NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077687

Metagenome / Metatranscriptome Family F077687

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077687
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 41 residues
Representative Sequence LAVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS
Number of Associated Samples 101
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.45 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.145 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.094 % of family members)
Environment Ontology (ENVO) Unclassified
(28.205 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.103 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.31%    β-sheet: 0.00%    Coil/Unstructured: 67.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF01424R3H 52.99
PF04307YdjM 3.42
PF0209660KD_IMP 3.42
PF02769AIRS_C 2.56
PF00550PP-binding 0.85
PF02527GidB 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG1847Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domainsGeneral function prediction only [R] 52.99
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 3.42
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 3.42
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.15 %
UnclassifiedrootN/A0.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100271649All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300002245|JGIcombinedJ26739_101558187All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300002560|JGI25383J37093_10183417All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300004156|Ga0062589_102067378All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005093|Ga0062594_102645928All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005171|Ga0066677_10338292All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005174|Ga0066680_10409197All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005186|Ga0066676_10095324All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300005330|Ga0070690_101433247All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005332|Ga0066388_108183699All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005529|Ga0070741_11550662All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005531|Ga0070738_10259113All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005531|Ga0070738_10288384All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005559|Ga0066700_10966292All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005560|Ga0066670_10405200All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300005566|Ga0066693_10209360All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005569|Ga0066705_10016498All Organisms → cellular organisms → Bacteria3698Open in IMG/M
3300005587|Ga0066654_10144916All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300005610|Ga0070763_10597845All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300005764|Ga0066903_103682064All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005764|Ga0066903_106340841All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005993|Ga0080027_10268013All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300006052|Ga0075029_100887454All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300006173|Ga0070716_100364711All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300006174|Ga0075014_100584368All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300006797|Ga0066659_10370246All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300006806|Ga0079220_10145931All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300006854|Ga0075425_101830344All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300009137|Ga0066709_100739792All Organisms → cellular organisms → Bacteria → Acidobacteria1419Open in IMG/M
3300009137|Ga0066709_103860712All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300009629|Ga0116119_1014074All Organisms → cellular organisms → Bacteria2307Open in IMG/M
3300010043|Ga0126380_11966963All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300010046|Ga0126384_11233901All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300010046|Ga0126384_11927687All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300010048|Ga0126373_13243903All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300010336|Ga0134071_10198832All Organisms → cellular organisms → Bacteria → Acidobacteria988Open in IMG/M
3300010341|Ga0074045_10788006All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300010341|Ga0074045_11062385All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300010358|Ga0126370_12270881All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300010362|Ga0126377_10973371All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300010398|Ga0126383_12005886All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300011120|Ga0150983_12246938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300011120|Ga0150983_12779280All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300011120|Ga0150983_13236352All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300011269|Ga0137392_10074891All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300011270|Ga0137391_10296712All Organisms → cellular organisms → Bacteria → Acidobacteria1395Open in IMG/M
3300011271|Ga0137393_10247068All Organisms → cellular organisms → Bacteria → Acidobacteria1514Open in IMG/M
3300012189|Ga0137388_11596277All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300012202|Ga0137363_10494479All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300012203|Ga0137399_11280220All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300012354|Ga0137366_10294293All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300012359|Ga0137385_10628132All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300012361|Ga0137360_10120431All Organisms → cellular organisms → Bacteria → Acidobacteria2040Open in IMG/M
3300012923|Ga0137359_10771746All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300012923|Ga0137359_11020108All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300012925|Ga0137419_11471368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300012925|Ga0137419_11825443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300012927|Ga0137416_10059623All Organisms → cellular organisms → Bacteria2719Open in IMG/M
3300012931|Ga0153915_12468463All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300012955|Ga0164298_11352141All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300012958|Ga0164299_10964422All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300015053|Ga0137405_1059179All Organisms → cellular organisms → Bacteria → Acidobacteria1415Open in IMG/M
3300015193|Ga0167668_1061444All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300017823|Ga0187818_10386921All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300017972|Ga0187781_10012552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6041Open in IMG/M
3300018006|Ga0187804_10593265All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300018058|Ga0187766_10331159All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300018431|Ga0066655_10429196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300020579|Ga0210407_10390142All Organisms → cellular organisms → Bacteria → Acidobacteria1089Open in IMG/M
3300020580|Ga0210403_10165372All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300020580|Ga0210403_11454569All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300020583|Ga0210401_11455001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300021086|Ga0179596_10709891All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300021088|Ga0210404_10643471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300021170|Ga0210400_10161879All Organisms → cellular organisms → Bacteria1806Open in IMG/M
3300021170|Ga0210400_10719580All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300021170|Ga0210400_11657048All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300021171|Ga0210405_10004819All Organisms → cellular organisms → Bacteria12540Open in IMG/M
3300021181|Ga0210388_10990824All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300021181|Ga0210388_11268226All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300021401|Ga0210393_11232564All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300021432|Ga0210384_11295673All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300021475|Ga0210392_11258086All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300022726|Ga0242654_10300684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300024290|Ga0247667_1042511All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300024331|Ga0247668_1086594All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300025899|Ga0207642_10053050All Organisms → cellular organisms → Bacteria → Acidobacteria1843Open in IMG/M
3300025939|Ga0207665_10163063All Organisms → cellular organisms → Bacteria → Acidobacteria1605Open in IMG/M
3300026217|Ga0209871_1105555All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300026494|Ga0257159_1053475All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300026523|Ga0209808_1268403All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300026551|Ga0209648_10072095All Organisms → cellular organisms → Bacteria2904Open in IMG/M
3300027674|Ga0209118_1222160All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300027765|Ga0209073_10439278All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300027857|Ga0209166_10317798All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300027874|Ga0209465_10280870All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300027903|Ga0209488_11108175All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300027965|Ga0209062_1032992All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300028906|Ga0308309_11625381All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300028906|Ga0308309_11661364All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300029910|Ga0311369_10173866All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300029944|Ga0311352_10470944All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300031545|Ga0318541_10192794All Organisms → cellular organisms → Bacteria → Acidobacteria1126Open in IMG/M
3300031576|Ga0247727_11186228Not Available512Open in IMG/M
3300031720|Ga0307469_10271055All Organisms → cellular organisms → Bacteria → Acidobacteria1380Open in IMG/M
3300031823|Ga0307478_10829810All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300031896|Ga0318551_10247223All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300031912|Ga0306921_10993233All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300031962|Ga0307479_10609868All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300032174|Ga0307470_11482290All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300032180|Ga0307471_101454951All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300032180|Ga0307471_103863872All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300032261|Ga0306920_100651090All Organisms → cellular organisms → Bacteria → Acidobacteria1556Open in IMG/M
3300032783|Ga0335079_10656692All Organisms → cellular organisms → Bacteria → Acidobacteria1100Open in IMG/M
3300032954|Ga0335083_10993016All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300033480|Ga0316620_10899252All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300034124|Ga0370483_0090050All Organisms → cellular organisms → Bacteria → Acidobacteria1003Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.13%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.13%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.71%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.85%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.85%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10027164933300002245Forest SoilSSGLAVYILTSSIVGIGQQWYLNRHHPVIAAPVTKPVRGKKS*
JGIcombinedJ26739_10155818713300002245Forest SoilYILTSSIVGIAQQWYLNRHHPVIAAPVTKPVRGKKS*
JGI25383J37093_1018341723300002560Grasslands SoilMPIGMAAMFMVIPYPSGLAVYILTSSLVGIVQQVYLNRQHPLPAAPARPARGKKS*
Ga0062589_10206737823300004156SoilFPISSGLAVYILTSSVVGIGQQWYLNRTHPLTPPEKSGKKS*
Ga0062594_10264592813300005093SoilTMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA*
Ga0066677_1033829223300005171SoilSGLAVYILTSSLVGIGQQWYLNRTHPVVTAPVKAGKGKKS*
Ga0066680_1040919723300005174SoilGMAGMFMVIPYPSGLAVYILTSGVVGVVQQWYLNRKHPLQVAPAKPVRGKKS*
Ga0066676_1009532413300005186SoilSSGLAVYILTSSLVGIGQQWYLNRTHPVTVPVKANRGKKS*
Ga0070690_10143324723300005330Switchgrass RhizosphereSPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA*
Ga0066388_10818369923300005332Tropical Forest SoilISSGLAVYILTSSLVGIGQQWWLNKTHPVTVAPAKPAKGKKS*
Ga0070741_1155066223300005529Surface SoilYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQSKKV*
Ga0070738_1025911313300005531Surface SoilALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQSKKV*
Ga0070738_1028838413300005531Surface SoilALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQNRKV*
Ga0066700_1096629213300005559SoilAVYILTSSVVGIAQQWYLNRTHPVPAPAKIVRGKKP*
Ga0066670_1040520023300005560SoilVYILTSSLVGIGQQWYLNRTHPVVTAPAKAGKWKKS*
Ga0066693_1020936023300005566SoilAVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS*
Ga0066705_1001649813300005569SoilKIMPVTMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVLKGKKA*
Ga0066654_1014491613300005587SoilSGLAVYILTSSLVGILQQWWLNRSHPVSVSASTKVVKGKKG*
Ga0070763_1059784523300005610SoilYILTSSLVGIVQQWYLNRTHPAPAAAKQISRGKK*
Ga0066903_10368206413300005764Tropical Forest SoilSGLAVYILTSSVVGIGQQWYLNRSHPITAPGKPDKKS*
Ga0066903_10634084123300005764Tropical Forest SoilYPSGLAVYILTSSVVGIVQQWYLNRKHPLLAAGKPARGKNGKKS*
Ga0080027_1026801323300005993Prmafrost SoilLTSSVVGIAQQWYLNRHHPVIPASVTAKPVRGKKS*
Ga0075029_10088745423300006052WatershedsIMPISSGLAVYILTSSVVGIGQQWYLNRKHPMPTSAKTVRGKK*
Ga0070716_10036471133300006173Corn, Switchgrass And Miscanthus RhizosphereFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA*
Ga0075014_10058436813300006174WatershedsLTSSLVGILQQWWLNRTHPIAAAVPVKALKGKKA*
Ga0066659_1037024633300006797SoilAVYILTSSVVGIGQQWYLNRTHPVPAPAKPVRGKKS*
Ga0079220_1014593113300006806Agricultural SoilMFMVIPYPSGLAVYILTSSAVGVLQQVYLNRTHPLPTPAGKPGRGKKS*
Ga0075425_10183034423300006854Populus RhizosphereMFMFFPISSGLAVYILTSSVVGIGQQWYLNRTHPVTPVAKAGKK*
Ga0066709_10073979233300009137Grasslands SoilFPISSGLAVYILTSSVVGIGQQWYLNRAHPVTPAAKSGKKS*
Ga0066709_10386071223300009137Grasslands SoilAVYILTSSVVGIAQQWYLNRTHPVPALAKTVRGKKP*
Ga0116119_101407443300009629PeatlandPFSSGLALYILTSSLVGILQQRYLNRTHPLPAPVKPVRAKK*
Ga0126380_1196696313300010043Tropical Forest SoilMFLVFPISSGLAVYILTSSVVGIGQQWYLNRSHPITPPGKPDKKS*
Ga0126384_1123390123300010046Tropical Forest SoilFPISSGLAVYILTSSLVGIGQQWYLNRAHPTNAPVKAKKS*
Ga0126384_1192768723300010046Tropical Forest SoilFMFFPISSGLAVYILTSSVVGIGQQWYLNRSHPLTSPEKSGKKS*
Ga0126373_1324390323300010048Tropical Forest SoilLFMVIPYPSGLAVYILTSSVVGIVQQWYLNRTHPLQAVGKPARGKNGKKS*
Ga0134071_1019883233300010336Grasslands SoilAVYILTSGVVGVAQQWYLNRKHPLQAAPAKPVRGKKS*
Ga0074045_1078800613300010341Bog Forest SoilLYILTSSLVGILQQWYLNRTHPLPAPVKPVRAKK*
Ga0074045_1106238523300010341Bog Forest SoilLYILTSSLVGILQQWYLNRTHPLPAPAKPARAKK*
Ga0126370_1227088123300010358Tropical Forest SoilFAAMFMFFPISSGLAVYILTSSVVGIGQQWYLNRTHPISPPEKSGKKS*
Ga0126377_1097337113300010362Tropical Forest SoilLMFVLFPISSGLAVYILTSSLVGIGQQWYLNRAHPTNAPVKAKKS*
Ga0126383_1200588613300010398Tropical Forest SoilMPIGMAAMFVVIPYPSGLAVYILTSGLVGVAQQWYLNHKHPLVPGEPLPSEKGKKKKP*
Ga0150983_1224693813300011120Forest SoilYILTSSVIGIVQQWYLNKTHPAPVPAKPVRGKKS*
Ga0150983_1277928033300011120Forest SoilYILTSSVVGIGQQWYLNHKHPVPTSAKLARGKKS*
Ga0150983_1323635223300011120Forest SoilMISPISSGLAVYILTSSLVGIVQQWYLNRKHPVTAPATVKPVRGKKV*
Ga0137392_1007489143300011269Vadose Zone SoilGLAVYILTSSVVGIAQQWYLNRTHPVPVPAKPARGKKS*
Ga0137391_1029671213300011270Vadose Zone SoilAVYILTSSVVGIGQQWYLNRTHPVTAPVKAKGGKKS*
Ga0137393_1024706833300011271Vadose Zone SoilYILTSSVVGIAQQWYLNRTHPVPAPAKIVRGKKP*
Ga0137388_1159627723300012189Vadose Zone SoilVYILTSSVVGIGQQWYLNRTHPVTVPVKIKGGKKS*
Ga0137363_1049447933300012202Vadose Zone SoilGLAAYILTSNVVSIAQQWYLNRTHPVPAPAKPVRGKKS*
Ga0137399_1128022013300012203Vadose Zone SoilMAAIFMISPISSGLAVYILTSSVVGIAQQWYLNRKHPAPTPAKPARGKKS*
Ga0137366_1029429313300012354Vadose Zone SoilAVYILTSSLVGIGQQWYLNRTHPVTVPVKANRGKKS*
Ga0137385_1062813213300012359Vadose Zone SoilISSGLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA*
Ga0137360_1012043143300012361Vadose Zone SoilAVYILTSSVVGIAQQWYLNRRHPLPAQAPVKATRGKKS*
Ga0137359_1077174633300012923Vadose Zone SoilAVYILTSSLVGIAQQWYLNRTHPVVTAPVKANRGKKS*
Ga0137359_1102010823300012923Vadose Zone SoilVYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA*
Ga0137419_1147136823300012925Vadose Zone SoilLAVYILTSSVVGIAQQWYLNRTHPVPAPAKPVRGKKS*
Ga0137419_1182544313300012925Vadose Zone SoilSMAAMFVVFPFSSGLAVYILTSNVVGIVQQSYLNRTHPVPAPAKPVRGKKS*
Ga0137416_1005962313300012927Vadose Zone SoilSGLAVYILTSSVVGIAQQWYLNRKHPAPAPAKPARGKKS*
Ga0153915_1246846313300012931Freshwater WetlandsPFSSGLALYILTSSVVGIGQQWYLNKSHPTSAVVPVKPGHGKKA*
Ga0164298_1135214123300012955SoilPSGLAVYILTSGVVGVVQQWYLNRKHPLTPQGKAPLSKKQADRSKA*
Ga0164299_1096442213300012958SoilPISSGLAVYILTSSLVGILQQWWLNRSHSVTVPASTKVVKGKKA*
Ga0137405_105917933300015053Vadose Zone SoilAVYILTSSLVGIAQQWYLNRRHPVNPTNKLAKGKKS*
Ga0167668_106144413300015193Glacier Forefield SoilSSGLAVYILTSSIVGIAQQWYLNRHHPVITAPVTKPVRGKKS*
Ga0187818_1038692113300017823Freshwater SedimentLALYILTSSLIGILQQWYLNRTHPLPAPAKPTRAKK
Ga0187781_1001255273300017972Tropical PeatlandLAVYILTSGLINVLQQWYLNRTHPLPAPAKPSRAKK
Ga0187804_1059326523300018006Freshwater SedimentVYILTSSLVGIVQQVWLNRAHPVTAPAKPVKGKKS
Ga0187766_1033115923300018058Tropical PeatlandFMISPISSGLAVYILTSSLVGILQQVWLNRTHPVVAPAKPVKGKKS
Ga0066655_1042919633300018431Grasslands SoilLAVYILTSSVVGIGQQWYLNRTHPVPAPAKIVRGKKP
Ga0210407_1039014233300020579SoilMPISMAAIFMISPISSGLAVYILTSSLVGIVQQWYLNRKHPVTTTTIVKPARGKKA
Ga0210403_1016537233300020580SoilAVYILTSSVVGIGQQWYLNRTHPVPAPVKPVRGKKS
Ga0210403_1145456913300020580SoilAMYILTSSVVGIVQQWYLNRTHPVPAPAKLVRGKKS
Ga0210401_1145500113300020583SoilISPISSGLAVYILTSSVVGIGQQWYLNHKHPVPASAKLARGKKS
Ga0179596_1070989123300021086Vadose Zone SoilGLAVYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA
Ga0210404_1064347123300021088SoilVYILTSSVVGIAQQWYLNRTHPVPAPVKPARGKKS
Ga0210400_1016187933300021170SoilSGLAVYILTSSLVGILQQWWLNRTHPAPAAAVSPARGKKGKKQ
Ga0210400_1071958013300021170SoilPSGLAVYILTSGVVGVGQQWYLNRTHPLPAPAKPARGKKQ
Ga0210400_1165704823300021170SoilISPISSGLAVYILTSSLVGILQQWWLNRTHPVNAVPVKALKGKKA
Ga0210405_1000481913300021171SoilGLALYILTSSLVGIVQQLYLNRTHPLPAPAKPTRAKN
Ga0210388_1099082423300021181SoilALYILTSSLVGIGQQWYLNKTHPAPAAAKQISRAKK
Ga0210388_1126822613300021181SoilGLALYILTSSLVGIGQQWYLNRSHPAPAAAKQISRGKK
Ga0210393_1123256413300021401SoilFMISPISSGLAVYILTSSVVGVGQQWYLNRQHPVTTPPAKLGRGKKS
Ga0210384_1129567313300021432SoilTMAGIFMISPISSGLAVYILTSSIVGIAQQWYLNRHHPVIAAPVTKPVRGKK
Ga0210392_1125808613300021475SoilLYILTSSLVGIGQQWYLNKTHPAPAAAKQISRGKK
Ga0242654_1030068423300022726SoilSGLAVYILTSGVVGVGQQWYLNRTHPLPAPAKPTRAKK
Ga0247667_104251133300024290SoilISSGLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA
Ga0247668_108659413300024331SoilALYILTSSLVGILQQWYLNRSHPLPAPAKPTRAKN
Ga0207642_1005305013300025899Miscanthus RhizosphereVTIAGIFMISPISSGLAVYILTSSLVGILQQWWLNRSHPVTVPVSTKVVKGKKA
Ga0207665_1016306313300025939Corn, Switchgrass And Miscanthus RhizosphereSGMFIIFPISSGLAVYILTSSLVGIVQQYYLNRTHPIAPVGKPAKAKKA
Ga0209871_110555513300026217Permafrost SoilPISSGLAVYILTSSIVGIGQQWYLNRHHPVIAAPVTKPVRGKKS
Ga0257159_105347513300026494SoilPFSSGLAVYIMTGSLIGVAQQWYLNRAHPVTVPAKVKGGKKS
Ga0209808_126840313300026523SoilLAVYILTSSVVGIAQQWYLNRAHPVPAPAKPVRGKKS
Ga0209648_1007209513300026551Grasslands SoilAAYILTSNVVSIAQQWYLNRTHPVPAPAKIVRGKKL
Ga0209118_122216013300027674Forest SoilILTSSIVGIGQQWYLNRHHPVIAAPAAKSVRGKKS
Ga0209073_1043927813300027765Agricultural SoilFMVIPYPSGLAVYILTSSAVGVLQQVYLNRTHPLPTPAGKPGRGKKS
Ga0209166_1031779823300027857Surface SoilGLAVYILTSSLVGIVQQYYLNRTHPIAPAGKPAKAKKA
Ga0209465_1028087033300027874Tropical Forest SoilMVIPYPSGLAVYILTSSVVGIGQQWYLNRTHPLQAVGKPARGKNGKKS
Ga0209488_1110817513300027903Vadose Zone SoilGMAGMFMVIPYPSGLAVYILTSGVVGVVQQWYLNRKHPLQVAPAKPVRGKKS
Ga0209062_103299213300027965Surface SoilMAALFIVIPYPSGLAVYILTSGLVGILQQWYLNKKHPMPAPAKVVRGKQNRKV
Ga0308309_1162538123300028906SoilAVYILTSSLVGILQQWWLNRTHPVTAVPVKAAKGKKS
Ga0308309_1166136413300028906SoilGLALYILTSSLVGIVQQWYLNRTHPAPAAAKQISRGKK
Ga0311369_1017386613300029910PalsaAVYILTSSVVGIGQQWYLNRTHPSPPPAKIVRNKKS
Ga0311352_1047094413300029944PalsaSSGLAVYILTSSVVGIGQQWYLNRTHPAPPPAKIVRNKKS
Ga0318541_1019279433300031545SoilLALYILTSSLIGIVQQWYLNKTHPLPAPAKPSRAKK
Ga0247727_1118622813300031576BiofilmGLVLYILSSNIVGIAQQWYLNKHAPAELKPGHGKKK
Ga0307469_1027105533300031720Hardwood Forest SoilPVTMAGIFMISPISSGLAVYILTSSLVGILQQWWLNRAHPVTAVAVKPAKGKKS
Ga0307478_1082981023300031823Hardwood Forest SoilMKIMPITMAGIFMISPISSGLAVYILTSSLVGIVQQVWLNRTHPAAAAPAPSKPARGKKS
Ga0318551_1024722313300031896SoilSSGLAVYILTSSVVGIGQQWYLNRTHPLTPPAKSGKKS
Ga0306921_1099323333300031912SoilGLAVYILTQSVVGILQQWYLNRTHPLPAPAKPSRAKK
Ga0307479_1060986813300031962Hardwood Forest SoilLAVYILTSSLVGIVQQVWLNRTHPAAAAPVPSKPARGKKS
Ga0307470_1148229023300032174Hardwood Forest SoilLALYILTSSLVGIVQQWYLNRTHPLPAPAKPTRAKN
Ga0307471_10145495113300032180Hardwood Forest SoilALYILTSSLVGIVQQWYLNRTHPLPAPAKPTRAKN
Ga0307471_10386387223300032180Hardwood Forest SoilAVYILTSSVVGIVQQWYLNRTHPLPAPVKGARGKKS
Ga0306920_10065109033300032261SoilLALYILTSSLVGILQQWYLNRTHPLPAPVKPTRAKK
Ga0335079_1065669233300032783SoilLYILTSNLILILQQWYLNKTHPVAIQPTKPSRAKK
Ga0335083_1099301623300032954SoilSGLAVYILTSSLVGIAQQYYLNRSHPINPTLKPVKAK
Ga0316620_1089925233300033480SoilIIPYPSGLAVYILTSGVVGIVQQWYLNRKHPQTPPGKAPLSKKQADRNKA
Ga0370483_0090050_876_10013300034124Untreated Peat SoilVYILTSSVVGIGQQWYLNRTHPAPPPAKIVRGKKSPGAQNA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.