NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077681

Metagenome Family F077681

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077681
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 45 residues
Representative Sequence ESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK
Number of Associated Samples 105
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.53 %
% of genes near scaffold ends (potentially truncated) 82.05 %
% of genes from short scaffolds (< 2000 bps) 88.03 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.145 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.675 % of family members)
Environment Ontology (ENVO) Unclassified
(31.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF09084NMT1 9.40
PF07690MFS_1 6.84
PF13379NMT1_2 5.98
PF00924MS_channel 5.13
PF07883Cupin_2 3.42
PF00330Aconitase 2.56
PF00753Lactamase_B 2.56
PF13439Glyco_transf_4 1.71
PF07995GSDH 1.71
PF00483NTP_transferase 0.85
PF00857Isochorismatase 0.85
PF01613Flavin_Reduct 0.85
PF02776TPP_enzyme_N 0.85
PF00890FAD_binding_2 0.85
PF02457DAC 0.85
PF02696SelO 0.85
PF00903Glyoxalase 0.85
PF02775TPP_enzyme_C 0.85
PF05378Hydant_A_N 0.85
PF00196GerE 0.85
PF03401TctC 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 9.40
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 9.40
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 5.13
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 5.13
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 1.71
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.71
COG0397Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)Posttranslational modification, protein turnover, chaperones [O] 0.85
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.85
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.85
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.15 %
UnclassifiedrootN/A0.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101352175All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300000559|F14TC_100086558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10001997All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter algicola5349Open in IMG/M
3300000955|JGI1027J12803_100945773All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300000955|JGI1027J12803_103447326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria758Open in IMG/M
3300001372|YBBDRAFT_1016730All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes816Open in IMG/M
3300003996|Ga0055467_10028704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1315Open in IMG/M
3300003999|Ga0055469_10021704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1480Open in IMG/M
3300004051|Ga0055492_10010624All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300004633|Ga0066395_10281493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300005181|Ga0066678_10687294All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005328|Ga0070676_11366746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300005332|Ga0066388_103351550All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium818Open in IMG/M
3300005366|Ga0070659_101595346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300005518|Ga0070699_100420884All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300005719|Ga0068861_100425609All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300005764|Ga0066903_100512992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2037Open in IMG/M
3300005764|Ga0066903_105447602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300005873|Ga0075287_1005076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1562Open in IMG/M
3300005875|Ga0075293_1017480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium884Open in IMG/M
3300005876|Ga0075300_1068437All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005885|Ga0075284_1052809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300005895|Ga0075277_1073160All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005937|Ga0081455_10172166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1648Open in IMG/M
3300006173|Ga0070716_100514263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium886Open in IMG/M
3300006844|Ga0075428_101824364All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300006845|Ga0075421_102515833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300006846|Ga0075430_101589790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300006854|Ga0075425_101040597All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300006871|Ga0075434_102073038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria574Open in IMG/M
3300006894|Ga0079215_10001177All Organisms → cellular organisms → Bacteria6617Open in IMG/M
3300006904|Ga0075424_100902596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium943Open in IMG/M
3300006969|Ga0075419_10313568All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1060Open in IMG/M
3300007004|Ga0079218_10840865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium890Open in IMG/M
3300007076|Ga0075435_100929758All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300007076|Ga0075435_101616672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300009100|Ga0075418_11761600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300009100|Ga0075418_13058759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300009147|Ga0114129_12313313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300009156|Ga0111538_13109302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300009174|Ga0105241_11738272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300010043|Ga0126380_11732981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300010360|Ga0126372_10803573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300010360|Ga0126372_11537788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300010397|Ga0134124_12977153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300010400|Ga0134122_10937424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium842Open in IMG/M
3300010403|Ga0134123_10806832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300011406|Ga0137454_1073712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300011419|Ga0137446_1121224All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300011422|Ga0137425_1130465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300011427|Ga0137448_1004789All Organisms → cellular organisms → Bacteria2585Open in IMG/M
3300011431|Ga0137438_1253227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300011436|Ga0137458_1102164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium825Open in IMG/M
3300011445|Ga0137427_10176285All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012189|Ga0137388_11431426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300012201|Ga0137365_11176738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria549Open in IMG/M
3300012354|Ga0137366_11031101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria570Open in IMG/M
3300012358|Ga0137368_10062900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium3055Open in IMG/M
3300012685|Ga0137397_10092644All Organisms → cellular organisms → Bacteria2208Open in IMG/M
3300012922|Ga0137394_10949646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria716Open in IMG/M
3300012930|Ga0137407_11347974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → environmental samples → uncultured Verrucomicrobiota bacterium678Open in IMG/M
3300012944|Ga0137410_10908642All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300012944|Ga0137410_11221021All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300012986|Ga0164304_10403323All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300013297|Ga0157378_10719688Not Available1019Open in IMG/M
3300014271|Ga0075326_1037188All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300014301|Ga0075323_1002906All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300014866|Ga0180090_1101362All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300014878|Ga0180065_1158403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi521Open in IMG/M
3300015373|Ga0132257_100914285All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300015373|Ga0132257_104637734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300015374|Ga0132255_105071286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300016387|Ga0182040_10231946All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300016404|Ga0182037_11008757All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300016422|Ga0182039_11965273All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300018072|Ga0184635_10064340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1427Open in IMG/M
3300018072|Ga0184635_10252947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria697Open in IMG/M
3300018074|Ga0184640_10052824All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300018082|Ga0184639_10245102All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300018432|Ga0190275_10733682All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300019377|Ga0190264_11015875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300020186|Ga0163153_10012768All Organisms → cellular organisms → Bacteria7782Open in IMG/M
3300020186|Ga0163153_10057157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2598Open in IMG/M
3300021081|Ga0210379_10270998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria739Open in IMG/M
3300022756|Ga0222622_10062440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium2157Open in IMG/M
3300022756|Ga0222622_10662624All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria756Open in IMG/M
3300025159|Ga0209619_10021738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_134237Open in IMG/M
3300025792|Ga0210143_1072905All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025907|Ga0207645_10907161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300025917|Ga0207660_10219835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1490Open in IMG/M
3300025919|Ga0207657_10023607All Organisms → cellular organisms → Bacteria5722Open in IMG/M
3300025922|Ga0207646_11811482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300025923|Ga0207681_11090407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300025939|Ga0207665_11574716All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300025992|Ga0208775_1001073All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300025993|Ga0208415_1005898All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300026003|Ga0208284_1025382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300026020|Ga0208531_1014528All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300026053|Ga0208422_1046941All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300026095|Ga0207676_12563990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300027326|Ga0209731_1056315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300027637|Ga0209818_1051738All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300027731|Ga0209592_1213225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300027907|Ga0207428_10660723All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300027909|Ga0209382_10038434All Organisms → cellular organisms → Bacteria5742Open in IMG/M
3300027909|Ga0209382_10183867All Organisms → cellular organisms → Bacteria2403Open in IMG/M
3300028814|Ga0307302_10406918All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028884|Ga0307308_10497968All Organisms → cellular organisms → Bacteria584Open in IMG/M
(restricted) 3300031150|Ga0255311_1078928All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031720|Ga0307469_11109248All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300032174|Ga0307470_10371056All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300032180|Ga0307471_100291381All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300032180|Ga0307471_100709776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1170Open in IMG/M
3300033419|Ga0316601_100549384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1116Open in IMG/M
3300034165|Ga0364942_0234827All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300034177|Ga0364932_0183124All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300034354|Ga0364943_0143113All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium858Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.27%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.56%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.56%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.56%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.85%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.85%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025992Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026020Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes)EnvironmentalOpen in IMG/M
3300026053Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10135217513300000364SoilFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK*
F14TC_10008655823300000559SoilTGFHERFNPQGIKNRDASAALDASFVQKAAERLKFGKK*
AF_2010_repII_A1DRAFT_1000199733300000597Forest SoilMRFNPQGIRNRDAKLYLDPSFVQKAAERLKLDKK*
JGI1027J12803_10094577323300000955SoilIEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK*
JGI1027J12803_10344732623300000955SoilIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ*
YBBDRAFT_101673013300001372Marine EstuarineFHERFNPQGIKNRDASGSLDPSFVQKAAERLKLGKK*
Ga0055467_1002870423300003996Natural And Restored WetlandsVSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0055469_1002170423300003999Natural And Restored WetlandsVSTPWEAGFESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0055492_1001062413300004051Natural And Restored WetlandsLPWQAGIESMITGFHERFNPQGIKNRDASAALDAGFVQKAAERLKLGKK*
Ga0066395_1028149313300004633Tropical Forest SoilWEAGIESMITGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK*
Ga0066678_1068729423300005181SoilFPWQSGIEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK*
Ga0070676_1136674613300005328Miscanthus RhizosphereGIEGMITGFHERFNPQGIKNRDARPYLDPYFVQKAAERLRLDKK*
Ga0066388_10335155023300005332Tropical Forest SoilGIESMITGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK*
Ga0070659_10159534613300005366Corn RhizosphereEAGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP*
Ga0070699_10042088413300005518Corn, Switchgrass And Miscanthus RhizosphereEGMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK*
Ga0068861_10042560913300005719Switchgrass RhizosphereDAIGGIPIPWEAGIESMITGFHERFNPQGIKNRDAKPYLDPTFVQKAVERLKLGKK*
Ga0066903_10051299213300005764Tropical Forest SoilESMINGYHARFTPAVVKNRDARPFLDASFVQRAVERAGIGKKP*
Ga0066903_10544760223300005764Tropical Forest SoilEAGIESMISGFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK*
Ga0075287_100507623300005873Rice Paddy SoilVSTPREAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0075293_101748023300005875Rice Paddy SoilVSTPREAGFESMITGFYERFNPQGIKNRDAEPYLDPSFVQKALERLKLGKK*
Ga0075300_106843713300005876Rice Paddy SoilESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0075284_105280913300005885Rice Paddy SoilIDGLPYPWEAGIEQMITGFHRRFNPQIVKNTDVKPYLDSTFVRTAAERLGLSKK*
Ga0075277_107316023300005895Rice Paddy SoilFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0081455_1017216633300005937Tabebuia Heterophylla RhizosphereFHERFNPQGIKNHDATPFLDPSFVQKAVERLKLSKK*
Ga0070716_10051426323300006173Corn, Switchgrass And Miscanthus RhizosphereMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK*
Ga0075428_10182436423300006844Populus RhizosphereGIESMITGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK*
Ga0075421_10251583313300006845Populus RhizosphereMISGFHERFNPQGIKNRDARSYLDPSFVQKAAERLRLDKK*
Ga0075430_10158979023300006846Populus RhizosphereVRWEAGIESMITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK*
Ga0075425_10104059733300006854Populus RhizosphereHERFTPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP*
Ga0075434_10207303813300006871Populus RhizosphereGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ*
Ga0079215_1000117753300006894Agricultural SoilLPWQAGIESMITGFHERFNPQGIKNRDARPFLDPSFVQRAVERLKLGKK*
Ga0075424_10090259613300006904Populus RhizosphereWEAGIESMITGFHERFNPQGIRNRDAKGFVDPSFVQRAAERLKLGRSNRP*
Ga0075419_1031356823300006969Populus RhizosphereEAGIESMITGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK*
Ga0079218_1084086523300007004Agricultural SoilMITGFRERFNPQGIKNRDARPFLDPSFVQKAAERLKLGKK*
Ga0075435_10092975813300007076Populus RhizosphereGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK*
Ga0075435_10161667223300007076Populus RhizosphereGVPVRWEAGIESMITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK*
Ga0075418_1176160013300009100Populus RhizosphereRFNPQGIRNRDAKGSIDASFVQRAAERLKLQKSKP*
Ga0075418_1305875913300009100Populus RhizosphereIEGMITGFHERFNPQGIKNRDAKPFLDPSFVQKAAERLKLDKK*
Ga0114129_1231331323300009147Populus RhizosphereMITGFHERFNPQGIKNRDAKSFLDASFVQKAVERLKLGKK*
Ga0111538_1310930223300009156Populus RhizosphereMITGFHERFNPQGIKNREAKPYLDPSFVQKAVERLKLGKK*
Ga0105241_1173827213300009174Corn RhizosphereITGFHERFNPQGTRNRDAKAFIDASFVQKAAERLKLERTNRP*
Ga0126380_1173298123300010043Tropical Forest SoilERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK*
Ga0126372_1080357323300010360Tropical Forest SoilFHERFNPQGIKNHDPKPFLDPSFVQKAVERLKLGKK*
Ga0126372_1153778823300010360Tropical Forest SoilVCRFQEAGIESMITGFHERFNPQGIKNRNAKPFIDPSFVQRAAERLKLVKSDRS*
Ga0134124_1297715313300010397Terrestrial SoilWEAGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP*
Ga0134122_1093742413300010400Terrestrial SoilAGIESMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLERK*
Ga0134123_1080683223300010403Terrestrial SoilFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGRTNRP*
Ga0137454_107371223300011406SoilMLENEYGSLPWQAGIESMITGFHERFNPQGIKNRDASSSLDASFVQKAAERLKLGKK*
Ga0137446_112122423300011419SoilGIEGMITGFHERFNPQGIKNRDARPFLDSSFVQKAAERLKLDKK*
Ga0137425_113046513300011422SoilNGFHARFTPALIKNRDARPYLDPSFVQRAVERLGLVKK*
Ga0137448_100478913300011427SoilGLPFPWQAGIEGMITGFHERFNPQGIKNRDARPFLDSSFVQKAAERLKLDKK*
Ga0137438_125322713300011431SoilGGLPFPWQAGIEGMITGFHERFNPQGIKNHDAKPFLDPSFVQRAAERLKLDRK*
Ga0137458_110216413300011436SoilGLPFPWQAGIEGMITGFHERFNPQGIKNRDARPYLDSSFVQKAAERLRLDKK*
Ga0137427_1017628533300011445SoilPWQAGIEGMITGFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK*
Ga0137388_1143142613300012189Vadose Zone SoilGYHARFTPAVVKNRDARPFLDPSFVQRAVDRLGLSRKQ*
Ga0137365_1117673823300012201Vadose Zone SoilGGLPFPWQSVIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ*
Ga0137366_1103110123300012354Vadose Zone SoilQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ*
Ga0137368_1006290033300012358Vadose Zone SoilWEAGIESMISGFHERFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK*
Ga0137397_1009264413300012685Vadose Zone SoilTGFHERFSPQGIKNRDAKPYLDPSFVQKAVERLKLGKK*
Ga0137394_1094964623300012922Vadose Zone SoilGGLPFPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ*
Ga0137407_1134797413300012930Vadose Zone SoilPWEAGIESMITGFHERFNPQGIKNRDAKPYLDPTFVQKAVERLKLGKK*
Ga0137410_1090864223300012944Vadose Zone SoilHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK*
Ga0137410_1122102113300012944Vadose Zone SoilEGIESMINGFHGRFSPTVVKNRDARPYLDPSFVQRAVERLGLAKK*
Ga0164304_1040332323300012986SoilGGIPIPWEAGIESMITGFHERFSPQGIKNRDAKPYLDPTFVQKAVERLKLGKK*
Ga0157378_1071968813300013297Miscanthus RhizosphereRFNPQGTRNRDAKAFIDASFVQKAAERLKLGRTDRP*
Ga0075326_103718833300014271Natural And Restored WetlandsESMITGFHERFNPQGVKNRDAKPYLDPSFVQNAVERLKLNKK*
Ga0075323_100290623300014301Natural And Restored WetlandsVSTPWEAGFESMITRFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK*
Ga0180090_110136223300014866SoilPFPWQEGIESMINGFHARFTPALVKNRDARPYLDPSFVQRAVDRLGLAKK*
Ga0180065_115840323300014878SoilMLENENGPLPWQAGIEGMITGLHERVNPQGIENRDASASLDGSFVQK
Ga0132257_10091428523300015373Arabidopsis RhizosphereIESMITGFHERFNPQGIKNREAKPYLDPSFVQKAVERLKLGRK*
Ga0132257_10463773413300015373Arabidopsis RhizosphereIESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVEQLKLGKK*
Ga0132255_10507128623300015374Arabidopsis RhizosphereGIPIPWEAGIESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK*
Ga0182040_1023194623300016387SoilQSGIEGMITGFHERFNPQGIKNHDAKPYLDPSFVQRAAERLKLDKK
Ga0182037_1100875723300016404SoilFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK
Ga0182039_1196527323300016422SoilGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK
Ga0184635_1006434013300018072Groundwater SedimentEGMITGFHERFNPQGIKNRDARPYLDPFFVQKAAERLKLNKSRQ
Ga0184635_1025294713300018072Groundwater SedimentFPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKGRQ
Ga0184640_1005282423300018074Groundwater SedimentMITGFHERFNPQGIKNRDARPYLDSSFVQKAAERLKLDKK
Ga0184639_1024510223300018082Groundwater SedimentFHERFNPQGIKNRDARAYLDSSFVQRAAERLKLDKK
Ga0190275_1073368223300018432SoilFGIESMITGFHERFNPQGIKNREAKAFVGPTFVQKATERLKLSGK
Ga0190264_1101587513300019377SoilMITGFHERFNPQGIKNRDAKPFLDPSFVQKAVERLKLKK
Ga0163153_1001276823300020186Freshwater Microbial MatMITGFHERFNPHGIKNRDAWASLDASFVQKTAERLKLKK
Ga0163153_1005715743300020186Freshwater Microbial MatMITGFHERFNPQGIKNRDASASLDASFVQKAAERLKLGKR
Ga0210379_1027099823300021081Groundwater SedimentPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRR
Ga0222622_1006244013300022756Groundwater SedimentISGFHERFNPLGIKNRDAKPFLDPSFVQKAVERLKLSQK
Ga0222622_1066262423300022756Groundwater SedimentGLPFPWQSGIEGMITGFHERFNPQGIKNRDARPYLDPSFVQKAAERLKLDKSRQ
Ga0209619_1002173813300025159SoilITGFHERFNPQGIKNRDAKPFLDSSFVQRAGERLKLSGK
Ga0210143_107290513300025792Natural And Restored WetlandsVSTPWEAGFESMITGFHERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK
Ga0207645_1090716123300025907Miscanthus RhizosphereGIEGMITGFHERFNPQGIKNRDARPYLDPYFVQKAAERLRLDKK
Ga0207660_1021983533300025917Corn RhizosphereERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP
Ga0207657_1002360713300025919Corn RhizosphereAGIESMITGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP
Ga0207646_1181148213300025922Corn, Switchgrass And Miscanthus RhizosphereTGFHERFNPQGIKNRDARPYLDPSFVQKAAERLRIDKK
Ga0207681_1109040713300025923Switchgrass RhizosphereITGFHGRFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP
Ga0207665_1157471613300025939Corn, Switchgrass And Miscanthus RhizosphereMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK
Ga0208775_100107323300025992Rice Paddy SoilVSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK
Ga0208415_100589823300025993Rice Paddy SoilMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK
Ga0208284_102538223300026003Rice Paddy SoilVSTPREAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK
Ga0208531_101452813300026020Rice Paddy SoilIGGVSTPWEAGFESMITGFYERFNPQGIKNRDAKPYLDPSFVQKALERLKLGKK
Ga0208422_104694113300026053Natural And Restored WetlandsGFHERFNPQGIRNHDAKPFLDPSFVQKAVERLKLGKK
Ga0207676_1256399023300026095Switchgrass RhizosphereGFHERFNPQGIRNRDAKAFIDASFVQKAAERLKLGGTNRP
Ga0209731_105631513300027326Forest SoilGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK
Ga0209818_105173813300027637Agricultural SoilAGIESMITGFHERFNPQGIKNRDAKAFLDPSFVQKAAERLKLGKK
Ga0209592_121322523300027731Freshwater SedimentMITGCHERFNPQGIKNRDASASLDSSFVQKAAERLKLGKM
Ga0207428_1066072313300027907Populus RhizosphereGVPIPWEAGIESMITGFHERFNPQGIKNRDVKPYLDPSFVQKAVERLKLGKK
Ga0209382_1003843413300027909Populus RhizosphereGIESMITGFHERFNPQGIKNRDVKPYLDPSFVQKAVERLKLGKK
Ga0209382_1018386713300027909Populus RhizosphereMISGFHERFNPQGIKNRDARSYLDPSFVQKAAERLRLDKK
Ga0307302_1040691823300028814SoilIESMITGFHERFNPLGIKNRDAKPFLDPSFVQKAVERLKLSQK
Ga0307308_1049796823300028884SoilIGGVPLPWEAGIESMITGFHERFNPQGIKNRDAKPFIDPSFVQKAVERLKLGKK
(restricted) Ga0255311_107892823300031150Sandy SoilTGFHERFNPQGIKNRDARPYLDSSFVQKAAERLKLERK
Ga0307469_1110924813300031720Hardwood Forest SoilESMITGFHERFNPQGIKNRDAKPYLDPSFVQKAVERLKLGKK
Ga0307470_1037105613300032174Hardwood Forest SoilGLPFPWQSGIEGMITGFHERFNPQGIRNRDAKPYLDPSFVQKAAERLKLDKK
Ga0307471_10029138133300032180Hardwood Forest SoilFPWQSGIEGMITGFHERFNPQGIKNRDAKPYLDPSFVQKAAERLKLDKK
Ga0307471_10070977613300032180Hardwood Forest SoilMINGYHARFTPAVVKNRDARPFLDPSFVQRAVERLGIGKKQ
Ga0316601_10054938423300033419SoilMITGFHERFNPQGIKNRDASAALDPSFVQKAAERLKLGKK
Ga0364942_0234827_422_5983300034165SedimentQYDAINGLPFPWQAGIEGMITGFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK
Ga0364932_0183124_2_1393300034177SedimentAGIEGMITDFHERFNPQGIKNRDAKPYLDSSFVQKAAERLKLDKK
Ga0364943_0143113_746_8563300034354SedimentFHARFNPQGIKNHDAKPFLDPSFVQKAVERLKLGKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.