097621_10049681823300006237Miscanthus RhizosphereGRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0074059_1157350633300006578SoilDAAGRVLSVTIGQHNPHLWSAWPQFGVTLVYAAVLLGVGSYLFRKRDA*
Ga0079221_1017847733300006804Agricultural SoilGPSNPHLWSAWPQFLVTVIWAVVLVGAGGYLFRKRDA*
Ga0075435_10003607473300007076Populus RhizosphereAGRVLSVTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGSYLFRNRDA*
Ga0105247_1011590533300009101Switchgrass RhizosphereFPDAAGRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0116218_144121823300009522Peatlands SoilDAANQVVSVTIGNNANPHLWSAWPQLGVTAIWAAALLAGGAYLFRKRDA*
Ga0116220_1005638613300009525Peatlands SoilTIGSNANPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA*
Ga0116219_1071854813300009824Peatlands SoilNQVVSVTIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA*
Ga0126380_1093201323300010043Tropical Forest SoilAAGRVLSVTIGQHKKHLSSAWPQSAVTVIYAAVLLAVGGYLFRKRDA*
Ga0126372_1129487023300010360Tropical Forest SoilGGGNDHLWSAWPQFLVTVLYAVVLVGIGAYLFRKRDA*
Ga0134125_1059477423300010371Terrestrial SoilFPDAAGRVLSVTIDQHNPHLWSEWPQFGVTLIYAAVLVGVGSYLFRKRDA*
Ga0134128_1167837913300010373Terrestrial SoilHPHLWSAWPQFAVTVIWALVLVAVGAYLFRKRDA*
Ga0126381_10072566443300010376Tropical Forest SoilDAAGRVLSVTIGQQNPHLWSAWPQLGVTLVYAAVLLAVGAYLFRKRDA*
Ga0136449_10150925213300010379Peatlands SoilDNADPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA*
Ga0136449_10424124313300010379Peatlands SoilQVVSVTISGNANQHLWSAWPQLGVTALWAVALLAVGAYLFRKRDA*
Ga0134126_1018233913300010396Terrestrial SoilTTGNDTNPHLWSAWPQLGVTALWAAALVAAGAYLFRKRDA*
Ga0126361_1009845213300010876Boreal Forest SoilNVNPHLWSAWPQLGVTALWTAALVAVGAYLFRKRDA*
Ga0164303_1014598613300012957SoilRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0164301_1134082123300012960SoilGRVLSVTIGQHNPHLWSAWPQFGVTLVYAAVLLGVGSYLFRKRDA*
Ga0126369_1189880923300012971Tropical Forest SoilFPHLWSAWPQFAVTAIYAVVLLAVGGYLFRKRDA*
Ga0157369_1093633313300013105Corn RhizosphereAAGRVISVTIGQDNPHLWSAWPQFLVTVIWAVVFVAVGGYLFRKRDA*
Ga0163163_1105943813300014325Switchgrass RhizosphereNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA*
Ga0182024_1049207513300014501PermafrostNPHLWSAWPQLGVTALWAVALVGVGAYLFRKRDA*
Ga0181522_1042922023300014657BogVLSVTLPGQQNPHLWSTWPQFLVTVIWMVVLVGVGGYLFRKRDA*
Ga0181522_1100888513300014657BogDAAGRVFSVTVGPANQHLWSAWPQFLVTVVWALVLVGVGGYLFRKRDA*
Ga0182033_1003797553300016319SoilTEPHLWSAWPQFGVTLIYAAVLLAAGAYLFRKRDA
Ga0182035_1146148723300016341SoilGQSTDHVWSAWPQFGVTLIYAAVLLAVGAYLFRKRDA
Ga0187820_124071013300017924Freshwater SedimentVGQHNPHLWSAWPQFGVTLVYAAVLLGVGAYLFRKRDA
Ga0187808_1037380213300017942Freshwater SedimentTNPHLWSAWPQFGVTLVYAAVFLAAGAYLFRKRDA
Ga0187817_1092540423300017955Freshwater SedimentNRVVSVTIGGNANPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0187816_1037658023300017995Freshwater SedimentGSADPHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA
Ga0210403_1083827513300020580SoilTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA
Ga0210399_1140415723300020581SoilTIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0210395_1092394113300020582SoilVISVTVGPQNPHLWSAWPQFLVTVVWAVVLVGVGGYLFRKRDA
Ga0210401_1028205823300020583SoilVGSDNPHLWSAWPQFLVTVIWAVVLVGVGGYLFRERDA
Ga0210401_1089226523300020583SoilIGQTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA
Ga0210400_1068374333300021170SoilANQHLWSAWPQLGVTALWAAALIGAGAYLFRKRDA
Ga0210405_1115159523300021171SoilIGNNANQHLWSAWPQLGVTALWAVALIGAGAYLFRKRDA
Ga0210388_1002991213300021181SoilIAGNAPGHLWSAWPQLGVTALWAAALVAVGAFLFRKRDA
Ga0210388_1129386923300021181SoilVSVTIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0210393_1070453213300021401SoilSVTIGSNANSHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0210385_1012526133300021402SoilRSVITITVGGGNPHLWSAWPQLGVTALWAVALVGIGGYLFRKRDA
Ga0210389_1066392613300021404SoilTIGSNANSHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0210387_1023421633300021405SoilGSADPHLWSAWPQLGVTALWAAALLGAGAYLFRKRDA
Ga0210386_1139765213300021406SoilSVTIPGSADPHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA
Ga0210383_1089510813300021407SoilDAAGRVLSVTIGQTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA
Ga0210391_1153552113300021433SoilSVTIGQTNQHLWSAWPQFGVTLIYAAVFLAIGAYLFRKRDA
Ga0210390_1016458843300021474SoilVVSVTIGENANQHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0210402_1031097913300021478SoilGRVLSVTIGQTNQHLWSAWPQFGVTLIYAAVFLAVGAYLFRKRDA
Ga0210402_1182597913300021478SoilGRVLSVTIGGNSNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0242668_110081923300022529SoilVPSVTIGQTNQHLWSAWPQFGVTLIYAAVFLAVGAYLFRKRDA
Ga0247678_101052813300024325SoilIDQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA
Ga0247668_106161413300024331SoilIGQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA
Ga0247668_111200813300024331SoilVLSVTIGQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA
Ga0207692_1018558323300025898Corn, Switchgrass And Miscanthus RhizosphereVTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0207699_1000811713300025906Corn, Switchgrass And Miscanthus RhizosphereIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA
Ga0207699_1148398213300025906Corn, Switchgrass And Miscanthus RhizosphereQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA
Ga0207707_1015452333300025912Corn RhizosphereDHPHLWSAWPQFAVTVIWALVLVAVGAYLFRKRDA
Ga0207671_1085657113300025914Corn RhizosphereIGQHNPHLWSEWPQFGITLIYAAVLLGVGSYLFRKRDA
Ga0207693_1122102313300025915Corn, Switchgrass And Miscanthus RhizospherePSAAGQVISMTVPGDQSAHLWSAWPQLLVTVVWAVVLIGAGGFLFRKRDA
Ga0207664_1004500353300025929Agricultural SoilIGQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA
Ga0207690_1077833033300025932Corn RhizosphereVISVTVGQDDPHLWSAWPQFLVTVIWAVVLVAVGGYLFRKRDA
Ga0207661_1144441513300025944Corn RhizospherePDAAGRVLSVTVGPSNPHLWSAWPQFLVTAIWAVVLVGAGGYLFRKRDA
Ga0209626_110173513300027684Forest SoilANQVVSLTIAGNAPGHLWSAWPQLGVTALWAAAPVAVGAFLFRKRDA
Ga0209139_1015812113300027795Bog Forest SoilSASPHLWSAWPQLGVTALWAAVLLGVGAYLFRKRDA
Ga0209274_1021614623300027853SoilSANPHLWSAWPQLGVTALWAAALLAAGGYLFRKRDA
Ga0209693_1015202813300027855SoilPDAANRVVSVTIGGNADPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA
Ga0209624_1039574533300027895Forest SoilSVTLPGQQNAHLWSAWPQFLVTVVWAVVLVGVGGYLFRKRDA
Ga0209006_1035786833300027908Forest SoilNQVVSTTIAGNGPGHLWSAWPQLGVTALWAVVLVGIGAYLFRKRDA
Ga0302232_1005055253300028789PalsaTIGPTSPNLWSAWPQLGVTALWAAALVALGAYLFRHRDA
Ga0308309_1041135233300028906SoilANQVVSVTFGPSANPHLWSAWPQLGVTALWAAALLAAGGYLFRKRDA
Ga0311340_1110507923300029943PalsaVTVGPDNIHLWSAWPQLGVTALWAAALVGIGAYLFRTRDA
Ga0311340_1121229913300029943PalsaAANQVVSVTVGPGNMHLWSAWPQLGVTALWAAVLLTIGAYLFRKRDA
Ga0311338_1189724323300030007PalsaNQVVTVTIGGNSNPHLWSAWPQLGVTALWAVALVAIGAYLFRKRDA
Ga0311370_1045846413300030503PalsaRFFPDGAGRVLSVTVGQHVAHLWSAWPQFGVTLIYAAVLLAVGAYLFRTRDA
Ga0311372_1243391523300030520PalsaSITVGGGNPHLWSYWPQFAVTAIYAAALLAIGAYLFRQRDA
Ga0311355_1161915013300030580PalsaANQVVSVTVGPGNMHLWSAWPQLGVTALWAAVLLTIGAYLFRKRDA
Ga0302325_1184111213300031234PalsaIASNGPGHLWSAWPQLGVTAVWAAVLIGIGAYLFRKRDA
Ga0302326_1038098143300031525PalsaVVSVTIGDSNQHLWSAWPQLGVTALWAAILVGVGAYLFRKRDA
Ga0318573_1060990823300031564SoilTNPHLWSAWPQLGVTALWAVALIAAGSYLFRKRDA
Ga0318572_1078714823300031681SoilSAGRVISVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA
Ga0307474_1057121613300031718Hardwood Forest SoilFFPDEAGRVISVTVGSANPHLWSAWPQLLVTVAWAAVLIGVGGYLFRKRDA
Ga0318493_1015886133300031723SoilPSGGEVYHMWSAWPQFAVTAVYAVVLLAIGAYLFRKRDA
Ga0306918_1012115543300031744SoilRFMPDSAGRVISVTVAGNEFPHLWSAWPQFAVTVIYAAVLLGVGGYLFRRRDA
Ga0318552_1033512223300031782SoilHNEHLWSAWPQFGVTLIYAVVLLATGAYLFRKRDA
Ga0318552_1072942713300031782SoilVRFMPDSAGRVISVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA
Ga0318576_1033434113300031796SoilGQHNPHLWSAWPQFGVTLVYAAVLLGVGAYLFRRRDA
Ga0318523_1055873523300031798SoilAAGRVLSVTVGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0318568_1026943413300031819SoilGRVLSVTVGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0307478_1054113113300031823Hardwood Forest SoilQTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA
Ga0310917_1099080813300031833SoilRVLSKTIGQTEPHLWSAWPQFGVTLIYAAVLLAAGAYLFRKRDA
Ga0318551_1011608423300031896SoilGQHNPHLWSAWPQFGVTLVYAAVLVGIGAYLFRRRDA
Ga0310916_1166440113300031942SoilGRVLSVTIGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0310910_1039685533300031946SoilQDNPHLWSAWPQFGVTLIYAAVLLLAGAYLFRKRDA
Ga0310910_1077607313300031946SoilGRVVSVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA
Ga0310909_1074486513300031947SoilSVTIGQDNPHLWSAWPQFGVTLIYAAVLLLAGAYLFRKRDA
Ga0318514_1036135313300032066SoilPDAAGRVLSVTIGQHNEHLWSAWPQFGVTLIYAVVLLATGAYLFRKRDA
Ga0306924_1210555423300032076SoilAGRVLSKTIGQTEPHLWSAWPQFGVTLIYAAVLLAVGAYLFRKRDA
Ga0318540_1003465543300032094SoilAGTEFPHLWSAWPQFAVTAIYAVVLLAVGGYLFRKRDA
Ga0335085_1045640313300032770SoilPDAAGRVLSVTIGQHNPHLWSAWPQFGVTLIYAAVLLGAGAYLFRKRDA
Ga0335079_1178087713300032783SoilTLPGQQNPHLWSTWPQFLVTVIWAAAFIGIGGYLFRKRDA
Ga0335075_1137412913300032896SoilGRVLSVTTGQTAQHLWSAWPQFGVTLIYAAVLVALGGYLFRRRDA
Ga0335072_1109161723300032898SoilVTISQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA
Ga0335073_1065543713300033134SoilVGQHNPHLWSAWPQFGVTLVYAAVLLGAGAYLFRKRDA
Ga0370514_114429_539_6733300034199Untreated Peat SoilVVSVTIGNNGNPHLWSAWPQLGVTALWAAVLLGAGAYLFRKRDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.