| Basic Information | |
|---|---|
| Family ID | F077687 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.145 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.205 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 0.00% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01424 | R3H | 52.99 |
| PF04307 | YdjM | 3.42 |
| PF02096 | 60KD_IMP | 3.42 |
| PF02769 | AIRS_C | 2.56 |
| PF00550 | PP-binding | 0.85 |
| PF02527 | GidB | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1847 | Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domains | General function prediction only [R] | 52.99 |
| COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 3.42 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 3.42 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.15 % |
| Unclassified | root | N/A | 0.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100271649 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101558187 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300002560|JGI25383J37093_10183417 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004156|Ga0062589_102067378 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005093|Ga0062594_102645928 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005171|Ga0066677_10338292 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005174|Ga0066680_10409197 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005186|Ga0066676_10095324 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300005330|Ga0070690_101433247 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005332|Ga0066388_108183699 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005529|Ga0070741_11550662 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005531|Ga0070738_10259113 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005531|Ga0070738_10288384 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005559|Ga0066700_10966292 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005560|Ga0066670_10405200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300005566|Ga0066693_10209360 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005569|Ga0066705_10016498 | All Organisms → cellular organisms → Bacteria | 3698 | Open in IMG/M |
| 3300005587|Ga0066654_10144916 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005610|Ga0070763_10597845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005764|Ga0066903_103682064 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005764|Ga0066903_106340841 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005993|Ga0080027_10268013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300006052|Ga0075029_100887454 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006173|Ga0070716_100364711 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300006174|Ga0075014_100584368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300006797|Ga0066659_10370246 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300006806|Ga0079220_10145931 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300006854|Ga0075425_101830344 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009137|Ga0066709_100739792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300009137|Ga0066709_103860712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300009629|Ga0116119_1014074 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300010043|Ga0126380_11966963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010046|Ga0126384_11233901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300010046|Ga0126384_11927687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300010048|Ga0126373_13243903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300010336|Ga0134071_10198832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300010341|Ga0074045_10788006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300010341|Ga0074045_11062385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300010358|Ga0126370_12270881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300010362|Ga0126377_10973371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300010398|Ga0126383_12005886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300011120|Ga0150983_12246938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300011120|Ga0150983_12779280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300011120|Ga0150983_13236352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300011269|Ga0137392_10074891 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300011270|Ga0137391_10296712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300011271|Ga0137393_10247068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300012189|Ga0137388_11596277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012202|Ga0137363_10494479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300012203|Ga0137399_11280220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012354|Ga0137366_10294293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300012359|Ga0137385_10628132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300012361|Ga0137360_10120431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300012923|Ga0137359_10771746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300012923|Ga0137359_11020108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300012925|Ga0137419_11471368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012925|Ga0137419_11825443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012927|Ga0137416_10059623 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
| 3300012931|Ga0153915_12468463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300012955|Ga0164298_11352141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012958|Ga0164299_10964422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300015053|Ga0137405_1059179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300015193|Ga0167668_1061444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300017823|Ga0187818_10386921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300017972|Ga0187781_10012552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6041 | Open in IMG/M |
| 3300018006|Ga0187804_10593265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300018058|Ga0187766_10331159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300018431|Ga0066655_10429196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300020579|Ga0210407_10390142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300020580|Ga0210403_10165372 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300020580|Ga0210403_11454569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300020583|Ga0210401_11455001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021086|Ga0179596_10709891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300021088|Ga0210404_10643471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300021170|Ga0210400_10161879 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300021170|Ga0210400_10719580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300021170|Ga0210400_11657048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300021171|Ga0210405_10004819 | All Organisms → cellular organisms → Bacteria | 12540 | Open in IMG/M |
| 3300021181|Ga0210388_10990824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300021181|Ga0210388_11268226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300021401|Ga0210393_11232564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300021432|Ga0210384_11295673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300021475|Ga0210392_11258086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300022726|Ga0242654_10300684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300024290|Ga0247667_1042511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300024331|Ga0247668_1086594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300025899|Ga0207642_10053050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1843 | Open in IMG/M |
| 3300025939|Ga0207665_10163063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
| 3300026217|Ga0209871_1105555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300026494|Ga0257159_1053475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300026523|Ga0209808_1268403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026551|Ga0209648_10072095 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300027674|Ga0209118_1222160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300027765|Ga0209073_10439278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300027857|Ga0209166_10317798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300027874|Ga0209465_10280870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300027903|Ga0209488_11108175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300027965|Ga0209062_1032992 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300028906|Ga0308309_11625381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300028906|Ga0308309_11661364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300029910|Ga0311369_10173866 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300029944|Ga0311352_10470944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300031545|Ga0318541_10192794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300031576|Ga0247727_11186228 | Not Available | 512 | Open in IMG/M |
| 3300031720|Ga0307469_10271055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300031823|Ga0307478_10829810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300031896|Ga0318551_10247223 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300031912|Ga0306921_10993233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300031962|Ga0307479_10609868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300032174|Ga0307470_11482290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300032180|Ga0307471_101454951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300032180|Ga0307471_103863872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032261|Ga0306920_100651090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1556 | Open in IMG/M |
| 3300032783|Ga0335079_10656692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300032954|Ga0335083_10993016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300033480|Ga0316620_10899252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300034124|Ga0370483_0090050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002716493 | 3300002245 | Forest Soil | SSGLAVYILTSSIVGIGQQWYLNRHHPVIAAPVTKPVRGKKS* |
| JGIcombinedJ26739_1015581871 | 3300002245 | Forest Soil | YILTSSIVGIAQQWYLNRHHPVIAAPVTKPVRGKKS* |
| JGI25383J37093_101834172 | 3300002560 | Grasslands Soil | MPIGMAAMFMVIPYPSGLAVYILTSSLVGIVQQVYLNRQHPLPAAPARPARGKKS* |
| Ga0062589_1020673782 | 3300004156 | Soil | FPISSGLAVYILTSSVVGIGQQWYLNRTHPLTPPEKSGKKS* |
| Ga0062594_1026459281 | 3300005093 | Soil | TMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA* |
| Ga0066677_103382922 | 3300005171 | Soil | SGLAVYILTSSLVGIGQQWYLNRTHPVVTAPVKAGKGKKS* |
| Ga0066680_104091972 | 3300005174 | Soil | GMAGMFMVIPYPSGLAVYILTSGVVGVVQQWYLNRKHPLQVAPAKPVRGKKS* |
| Ga0066676_100953241 | 3300005186 | Soil | SSGLAVYILTSSLVGIGQQWYLNRTHPVTVPVKANRGKKS* |
| Ga0070690_1014332472 | 3300005330 | Switchgrass Rhizosphere | SPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA* |
| Ga0066388_1081836992 | 3300005332 | Tropical Forest Soil | ISSGLAVYILTSSLVGIGQQWWLNKTHPVTVAPAKPAKGKKS* |
| Ga0070741_115506622 | 3300005529 | Surface Soil | YPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQSKKV* |
| Ga0070738_102591131 | 3300005531 | Surface Soil | ALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQSKKV* |
| Ga0070738_102883841 | 3300005531 | Surface Soil | ALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQNRKV* |
| Ga0066700_109662921 | 3300005559 | Soil | AVYILTSSVVGIAQQWYLNRTHPVPAPAKIVRGKKP* |
| Ga0066670_104052002 | 3300005560 | Soil | VYILTSSLVGIGQQWYLNRTHPVVTAPAKAGKWKKS* |
| Ga0066693_102093602 | 3300005566 | Soil | AVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS* |
| Ga0066705_100164981 | 3300005569 | Soil | KIMPVTMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVLKGKKA* |
| Ga0066654_101449161 | 3300005587 | Soil | SGLAVYILTSSLVGILQQWWLNRSHPVSVSASTKVVKGKKG* |
| Ga0070763_105978452 | 3300005610 | Soil | YILTSSLVGIVQQWYLNRTHPAPAAAKQISRGKK* |
| Ga0066903_1036820641 | 3300005764 | Tropical Forest Soil | SGLAVYILTSSVVGIGQQWYLNRSHPITAPGKPDKKS* |
| Ga0066903_1063408412 | 3300005764 | Tropical Forest Soil | YPSGLAVYILTSSVVGIVQQWYLNRKHPLLAAGKPARGKNGKKS* |
| Ga0080027_102680132 | 3300005993 | Prmafrost Soil | LTSSVVGIAQQWYLNRHHPVIPASVTAKPVRGKKS* |
| Ga0075029_1008874542 | 3300006052 | Watersheds | IMPISSGLAVYILTSSVVGIGQQWYLNRKHPMPTSAKTVRGKK* |
| Ga0070716_1003647113 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA* |
| Ga0075014_1005843681 | 3300006174 | Watersheds | LTSSLVGILQQWWLNRTHPIAAAVPVKALKGKKA* |
| Ga0066659_103702463 | 3300006797 | Soil | AVYILTSSVVGIGQQWYLNRTHPVPAPAKPVRGKKS* |
| Ga0079220_101459311 | 3300006806 | Agricultural Soil | MFMVIPYPSGLAVYILTSSAVGVLQQVYLNRTHPLPTPAGKPGRGKKS* |
| Ga0075425_1018303442 | 3300006854 | Populus Rhizosphere | MFMFFPISSGLAVYILTSSVVGIGQQWYLNRTHPVTPVAKAGKK* |
| Ga0066709_1007397923 | 3300009137 | Grasslands Soil | FPISSGLAVYILTSSVVGIGQQWYLNRAHPVTPAAKSGKKS* |
| Ga0066709_1038607122 | 3300009137 | Grasslands Soil | AVYILTSSVVGIAQQWYLNRTHPVPALAKTVRGKKP* |
| Ga0116119_10140744 | 3300009629 | Peatland | PFSSGLALYILTSSLVGILQQRYLNRTHPLPAPVKPVRAKK* |
| Ga0126380_119669631 | 3300010043 | Tropical Forest Soil | MFLVFPISSGLAVYILTSSVVGIGQQWYLNRSHPITPPGKPDKKS* |
| Ga0126384_112339012 | 3300010046 | Tropical Forest Soil | FPISSGLAVYILTSSLVGIGQQWYLNRAHPTNAPVKAKKS* |
| Ga0126384_119276872 | 3300010046 | Tropical Forest Soil | FMFFPISSGLAVYILTSSVVGIGQQWYLNRSHPLTSPEKSGKKS* |
| Ga0126373_132439032 | 3300010048 | Tropical Forest Soil | LFMVIPYPSGLAVYILTSSVVGIVQQWYLNRTHPLQAVGKPARGKNGKKS* |
| Ga0134071_101988323 | 3300010336 | Grasslands Soil | AVYILTSGVVGVAQQWYLNRKHPLQAAPAKPVRGKKS* |
| Ga0074045_107880061 | 3300010341 | Bog Forest Soil | LYILTSSLVGILQQWYLNRTHPLPAPVKPVRAKK* |
| Ga0074045_110623852 | 3300010341 | Bog Forest Soil | LYILTSSLVGILQQWYLNRTHPLPAPAKPARAKK* |
| Ga0126370_122708812 | 3300010358 | Tropical Forest Soil | FAAMFMFFPISSGLAVYILTSSVVGIGQQWYLNRTHPISPPEKSGKKS* |
| Ga0126377_109733711 | 3300010362 | Tropical Forest Soil | LMFVLFPISSGLAVYILTSSLVGIGQQWYLNRAHPTNAPVKAKKS* |
| Ga0126383_120058861 | 3300010398 | Tropical Forest Soil | MPIGMAAMFVVIPYPSGLAVYILTSGLVGVAQQWYLNHKHPLVPGEPLPSEKGKKKKP* |
| Ga0150983_122469381 | 3300011120 | Forest Soil | YILTSSVIGIVQQWYLNKTHPAPVPAKPVRGKKS* |
| Ga0150983_127792803 | 3300011120 | Forest Soil | YILTSSVVGIGQQWYLNHKHPVPTSAKLARGKKS* |
| Ga0150983_132363522 | 3300011120 | Forest Soil | MISPISSGLAVYILTSSLVGIVQQWYLNRKHPVTAPATVKPVRGKKV* |
| Ga0137392_100748914 | 3300011269 | Vadose Zone Soil | GLAVYILTSSVVGIAQQWYLNRTHPVPVPAKPARGKKS* |
| Ga0137391_102967121 | 3300011270 | Vadose Zone Soil | AVYILTSSVVGIGQQWYLNRTHPVTAPVKAKGGKKS* |
| Ga0137393_102470683 | 3300011271 | Vadose Zone Soil | YILTSSVVGIAQQWYLNRTHPVPAPAKIVRGKKP* |
| Ga0137388_115962772 | 3300012189 | Vadose Zone Soil | VYILTSSVVGIGQQWYLNRTHPVTVPVKIKGGKKS* |
| Ga0137363_104944793 | 3300012202 | Vadose Zone Soil | GLAAYILTSNVVSIAQQWYLNRTHPVPAPAKPVRGKKS* |
| Ga0137399_112802201 | 3300012203 | Vadose Zone Soil | MAAIFMISPISSGLAVYILTSSVVGIAQQWYLNRKHPAPTPAKPARGKKS* |
| Ga0137366_102942931 | 3300012354 | Vadose Zone Soil | AVYILTSSLVGIGQQWYLNRTHPVTVPVKANRGKKS* |
| Ga0137385_106281321 | 3300012359 | Vadose Zone Soil | ISSGLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA* |
| Ga0137360_101204314 | 3300012361 | Vadose Zone Soil | AVYILTSSVVGIAQQWYLNRRHPLPAQAPVKATRGKKS* |
| Ga0137359_107717463 | 3300012923 | Vadose Zone Soil | AVYILTSSLVGIAQQWYLNRTHPVVTAPVKANRGKKS* |
| Ga0137359_110201082 | 3300012923 | Vadose Zone Soil | VYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA* |
| Ga0137419_114713682 | 3300012925 | Vadose Zone Soil | LAVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS* |
| Ga0137419_118254431 | 3300012925 | Vadose Zone Soil | SMAAMFVVFPFSSGLAVYILTSNVVGIVQQSYLNRTHPVPAPAKPVRGKKS* |
| Ga0137416_100596231 | 3300012927 | Vadose Zone Soil | SGLAVYILTSSVVGIAQQWYLNRKHPAPAPAKPARGKKS* |
| Ga0153915_124684631 | 3300012931 | Freshwater Wetlands | PFSSGLALYILTSSVVGIGQQWYLNKSHPTSAVVPVKPGHGKKA* |
| Ga0164298_113521412 | 3300012955 | Soil | PSGLAVYILTSGVVGVVQQWYLNRKHPLTPQGKAPLSKKQADRSKA* |
| Ga0164299_109644221 | 3300012958 | Soil | PISSGLAVYILTSSLVGILQQWWLNRSHSVTVPASTKVVKGKKA* |
| Ga0137405_10591793 | 3300015053 | Vadose Zone Soil | AVYILTSSLVGIAQQWYLNRRHPVNPTNKLAKGKKS* |
| Ga0167668_10614441 | 3300015193 | Glacier Forefield Soil | SSGLAVYILTSSIVGIAQQWYLNRHHPVITAPVTKPVRGKKS* |
| Ga0187818_103869211 | 3300017823 | Freshwater Sediment | LALYILTSSLIGILQQWYLNRTHPLPAPAKPTRAKK |
| Ga0187781_100125527 | 3300017972 | Tropical Peatland | LAVYILTSGLINVLQQWYLNRTHPLPAPAKPSRAKK |
| Ga0187804_105932652 | 3300018006 | Freshwater Sediment | VYILTSSLVGIVQQVWLNRAHPVTAPAKPVKGKKS |
| Ga0187766_103311592 | 3300018058 | Tropical Peatland | FMISPISSGLAVYILTSSLVGILQQVWLNRTHPVVAPAKPVKGKKS |
| Ga0066655_104291963 | 3300018431 | Grasslands Soil | LAVYILTSSVVGIGQQWYLNRTHPVPAPAKIVRGKKP |
| Ga0210407_103901423 | 3300020579 | Soil | MPISMAAIFMISPISSGLAVYILTSSLVGIVQQWYLNRKHPVTTTTIVKPARGKKA |
| Ga0210403_101653723 | 3300020580 | Soil | AVYILTSSVVGIGQQWYLNRTHPVPAPVKPVRGKKS |
| Ga0210403_114545691 | 3300020580 | Soil | AMYILTSSVVGIVQQWYLNRTHPVPAPAKLVRGKKS |
| Ga0210401_114550011 | 3300020583 | Soil | ISPISSGLAVYILTSSVVGIGQQWYLNHKHPVPASAKLARGKKS |
| Ga0179596_107098912 | 3300021086 | Vadose Zone Soil | GLAVYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA |
| Ga0210404_106434712 | 3300021088 | Soil | VYILTSSVVGIAQQWYLNRTHPVPAPVKPARGKKS |
| Ga0210400_101618793 | 3300021170 | Soil | SGLAVYILTSSLVGILQQWWLNRTHPAPAAAVSPARGKKGKKQ |
| Ga0210400_107195801 | 3300021170 | Soil | PSGLAVYILTSGVVGVGQQWYLNRTHPLPAPAKPARGKKQ |
| Ga0210400_116570482 | 3300021170 | Soil | ISPISSGLAVYILTSSLVGILQQWWLNRTHPVNAVPVKALKGKKA |
| Ga0210405_100048191 | 3300021171 | Soil | GLALYILTSSLVGIVQQLYLNRTHPLPAPAKPTRAKN |
| Ga0210388_109908242 | 3300021181 | Soil | ALYILTSSLVGIGQQWYLNKTHPAPAAAKQISRAKK |
| Ga0210388_112682261 | 3300021181 | Soil | GLALYILTSSLVGIGQQWYLNRSHPAPAAAKQISRGKK |
| Ga0210393_112325641 | 3300021401 | Soil | FMISPISSGLAVYILTSSVVGVGQQWYLNRQHPVTTPPAKLGRGKKS |
| Ga0210384_112956731 | 3300021432 | Soil | TMAGIFMISPISSGLAVYILTSSIVGIAQQWYLNRHHPVIAAPVTKPVRGKK |
| Ga0210392_112580861 | 3300021475 | Soil | LYILTSSLVGIGQQWYLNKTHPAPAAAKQISRGKK |
| Ga0242654_103006842 | 3300022726 | Soil | SGLAVYILTSGVVGVGQQWYLNRTHPLPAPAKPTRAKK |
| Ga0247667_10425113 | 3300024290 | Soil | ISSGLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA |
| Ga0247668_10865941 | 3300024331 | Soil | ALYILTSSLVGILQQWYLNRSHPLPAPAKPTRAKN |
| Ga0207642_100530501 | 3300025899 | Miscanthus Rhizosphere | VTIAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA |
| Ga0207665_101630631 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SGMFIIFPISSGLAVYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA |
| Ga0209871_11055551 | 3300026217 | Permafrost Soil | PISSGLAVYILTSSIVGIGQQWYLNRHHPVIAAPVTKPVRGKKS |
| Ga0257159_10534751 | 3300026494 | Soil | PFSSGLAVYIMTGSLIGVAQQWYLNRAHPVTVPAKVKGGKKS |
| Ga0209808_12684031 | 3300026523 | Soil | LAVYILTSSVVGIAQQWYLNRAHPVPAPAKPVRGKKS |
| Ga0209648_100720951 | 3300026551 | Grasslands Soil | AAYILTSNVVSIAQQWYLNRTHPVPAPAKIVRGKKL |
| Ga0209118_12221601 | 3300027674 | Forest Soil | ILTSSIVGIGQQWYLNRHHPVIAAPAAKSVRGKKS |
| Ga0209073_104392781 | 3300027765 | Agricultural Soil | FMVIPYPSGLAVYILTSSAVGVLQQVYLNRTHPLPTPAGKPGRGKKS |
| Ga0209166_103177982 | 3300027857 | Surface Soil | GLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA |
| Ga0209465_102808703 | 3300027874 | Tropical Forest Soil | MVIPYPSGLAVYILTSSVVGIGQQWYLNRTHPLQAVGKPARGKNGKKS |
| Ga0209488_111081751 | 3300027903 | Vadose Zone Soil | GMAGMFMVIPYPSGLAVYILTSGVVGVVQQWYLNRKHPLQVAPAKPVRGKKS |
| Ga0209062_10329921 | 3300027965 | Surface Soil | MAALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQNRKV |
| Ga0308309_116253812 | 3300028906 | Soil | AVYILTSSLVGILQQWWLNRTHPVTAVPVKAAKGKKS |
| Ga0308309_116613641 | 3300028906 | Soil | GLALYILTSSLVGIVQQWYLNRTHPAPAAAKQISRGKK |
| Ga0311369_101738661 | 3300029910 | Palsa | AVYILTSSVVGIGQQWYLNRTHPSPPPAKIVRNKKS |
| Ga0311352_104709441 | 3300029944 | Palsa | SSGLAVYILTSSVVGIGQQWYLNRTHPAPPPAKIVRNKKS |
| Ga0318541_101927943 | 3300031545 | Soil | LALYILTSSLIGIVQQWYLNKTHPLPAPAKPSRAKK |
| Ga0247727_111862281 | 3300031576 | Biofilm | GLVLYILSSNIVGIAQQWYLNKHAPAELKPGHGKKK |
| Ga0307469_102710553 | 3300031720 | Hardwood Forest Soil | PVTMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRAHPVTAVAVKPAKGKKS |
| Ga0307478_108298102 | 3300031823 | Hardwood Forest Soil | MKIMPITMAGIFMISPISSGLAVYILTSSLVGIVQQVWLNRTHPAAAAPAPSKPARGKKS |
| Ga0318551_102472231 | 3300031896 | Soil | SSGLAVYILTSSVVGIGQQWYLNRTHPLTPPAKSGKKS |
| Ga0306921_109932333 | 3300031912 | Soil | GLAVYILTQSVVGILQQWYLNRTHPLPAPAKPSRAKK |
| Ga0307479_106098681 | 3300031962 | Hardwood Forest Soil | LAVYILTSSLVGIVQQVWLNRTHPAAAAPVPSKPARGKKS |
| Ga0307470_114822902 | 3300032174 | Hardwood Forest Soil | LALYILTSSLVGIVQQWYLNRTHPLPAPAKPTRAKN |
| Ga0307471_1014549511 | 3300032180 | Hardwood Forest Soil | ALYILTSSLVGIVQQWYLNRTHPLPAPAKPTRAKN |
| Ga0307471_1038638722 | 3300032180 | Hardwood Forest Soil | AVYILTSSVVGIVQQWYLNRTHPLPAPVKGARGKKS |
| Ga0306920_1006510903 | 3300032261 | Soil | LALYILTSSLVGILQQWYLNRTHPLPAPVKPTRAKK |
| Ga0335079_106566923 | 3300032783 | Soil | LYILTSNLILILQQWYLNKTHPVAIQPTKPSRAKK |
| Ga0335083_109930162 | 3300032954 | Soil | SGLAVYILTSSLVGIAQQYYLNRSHPINPTLKPVKAK |
| Ga0316620_108992523 | 3300033480 | Soil | IIPYPSGLAVYILTSGVVGIVQQWYLNRKHPQTPPGKAPLSKKQADRNKA |
| Ga0370483_0090050_876_1001 | 3300034124 | Untreated Peat Soil | VYILTSSVVGIGQQWYLNRTHPAPPPAKIVRGKKSPGAQNA |
| ⦗Top⦘ |